(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE58

PENCW_16.PE58        Location/Qualifiers
FT   CDS_pept        join(complement(136942..137068),complement(136638..136827),
FT                   complement(136435..136570))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946694"
FT                   /orf_name="Pc20g00580"
FT                   /product="Putative uncharacterized protein Pc20g00580 "
FT                   /protein_id="CAP85387.1"
FT                   /db_xref="UniParc:UPI0001831ABC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG05"
FT                   /transl_table=1
FT                   /translation="MTPDDLVWEQAEEIFDKWLLQFLQHDVLRPIGAFIITHERGFGGK
FT                   GGDGIDSRSKVDGDGHQGSIYRGIQMSTLTFHEQFESQEKAKVENSLEKRMDSEPTHDE
FT                   TSHLQQFPEQSLLVYKPRRHMQLKQMKIMRITVSQRPWIIQASRNP"
     atgacccctg atgacctagt ctgggagcaa gccgaagaaa tattcgacaa atggctcctt        60
     caatttcttc aacatgacgt cttaagaccg atcggggcct tcatcatcac tcatgaaaga       120
     ggctttggag gaaaaggagg agatggaatt gatagtcgct cgaaagttga tggagatgga       180
     caccaaggct ctatctatcg tgggatccag atgagtacac tgacatttca cgagcaattc       240
     gagagtcaag aaaaagcgaa agtcgagaac agcctggaaa agcgtatgga tagtgagcct       300
     actcacgatg agaccagtca tttacagcaa ttccctgagc aatctcttct ggtctataag       360
     ccaagacgtc atatgcaatt gaaacaaatg aaaatcatgc gcatcactgt atcgcagagg       420
     ccgtggataa tccaggcaag tcgtaatccg tag                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page