(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE60

PENCW_16.PE60        Location/Qualifiers
FT   CDS_pept        join(complement(138844..139026),complement(138591..138739),
FT                   complement(138331..138532))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224472" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946695"
FT                   /orf_name="Pc20g00600"
FT                   /product="Pc20g00600 protein"
FT                   /function="ATP binding"
FT                   /protein_id="CAP85389.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI0001831B89"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG07"
FT                   /transl_table=1
FT                   /translation="MRTSPNVIITGTPGVGKTVHCEQLAQEIGLKHLSINQVAKDRGCF
FT                   DEYDEELKTWVVDEDKLLDALEDEIPNGGYLIDWHACDLFPKSWIDLVVVLRCPTTDVL
FT                   YDRLSSRGYHEKKLEENVDAEIFGVLADEAREAFDEEIVVELNSEQDSDVDSNCQRIAQ
FT                   WVDSWKQSQAENAD"
     atgcgcactt ctccaaatgt gatcatcacc ggcactcccg gcgtgggaaa gaccgtccac        60
     tgcgagcaac tcgcgcaaga gatcggcctg aagcacctgt ccattaacca ggtcgcaaag       120
     gaccgtgggt gcttcgatga atatgacgag gaattgaaga cctgggtggt cgatgaggat       180
     aagctcctcg atgccctcga agacgaaatt cctaatggtg gctatttaat cgactggcac       240
     gcctgcgatc tcttccccaa gtcttggatc gatctcgtcg tcgtcctccg ctgccccact       300
     acagatgttc tatacgaccg actttcctcg cggggctacc acgagaaaaa gctagaagag       360
     aacgttgatg cagaaatctt cggcgtccta gcagacgaag cgcgggaagc attcgacgaa       420
     gagatcgtgg tagaattgaa cagcgagcag gattcggatg tggactcgaa ctgccagcgg       480
     atcgcgcaat gggtcgattc gtggaagcaa tcgcaggcgg agaatgctga ttga             534
//

If you have problems or comments...

PBIL Back to PBIL home page