(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE56

PENCW_16.PE56        Location/Qualifiers
FT   CDS_pept        join(129123..129169,129251..129330,129393..130100,
FT                   130159..130499,130552..130602)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171827" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946692"
FT                   /orf_name="Pc20g00560"
FT                   /product="Pc20g00560 protein"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85385.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="UniParc:UPI0001831ABA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP4"
FT                   /transl_table=1
FT                   /translation="MSEPIRNKKADFPVAPTPQNTPANNAPISSHAQQPGVSSIEEESL
FT                   DKAAAASLFARNPALVSMIQGKLGQLVGRSSGYIESLPPSVRRRVAGLKGIQKEHSKLE
FT                   AQFQEEVLELEKKYFGKFTPLYQRRSTIINGGVEPTEAEVEAGKEDEESDEEETKEEPK
FT                   KEEAETANGIPEFWLSAMKNQISLAEMITERDEEALKHLTDIRMEYLDRPGFRLIFEFS
FT                   ENEFFTNKTISKTYFYKDESGYGGDFIYDHADGSQIDWKEDKDLTLRLESKKQRNKNTK
FT                   QTRVVKISVPTESFFNFFSPPQPPSEDDESVASDIEERLELDYQLGEDIKEKLIPRAID
FT                   WFTGEALQFEELGEDFDGDEFEDDDDEEEEDDEDEEDLGSDRDVDEEDTDEEDGTSKPK
FT                   KEAAECKQN"
     atgtctgagc ccatcagaaa caagaaggcg gacttcccgg tcgcaccgac cccgcaaaac        60
     acaccggcca acaatgctcc catctcgtct cacgctcagc agcctggtgt atccagcatc       120
     gaggaggaat cccttgacaa agccgccgct gcctcgctct tcgcccgcaa ccctgctctg       180
     gtctccatga tccaaggcaa gttgggtcaa ctcgtcggtc gctcgtcagg ctacatcgaa       240
     tctctccccc cctccgtccg ccgccgtgtc gctggtctga agggtattca gaaggagcac       300
     tccaagctcg aggctcagtt ccaagaggag gttctggaac ttgagaagaa gtacttcggc       360
     aagttcacgc ccctgtacca gcgtcgttct actatcatca acggcggtgt cgagccgacc       420
     gaggccgagg ttgaggccgg aaaggaggat gaggagagtg atgaggagga gaccaaggag       480
     gaacccaaga aggaggaggc tgagaccgcg aacggcattc ccgagttctg gctttctgcc       540
     atgaagaacc agatctcgct tgctgagatg atcaccgagc gcgatgagga ggctctcaag       600
     cacctcaccg acattcgcat ggagtacctt gaccgacccg gattccgcct catctttgag       660
     ttctctgaga acgagttctt caccaacaaa accatttcca agacatactt ctacaaggat       720
     gagagtggat acggtggcga tttcatttac gaccacgccg atggatccca aattgactgg       780
     aaggaggaca aagacctgac cctccgtctg gagagcaaga agcagcgcaa caagaacacc       840
     aagcagaccc gcgttgttaa gattagtgtg cctaccgagt ccttcttcaa cttcttctcc       900
     cccccgcagc caccctccga ggatgacgag tcagtcgcca gcgacattga agagcgtctg       960
     gagcttgatt accagctcgg cgaggatatt aaggagaagc ttattccccg tgccatcgac      1020
     tggttcaccg gcgaagctct ccagtttgag gagctcggtg aggatttcga tggtgacgag      1080
     tttgaggatg atgatgatga ggaggaggag gacgatgagg acgaggagga tcttgggtcg      1140
     gaccgtgatg tggacgagga ggacacagat gaagaggacg gtacttccaa gcccaagaag      1200
     gaggccgccg agtgcaagca aaactaa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page