(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE63

PENCW_16.PE63        Location/Qualifiers
FT   CDS_pept        join(complement(143385..143935),complement(142882..143325),
FT                   complement(142234..142638),complement(141272..142169))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234943" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946698"
FT                   /orf_name="Pc20g00630"
FT                   /product="Pc20g00630 protein"
FT                   /protein_id="CAP85392.1"
FT                   /db_xref="UniParc:UPI0001831B8C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG10"
FT                   /transl_table=1
FT                   /translation="MFHKRQEHDAEETTRKSRSLWIFRSWSWFPNYAKEPEMQQLTVHS
FT                   DPVRKWIKGVVICSWIIGGVLALNIILTVVAAGLAYSGNSGQMFDFASLYMGKCSTSKY
FT                   WTTGLHLLINILSTALLGASNYCMQCLAAPSREQVDEAHSQKTWVRIGVPNIMDLLRYQ
FT                   TGRRRLLGSILLITSLPIHLIYNSAVYFSIGPTEYSIVAAQDKLIQEHGNSTEFEQCFT
FT                   ENVGMDLPSFNAAIRDGRFNTLSKQECIDIFAQDYASGYGTVVLVTKDPMPQNESVALV
FT                   GTGNRHSFEGGFSQFSWLCDEEYPCTKSIAEEDTQDWSVDALTWSRPTIHLTARSYSID
FT                   HCMTLPVEETCQLFFSPLICLVVIGCNLVKLICALLAARENRKDIFLTTGDAIASFLAK
FT                   PDPATEGVCLLSGSLVKKRTQGWRKYKGRERKSLDLLETKQESPLRLPSRKRWFQAASV
FT                   SRWVYTVLLFVCMLVPSVIVLRLGILNYNKASKSKSIWDSGLGEASSGTTLAGLSISAT
FT                   STGIFSMILMANIPQILVSLAYFFYNGLLTCMLGAVEYDNYATKRKPLRVSWPRGAQRS
FT                   TYYLTLPYRYSIPLLIVSAVLHWLVSQSFFFVQVIPFDRHGVPQERYPEVLVTCGYSPV
FT                   AIIFGIIVGGLLPVVAALMGLRRFRSHMPLAGQCSAAISAACHPMTTAVDHALKPVQWG
FT                   EVPGSVLSHSGFLNTITTDIECDARSSVGSDEQRLPLARELDRNDSRAVGFLHCTFTSE
FT                   DVSEPSTSHLYL"
     atgttccaca agaggcaaga gcacgatgcc gaagaaacaa cgaggaagtc acgatcccta        60
     tggattttta ggtcatggtc ctggtttcca aattatgcaa aagagccgga gatgcaacaa       120
     ctaacggtcc attccgaccc tgttcgcaaa tggataaagg gtgtagtgat ctgctcatgg       180
     atcattggcg gagtcctcgc cttgaacatc atcctcactg tcgtcgctgc tggcctggcg       240
     tattcaggga acagtgggca gatgttcgac ttcgcttccc tctatatggg aaagtgctcg       300
     acttccaaat attggaccac gggcttgcac ctcctgatca acattctcag cactgccctt       360
     ctaggggcaa gcaactactg catgcagtgt cttgcagctc cttcgcgaga gcaggtagat       420
     gaagcccaca gtcaaaagac atgggttcgg atcggcgtcc cgaatataat ggatcttctt       480
     cgctatcaaa cgggcaggcg acgccttctc ggatcgatcc tgctgatcac ctcattgcct       540
     atccatttga tttacaattc agccgtatac ttctcgattg gtccaacaga atactcaatc       600
     gttgcagcac aggataagct tattcaggaa cacggcaact ccacggaatt tgagcaatgc       660
     ttcacagaaa acgtcggaat ggacttgcca tcattcaacg ctgcgatccg tgatgggagg       720
     ttcaacacac tttccaagca agaatgtatt gatatctttg ctcaggacta tgcatctggg       780
     tacggaacgg ttgttctggt gaccaaggac ccgatgcctc aaaacgagtc tgtagccttg       840
     gtagggacag gaaatagaca cagctttgag ggtgggtttt ctcaattcag ttggctgtgt       900
     gacgaagaat atccctgcac caagagtata gccgaagaag acacccagga ctggtcggtc       960
     gatgcattga cgtggtcgcg tcccaccata catttgactg cgcgatcgta ttcaatcgac      1020
     cactgcatga cgctgccggt tgaggagact tgccagctat tcttcagtcc actgatttgc      1080
     ctggttgtaa ttggctgcaa tctagtcaag ctcatctgtg cgctgctagc ggcacgcgag      1140
     aacagaaaag atattttcct caccaccgga gacgcgattg cgtctttcct tgccaaaccg      1200
     gacccagcca ccgagggagt ctgcctactt tcggggtctc tagtcaagaa aagaacacaa      1260
     ggttggcgga agtacaaggg ccgtgaacgc aaatctttag atcttctgga aaccaaacaa      1320
     gagagtccgc ttcgtttacc ttcaaggaaa cgatggtttc aagctgcgag tgtatcacgc      1380
     tgggtatata cggttctcct attcgtgtgc atgctagtcc catccgtcat tgttcttcgt      1440
     ctggggattc tcaattacaa caaagcctcc aaatcaaaga gcatatggga ctccgggctg      1500
     ggagaggcaa gctcagggac cactctagcg ggcttgagca tttccgctac ctcaactggg      1560
     atattttcaa tgattcttat ggccaacata cctcagatac tggtctcgct ggcttacttc      1620
     ttctacaacg gcctgctaac ctgcatgctc ggcgccgtcg agtacgacaa ttacgctaca      1680
     aagcgaaagc ctctccgtgt atcctggccc cgcggtgccc agcgttcaac atactacctc      1740
     acccttccat accgctacag tatcccgttg ctgatagtct ccgctgttct ccattggctc      1800
     gtatcccaga gttttttctt cgtccaggtg atcccattcg accggcatgg agtaccccaa      1860
     gagagatacc cggaagtcct cgttacttgt gggtattctc ccgttgccat cattttcgga      1920
     ataatcgttg gtggcttgct gcccgtcgtc gctgcactta tgggattgcg tcgcttcaga      1980
     tcacacatgc cgctggccgg tcagtgtagt gcggcaatca gcgctgcgtg tcatccgatg      2040
     actacagcgg ttgaccatgc actgaaacca gtacagtggg gcgaagttcc aggcagcgtg      2100
     ttatcgcata gcggcttttt gaacacaata acgacggata ttgagtgtga cgctcggtca      2160
     agtgtcggaa gtgatgagca aaggctacct ttggctaggg agctggatag aaatgattcc      2220
     agggcagtcg gtttcttgca ttgcacattt acttcggaag atgttagtga gccgagcaca      2280
     tcacatctct atctctag                                                    2298
//

If you have problems or comments...

PBIL Back to PBIL home page