(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE51

PENCW_16.PE51        Location/Qualifiers
FT   CDS_pept        join(complement(114651..114856),complement(114095..114554))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824090"
FT                   /orf_name="Pc20g00510"
FT                   /product="Putative uncharacterized protein Pc20g00510 "
FT                   /protein_id="CAP85380.1"
FT                   /db_xref="UniParc:UPI0001831AB5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFN9"
FT                   /transl_table=1
FT                   /translation="MSAATSSASTTHATGSLQDPTKLSSWVTEAQDAKKTPLLFSCIYG
FT                   IYLLGRIVVLLVANALKKRESQAEKDAKCSECPTARSRILELEQRVRIAELSARDANSR
FT                   AERFAVQVRRANELAEEFQRRAMAVEERVGDWRNFEFSANEVGSLHSPQTPSRHSPASS
FT                   AQSQPDSLKTQIKQSRVVSWTRSISRSVRRAVRPRRHKRSETLEAGQQFSKVRNSRSN"
     atgtctgctg ctaccagttc agcgtccacc acccatgcca ctggttccct ccaagaccct        60
     acgaagctca gttcatgggt tacggaggct caggatgcaa agaagacccc tttgctattc       120
     tcgtgcatct acgggatcta tcttttaggc cggattgtcg tccttctcgt ggccaatgcc       180
     ctcaagaaga gagagtcaca agcagagaag gatgccaagt gcagtgaatg ccccaccgca       240
     agaagccgaa tcctggagct tgagcaacgg gttaggatcg cagagctctc cgccagggat       300
     gccaactcac gcgctgagag atttgcagtg caagtgagac gggcaaatga actagcggaa       360
     gagtttcagc gacgagctat ggcggttgag gagcgggtag gtgactggag gaatttcgag       420
     ttttccgcca atgaagttgg cagtttgcac tcaccccaga ctcctagtcg tcattctcct       480
     gcttcttctg ctcagtccca acccgattcc ctgaagaccc aaatcaagca atcccgggtg       540
     gtaagctgga cacgctccat ctcacgctcc gtcagacgcg ccgtgcgccc ccgccgtcac       600
     aaaaggagtg agactttgga ggctggtcag caattttcca aagttcgcaa ctctcgttct       660
     aattga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page