(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE52

PENCW_16.PE52        Location/Qualifiers
FT   CDS_pept        <115351..>115918
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200305" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824091"
FT                   /orf_name="Pc20g00520"
FT                   /product="Pc20g00520 protein"
FT                   /protein_id="CAP85381.1"
FT                   /db_xref="UniParc:UPI0001831AB6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP0"
FT                   /transl_table=1
FT                   /translation="MSTPYDFDRQKESDISKIVPKLKGESNFAQWQHRLYMALRGNNKT
FT                   YVHLIQGTVNKPTPPDLYDESVETVRELAQHRATSAVFASGSSDPIAPVSDVVVRELVK
FT                   EQKQKNKELLREYQVLVDKWDLFNIHCCNQIFSTLDTIPASYVHNVENPRDAYKLLRAE
FT                   YGSSPWQGDFKRFEVLINLQHKNNNS"
     atgtcgaccc cttacgattt cgatcgccaa aaggaatccg atatctccaa gatcgtcccc        60
     aagctaaagg gtgaatccaa tttcgcccaa tggcaacaca gactgtacat ggccctgaga       120
     ggaaacaaca agacttacgt ccacctcata caaggcactg taaacaaacc cactcccccg       180
     gacctctatg acgaatccgt cgagactgtg cgagaacttg ctcagcatag agctactagt       240
     gctgtctttg cttcaggttc tagtgatcca attgctcctg tctctgacgt tgtcgtccga       300
     gagcttgtta aggaacaaaa gcagaagaac aaggagctac tcagggaata tcaggtcctc       360
     gttgacaaat gggacctgtt taacattcac tgctgcaatc agatttttag cacccttgac       420
     actatccctg cttcctatgt gcataatgtg gagaatccac gagatgcata caaacttctt       480
     cgcgctgaat atggttcctc accctggcag ggtgatttca agcgtttcga ggttctcatc       540
     aatcttcaac acaagaacaa caacagca                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page