(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE59

PENCW_16.PE59        Location/Qualifiers
FT   CDS_pept        join(137402..137572,137628..137701,137758..137902,
FT                   137956..137992,138054..138118,138171..138239)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000293320" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824092"
FT                   /orf_name="Pc20g00590"
FT                   /product="Pc20g00590 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP85388.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="UniParc:UPI0001831ABD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG06"
FT                   /transl_table=1
FT                   /translation="MTLTKLNFITGNKNKLLEVRAILGKVIEVDNQEVDVPEIQGTIEE
FT                   IAKEKARRAAEAINGPALTEDTALEFHALKGLPGPYIKSFMEKLGHEGLNKMLDGFEDR
FT                   TAEAVCTFAFCRGPGEEPIVFQGRTEGAIVRPRGSGNFGWDAIFEYDGKQTYAEMDKEE
FT                   KNKISHRYKALVKLQQWLAEGQQ"
     atgactctca ccaagctcaa cttcatcacc ggcaacaaaa acaagctcct cgaggtgcgg        60
     gctatcctcg gcaaggtcat tgaagtggac aaccaggagg tcgatgtccc agagatccaa       120
     ggcacaatcg aagagatcgc caaagagaag gccagacgtg ccgccgaagc gatcaatgga       180
     cctgccttga ccgaagacac tgcgcttgag ttccatgcgc tcaagggtct ccctgggcca       240
     tacatcaaat cgttcatgga gaaactgggt cacgagggct tgaacaagat gctcgatggc       300
     tttgaggaca gaactgccga agctgtgtgt acctttgcct tttgccgggg tcccggtgaa       360
     gagcccattg ttttccaggg gagaacagag ggtgctattg tgcggcccag aggctcagga       420
     aactttggct gggatgctat cttcgaatat gatggcaaac aaacatatgc cgagatggac       480
     aaagaggaaa agaacaagat ctcgcaccgg tacaaggcgc tggtgaagtt gcagcagtgg       540
     ctagccgaag gccaacagta a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page