(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE55

PENCW_16.PE55        Location/Qualifiers
FT   CDS_pept        join(complement(127837..127928),complement(127738..127777),
FT                   complement(127137..127679),complement(126743..127084),
FT                   complement(126561..126695),complement(126441..126507),
FT                   complement(126253..126384),complement(125857..126206),
FT                   complement(125648..125793),complement(125485..125592),
FT                   complement(125126..125432),complement(124924..125077),
FT                   complement(124519..124851),complement(124381..124463),
FT                   complement(124198..124329),complement(123775..124131),
FT                   complement(123678..123723),complement(123529..123625),
FT                   complement(123274..123422),complement(123134..123213),
FT                   complement(122902..123098),complement(122771..122830),
FT                   complement(122508..122568))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946691"
FT                   /orf_name="Pc20g00550"
FT                   /product="Pc20g00550 protein"
FT                   /EC_number="3.6.3.8"
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85384.1"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831AB9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP3"
FT                   /transl_table=1
FT                   /translation="MGSRPQSPSGTGPVDLSMPRNRLRRDSMRSSMSVVSDVEMARNEV
FT                   FDGPISESIPSSVVSFAHRRDRAGSTVSFTYFQDEEDFAEWSNEDEDVVDEEGEDDEES
FT                   LHGIRDPDLESARGSFVSKRMSTSRDSVEHPLLSRYLSASSYGRDRRSGSRLNQKVYIA
FT                   SEDLTAVFAGFSTSSGGFAVYIALCILTGGFAWLLFRWLPRWRVKLIGKATPIGKCQWV
FT                   AIEDQWNQFTIHGVDSQIYGRPLSTVFADSPSHGYDEDNDPNIDSLRFIDYRYLKFFYH
FT                   PIEDKFSLINGWKDPSWTNAKVMRSGLDADERDSREQIFGSNAIEIEQKTIPQLLVDEA
FT                   FHPFYIFQIASLVLWSMDEYYYYAVCIFLISFFSIATTVLETKSTMSRLREISLFECDV
FT                   RVLRNGFWRSVSSQELVPGDVYEFSDPSLHQVPCDCILLSGDSIVNESMLTGESVPVSK
FT                   TPLTDDALKYLDLSTPSIHPQVAKHFLFSGTKVIRARRPQNVDEDEAVALAVVMRTGFL
FT                   TTKGALVRSMLFPKPSGFKFYRDSFRYIAVMAIVALLGFVASFINFVRLGLAWHLIIIR
FT                   ALDLITIVVPPALPATLTIGTNFALSRLKKQNIFCISPQKVNVGGKLDIVCFDKTGTLT
FT                   EDGLDVLGARIVTRGKRFSELLSETSDGFLCPSQNVDSECDIEKQRNIMYAMATCHSLR
FT                   VVDDELLGDPLDVKMFQFTNWRFEEGGNHVSDQTNPKYDTIAPSVAKPPQRHIGDEQDV
FT                   NDSLELGVLRSFEFVSNLRRASVIVRKFGDNGASFFVKGAPESIKDICIPGTLPSDYED
FT                   LLNYYTHKGYRVIACASKYERKLSWMKAQKMTRTDAESDLEFLGFIIFENKLKPSTAGV
FT                   ISELNEAGIRNVMCTGDNILTAISVARECNMLGRDELCFIPHFIEEPGISSKISLIWEC
FT                   VDNPDLQLDPRTLLPMNDAEVDLSIPGNVLTEREYSVAVTGDAFRWLVDFGNEDVLKKV
FT                   LVCGKVFARMSPDEKHELVEKLQSIDYCCGFCGDGANDCGALKAADVGISLSDAEASVA
FT                   APFTSRLFEISCVPTVIKEGRAALVTSFSCFKFMSLYSAIQFSSVSFLYTSGSNLGDFQ
FT                   FLFIDLVLIMPIAVFMGWADPAPTLSRKRPTADLVSRKVLTPLLGQILFLPPQLDLEKS
FT                   NIVNSENTALFLFSCFQYIFISIVLSAGPPFRKPMTQNGPYLFTIIVNTMISGYMLFRP
FT                   SNWVSEMLATRASIRYLRSVLDSREEHIPTCGTDAWTRSCPLAAKLPQKAQDVQSAVGG
FT                   IAPMKYAFKAPTLGSASANRATELPFQKIEKKGGPKGASSPTERDHPSWPGT"
     atgggaagcc gtccgcagtc tccctcgggg actggtcccg tggacctctc tatgcctcga        60
     aatagactgc gacgcgattc catgagaagc agtatgagcg tcgtgtcgga tgtggagatg       120
     gcccgtaatg aggtcttcga tggcccgata tcggagagca ttccttctag cgtcgtctcg       180
     ttcgcgcacc gccgtgatcg agcaggctct acggtgagct ttacatactt tcaggacgag       240
     gaagacttcg cagaatggtc gaacgaagat gaggatgtag tggatgagga aggcgaggac       300
     gatgaagaat ctctacatgg gatcagggac ccagatcttg agtcagctag gggatccttt       360
     gtgtctaagc ggatgtctac ctcgcgcgac tcggttgaac atccacttct ttctcgctac       420
     ctatccgcca gctcgtatgg ccgagaccgg cgatccggca gtcggttgaa tcaaaaagtc       480
     tatattgcgt cggaggatct gacagctgtc tttgctggct tttccacgag ttcgggaggg       540
     tttgctgtct atattgccct ttgcatcttg accggtggat ttgcctggct cctcttccga       600
     tggctgccac gatggcgggt aaagttgatt gggaaggcaa ccccgatagg gaaatgccag       660
     tgggtggcta tcgaggacca atggaaccaa ttcaccatcc acggagttga cagccaaatc       720
     tatggacgtc cgctttccac ggtcttcgct gactcgccaa gtcacggcta cgatgaggat       780
     aatgacccga atatcgactc tctacgcttc attgactatc gatatctgaa attcttctat       840
     catccaatcg aggacaaatt ttctttgata aatggctgga aagatccctc gtggactaat       900
     gccaaggtta tgcgaagcgg attggatgcc gacgaacgag acagcaggga acagatattt       960
     ggaagcaacg ccatcgaaat tgagcaaaag acaattcctc agcttctcgt cgacgaggcc      1020
     tttcatcctt tctatatctt ccaaattgcc agtctcgttc tgtggtccat ggatgagtat      1080
     tactactacg ccgtctgtat ctttcttata tcatttttca gcatagcaac gactgtgcta      1140
     gagacaaaat caacaatgag tcggctcagg gagatatctc tcttcgagtg tgatgttcgt      1200
     gttttaagaa atgggttctg gcggtctgtc tcctcacaag agctggttcc tggtgatgtg      1260
     tatgaattct ccgacccatc ccttcaccag gtcccgtgtg actgtatctt gttgtcaggg      1320
     gacagcattg tgaatgagag catgctcacc ggtgaatccg ttcccgtgtc taagacacca      1380
     ctcactgatg acgccctcaa atacctcgac ctcagtaccc cttccatcca cccccaggtt      1440
     gctaagcact tccttttcag cggaacgaaa gtaattcggg ctagacgacc ccaaaatgtt      1500
     gacgaagatg aagcagtagc attggcagtc gttatgagaa ccggcttttt gacgaccaag      1560
     ggggctctag ttcgatcgat gctttttcca aagccttctg gattcaagtt ctatcgagac      1620
     tcgttccgct acatcgctgt gatggcgatt gtcgcccttc tcggatttgt tgcttcattc      1680
     attaactttg ttcgattggg tcttgcttgg catctgatca taatccgagc cctcgatttg      1740
     atcacgattg ttgtaccgcc agctctccca gccacactta ccatcggaac caattttgcg      1800
     ctttcaaggc tgaaaaagca gaacatattc tgtatcagcc cacagaaggt caatgtggga      1860
     ggaaagctgg acattgtttg tttcgataaa actggaaccc tcacagaaga cgggctggat      1920
     gtgctaggag cccgtatagt gacccgtggc aaaaggtttt cagagttgct ctctgagacg      1980
     tcagacgggt ttctttgccc ttcccaaaat gtcgactccg aatgcgatat cgaaaagcaa      2040
     aggaacatca tgtacgccat ggctacatgc cattccctca gggtagtgga cgatgagctg      2100
     ttgggagatc ctctcgatgt gaagatgttc caattcacca actggaggtt tgaggaggga      2160
     gggaatcatg tttccgacca gacaaacccc aaatacgaca ccatagcgcc gtcagttgca      2220
     aagccccctc aacgacatat cggtgacgaa caggatgtaa atgactctct cgagcttgga      2280
     gtgctgcgga gtttcgaatt tgtctccaat cttcgccgcg caagtgtcat cgtcaggaag      2340
     tttggtgaca atggagcaag tttctttgtc aagggtgccc cggaaagcat caaggacata      2400
     tgtattcctg gaacacttcc ttcggactat gaggacctcc tgaactacta cacacacaaa      2460
     ggataccgtg tgattgcctg cgcttccaaa tacgaacgaa agctgagctg gatgaaagcc      2520
     caaaaaatga cgcggacgga cgccgaatcc gacctggaat tcctgggctt cattatattc      2580
     gagaacaagt tgaaacccag tactgccggt gtgatttctg agttgaacga ggcgggcatc      2640
     cgcaatgtaa tgtgcaccgg tgataacatc ttgactgcca tcagcgttgc tcgtgaatgc      2700
     aacatgcttg gacgtgatga actatgcttc attccgcact ttattgaaga acctggtatt      2760
     tcatccaaga tttctctcat atgggaatgt gtggacaatc ccgacctcca gttggatccc      2820
     agaacactct tgcctatgaa cgacgcggag gtcgacctgt caattccagg aaacgttctc      2880
     accgagcgtg aatactctgt cgctgtcacg ggtgatgcct ttaggtggtt ggttgacttc      2940
     gggaatgaag atgtactcaa aaaggtgctt gtatgcggca aagtgtttgc tcgtatgtcc      3000
     ccagacgaga agcacgaact ggttgagaag cttcaatcta tcgattattg ctgtggcttt      3060
     tgcggcgacg gtgccaatga ttgtggcgct ctgaaggctg cagatgttgg tatctcattg      3120
     tcggacgccg aggcgtccgt tgccgcgccc tttaccagtc gcctgttcga aatctcctgt      3180
     gttccgacgg tgattaagga gggtcgagct gctctggtga caagcttctc ctgtttcaag      3240
     ttcatgagtc tttattccgc cattcagttc tcctcggtta gcttcctgta cacgtcgggg      3300
     tcaaatcttg gtgatttcca gttccttttt atcgaccttg tgctcattat gcccattgca      3360
     gtcttcatgg gttgggctga tcctgctccc acgctgtctc ggaaacggcc aactgctgat      3420
     cttgtgtcgc gtaaggtatt gacacctttg ctcgggcaga tattgttctt gccgccacaa      3480
     ctggacctgg aaaagagcaa catcgtcaac tcggagaata cggctttgtt cttgttttcc      3540
     tgtttccagt acatcttcat cagtattgtt ctgagcgccg gtccaccatt ccggaaacca      3600
     atgacccaga atgggccgta tttgtttacg atcatcgtca acaccatgat ctctggctat      3660
     atgctcttta gaccatccaa ctgggtgtcg gagatgctgg ctactcgcgc tagcattcgg      3720
     tatcttcgtt ctgtcctgga cagcagagaa gaacatattc ccacgtgtgg cacagatgct      3780
     tggacacgct cgtgcccgct tgcagccaaa ctaccgcaaa aagcgcaaga tgtacaaagt      3840
     gctgttggag gcattgcgcc tatgaaatac gcttttaaag cacccacatt aggctccgcc      3900
     tcggccaata gggccacaga gttaccattt cagaaaattg aaaagaaagg tggtcccaag      3960
     ggtgcttcca gcccaacaga gcgggaccat ccttcttggc ccggtacatg a               4011
//

If you have problems or comments...

PBIL Back to PBIL home page