(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE57

PENCW_16.PE57        Location/Qualifiers
FT   CDS_pept        join(131371..131505,131602..131734,131791..131980,
FT                   132039..135891,135944..136017,136075..136393)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171839" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946693"
FT                   /orf_name="Pc20g00570"
FT                   /product="Pc20g00570 protein"
FT                   /EC_number="3.6.4.1"
FT                   /function="ATP binding"
FT                   /function="actin filament binding"
FT                   /function="motor activity"
FT                   /cellular_component="myosin complex"
FT                   /protein_id="CAP85386.1"
FT                   /db_xref="GO:0003774"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016459"
FT                   /db_xref="GO:0051015"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="InterPro:IPR018444"
FT                   /db_xref="UniParc:UPI0001831ABB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG04"
FT                   /transl_table=1
FT                   /translation="MAHIYEVGTRAWQPDPTEGWLASEVKEKLEDGEKVQLIFELENGE
FT                   TKTVETTQSELQVDNNPKLPPLMNPAMLEASEDLTNLSHLNEPAVLQAIKLRYAQKEIY
FT                   TYSGIVLIATNPFARVDSLYVPQMVQVYAGKQRASQAPHLFAIAEEAFADMLRDGKNQT
FT                   IVVSGESGAGKTVSAKYIMRYFATRESSDQPGKYTTSRAEAISETEEQILATNPVMEAF
FT                   GNAKTTRNDNSSRFGKYIEIMFDDRTNIIGAKIRTYLLERSRLVFQPLKERNYHIFYQL
FT                   VAGASDAEKQELGLLATEDFEYLNQGGTPVIDGVDDKAEFEATRKSLAVIGVPKEDQTG
FT                   IFRVLAALLHLGNVKITATRTDSSVSSTEPSLLRACEMLGIDATEFAKWIVKKQLITRG
FT                   EKITSNLTQQQALVVRDSVSKFIYSSLFDWLVDKINRRLATDEVLEQFKCFIGVLDIYG
FT                   FEHFAKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVREEIDWTFIDFSDNQPCIDLI
FT                   EAKLGVLALLDEESRLPMGSDEQFVTKLHHHFAADKQKFYKKPRFGKSAFTVCHYAVDV
FT                   TYESDGFIEKNRDTVPDEHLEVLRNSSNPFIKEILDTAAAVREKDSASMSSKPVAAAPG
FT                   RRIGVAVNRKPTLGGIFKSSLIELMHTINNTEVHYIRCIKPNEAKEAWKFEGPMVLSQL
FT                   RACGVLETVRISTAGYPTRWTYEEFAIRYYMLCHSSQWTSEIRDMCHAILRKALGDEKQ
FT                   DKYQLGLTKIFFRAGMLAFLENLRTSRLNECAIMIQKNLRAKYYRRRYLDARDSILTTQ
FT                   AFIRGFLARQHAHEIRRTKAATTIQRVWRGQKEKKRYTQIRKNFILFESVAKGFLCRRN
FT                   IMDSINGNAAKVIQRAFRSWRQLRAWRQYRRKVITIQNLWRGKEARNAYKRLREDARDL
FT                   KQISYKLENKVVELTQYLQTLKLENKTLVSQLDNYDTQLKSWRTRHNALEARTKELQVE
FT                   ANQAGITAARLEAIEEEMSKLQQGHTEAQATIKRLQEEERISREALQTANEELERLKLL
FT                   DADHEKDKTALRQRISDLEEQLEVAKRSVPLNGMNGDGLPNGGAVQTPTPGLINLVSSK
FT                   KPKPKRRSAGAERIETDRFSGAYNPRPVSMAVTPGSMATRQSAAISPGLESVEVELENL
FT                   LSEEEDLNEEVAMGLIRNLKIPLPTSTPPPTEKEVLFPAYLINLVTSEMWNNGFVKESE
FT                   RFLANVMQSIQQEVMQHDGDDAINPGAFWLSNVHEMLSFVFLAEDWYEAQKTENYEYDR
FT                   LLEIVKHDLESLEFNIYHTWMKVLKKKLYKMIVPAIIESQSLPGFVTSETNRFLGKLLP
FT                   SNNNPAYSMDNLLSLLNGVYKAMKAFYLEDAIILQTVTELLRLVGVTAFNDLLMRRNFL
FT                   SWKRGLQINYNITRIEEWCKSHDMPEGTLKLEHLMQATKLLQLKKATLNDIEIIQDICW
FT                   MLSPNQIQKLLNQYLVADYEQPINGEIMKAVASRVTEKSDVLLLAPVDMEDSGPYEIAE
FT                   PRVITALETYTPSWLQTPRLKRLAEIVSAQAMAQQEKLDWDNGVVEE"
     atggcgcaca tttatgaggt cggcacacgg gcctggcagc ccgacccgac agaaggatgg        60
     ctggcatccg aagtgaagga gaagctggag gatggagaga aagtgcagct aattttcgag       120
     ttggaaaatg gagagacaaa aaccgtggag actacgcagt ccgagctgca ggtcgataac       180
     aaccctaaat tacctccgct catgaaccct gctatgcttg aagcaagcga agatttgacg       240
     aatttgtctc acctgaacga gcctgctgtc ctccaggcta taaaactccg ctacgctcag       300
     aaggagatat atacctacag tggtatcgtc ttgatcgcaa ccaacccttt cgcccgagtc       360
     gattcgctgt acgtgccgca gatggtgcag gtttatgctg ggaaacaacg tgcctcgcag       420
     gcgcctcacc tgttcgcaat tgcggaggaa gcttttgctg acatgcttcg cgatggaaag       480
     aatcagacga ttgtggtctc cggtgaatct ggagccggta agaccgtgag tgccaaatat       540
     atcatgcgct actttgcgac tcgcgagtct tccgatcagc ctggaaaata caccactagc       600
     cgcgcagagg caatcagtga aaccgaggag cagatcctag ctaccaaccc ggtcatggaa       660
     gcgttcggta acgccaaaac cactcgcaac gacaactcct cccgtttcgg caagtatatc       720
     gagattatgt tcgatgaccg aacgaatatc atcggagcta agatcaggac gtatcttctt       780
     gagcggtcga gactggtctt ccagcctctc aaggagcgca attaccacat cttctaccag       840
     ctggtagctg gtgcttccga cgcggagaaa caggagctgg gtctcttggc tactgaagac       900
     tttgagtatc tgaaccaggg tggcactcca gtgatcgacg gtgtcgatga caaggctgaa       960
     tttgaggcaa ccaggaagtc gctggctgtg attggtgtgc cgaaagaaga ccagacaggc      1020
     atcttccgtg ttctcgccgc tttgcttcac ctcggtaatg tcaagattac ggctactcgc      1080
     acggattcgt cagtctcgtc gaccgagcct tcacttctcc gcgcgtgtga gatgcttgga      1140
     atcgatgcta ccgagtttgc aaaatggatc gtgaagaagc aacttatcac gcgtggcgag      1200
     aaaatcacct ccaatctcac acagcaacag gctttggttg tccgagactc cgtctccaag      1260
     ttcatctatt caagtctatt tgactggcta gtggacaaga tcaatcgccg cctcgctacc      1320
     gatgaagtgc ttgagcagtt caaatgcttt attggtgttc ttgatattta tgggttcgaa      1380
     catttcgcca agaactcctt cgaacaattc tgcatcaatt atgccaacga gaagttgcaa      1440
     caggaattca accagcatgt gttcaagctt gaacaggaag aatatgtccg ggaagagatc      1500
     gactggacat tcattgactt ttcggataat caaccttgta tcgatcttat cgaagcgaag      1560
     ctcggcgtcc tggccctttt ggatgaagag tctcgacttc ctatgggttc agacgagcag      1620
     tttgtcacca agcttcacca ccactttgcg gctgacaagc agaagttcta caagaaaccc      1680
     cgctttggga agtctgcatt caccgtctgt cactatgcag ttgatgttac ttatgaatct      1740
     gatggattta tcgaaaagaa ccgtgacact gtgccagacg agcatctgga agtgttgcgc      1800
     aattcctcca atcctttcat caaggagatt ctagacactg ccgcggccgt tcgcgagaag      1860
     gactctgctt ctatgtcgtc taagccagtt gcagcagctc cagggcgtcg gattggcgtt      1920
     gcagtcaatc ggaaacccac gcttggagga atcttcaagt cttcgctgat tgaattgatg      1980
     cacaccatca acaacactga agttcattac atccgttgca tcaaacccaa tgaggcaaag      2040
     gaggcctgga aattcgaagg tcccatggtt ctcagtcagc tgagagcttg tggtgtcctg      2100
     gaaactgtcc gaatcagtac tgctggctac ccaacccgat ggacttatga ggaatttgcc      2160
     attcggtact acatgctgtg ccattcttcg caatggacct cggagattcg ggatatgtgc      2220
     catgcaatcc ttcgaaaggc cctcggggat gaaaagcaag ataagtatca gcttggtctt      2280
     actaagatct tcttccgagc tggtatgctc gcattcctgg agaatctccg aacgtctagg      2340
     ttgaatgaat gcgccatcat gatccagaag aacttgcgtg ccaagtacta ccgccgccgc      2400
     tacctcgatg ctcgcgactc aattctcacc actcaggcct tcattcgcgg tttcttggca      2460
     cgccagcatg cccatgagat tcggcgcacc aaggctgcta ctacgatcca gcgggtctgg      2520
     cgtggccaga aggagaagaa gcggtacact caaatccgca aaaacttcat tctgttcgag      2580
     tctgttgcga agggattcct atgccgacgc aacatcatgg actctatcaa tggaaatgcg      2640
     gccaaggtca ttcaacgtgc tttccgctcc tggcgtcaac tccgggcctg gagacagtat      2700
     cgtcgcaaag ttatcactat ccaaaacctc tggagaggaa aagaggccag aaatgcttat      2760
     aagagactcc gtgaggatgc ccgtgatctc aagcagattt cttacaagtt ggagaataag      2820
     gtggttgagt tgacccaata cttgcaaact ctcaagcttg agaataagac cttggtctca      2880
     cagctggaca actacgatac ccaattgaag tcatggagaa cccgacacaa tgccttggag      2940
     gctcgcacga aggaactcca ggttgaagca aaccaggctg gtatcaccgc agcccggtta      3000
     gaggcgattg aagaggagat gagtaagctt cagcaaggcc acactgaagc tcaggctacc      3060
     atcaagcgcc tccaagaaga ggagcgaatc tcccgtgagg ctctccagac cgccaacgag      3120
     gagttggagc gtctcaagct cttggatgcc gaccatgaga aagacaagac tgctctccgg      3180
     cagcggattt ccgatctcga ggagcagctc gaggttgcca agagatccgt gcctttgaac      3240
     ggtatgaatg gtgatggtct acccaacggc ggtgcagtcc agacccctac cccgggcttg      3300
     atcaacttgg tatcttcaaa gaaacccaag cccaagagac gcagtgccgg tgctgaaagg      3360
     atcgagacgg atcgtttcag tggtgcatac aaccctcggc ctgtttcaat ggcggtcacg      3420
     cccggatcta tggctacccg tcaaagtgcg gccatctctc ctggtctaga gtcggtcgag      3480
     gtggagctcg agaacttgct ttctgaagag gaggacttga atgaggaagt cgccatgggt      3540
     cttatccgca acttgaagat tccgctccca acttcgacac cacctccaac tgagaaggaa      3600
     gtcctgttcc cagcatacct gattaacctt gttacgtcgg agatgtggaa caacggattt      3660
     gttaaggagt cggagcgatt cttggccaat gttatgcagt ccatccagca agaagtcatg      3720
     cagcatgatg gggacgacgc gatcaatccc ggtgccttct ggttatccaa cgtgcacgag      3780
     atgctatcct ttgtcttcct ggccgaggat tggtatgaag cacaaaagac cgagaactac      3840
     gagtatgacc gcctgttgga aattgtcaag cacgacctcg agagcttgga attcaacatc      3900
     tatcacactt ggatgaaggt gctgaagaag aagttgtaca agatgatcgt tccagccatc      3960
     atcgagtctc aatcacttcc cggctttgtc accagtgaaa cgaatcgctt ccttggaaag      4020
     cttctgccct ccaacaacaa ccccgcttac agcatggaca acctcctcag tctattgaac      4080
     ggtgtttaca aggcaatgaa ggccttctac cttgaggacg ccatcatcct ccagaccgtc      4140
     acggagctct tgcgcttggt tggtgtcact gctttcaacg atctcctcat gcggcgtaac      4200
     ttcctgtcgt ggaagcgtgg cctgcaaatc aactacaaca tcactcgtat tgaggagtgg      4260
     tgcaagagtc atgatatgcc agaggggacg ttgaagctag agcatttgat gcaagcgacc      4320
     aagcttctgc agttgaagaa ggctactctg aatgatattg agatcattca ggatatttgc      4380
     tggatgctgt ctccgaacca aattcagaaa ctgctgaatc agtacctggt ggcggattac      4440
     gaacagccca tcaacggcga aatcatgaag gccgtcgctt ctcgcgtcac cgagaagagc      4500
     gatgtgctcc tcctggctcc agtagacatg gaggacagtg gcccgtatga gatcgccgag      4560
     ccgcgtgtta tcactgctct ggagacctat accccatcct ggctacaaac accgcggttg      4620
     aaacgacttg ctgagattgt gtccgcgcaa gcgatggcac agcaagagaa gctcgactgg      4680
     gataacgggg tggttgagga atag                                             4704
//

If you have problems or comments...

PBIL Back to PBIL home page