(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE64

PENCW_16.PE64        Location/Qualifiers
FT   CDS_pept        join(146670..146797,146849..146929,147003..148252,
FT                   148352..148449)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000293094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671392"
FT                   /orf_name="Pc20g00640"
FT                   /product="Pc20g00640 protein"
FT                   /function="amino acid binding"
FT                   /function="aspartate kinase activity"
FT                   /biological_process="cellular amino acid biosynthetic
FT                   process"
FT                   /protein_id="CAP85393.1"
FT                   /db_xref="GO:0004072"
FT                   /db_xref="GO:0008652"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="UniParc:UPI0001831B8D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG11"
FT                   /transl_table=1
FT                   /translation="MATTILDSNLPVTAQAHSSWVVQKFGGTSVGKFARNIIEQVVEPS
FT                   LVNNRVAVVCSARSSSTKAEGTTNRLLRAARDAESPRSRQYLTLVEAVRLEHVQVAQEE
FT                   LKSVEIRDQVIADITGECERVLKFLEAAQTLGEISARCVDKVMSTGEKLSCRLMAALLQ
FT                   DRGVDSQYVDLAEIIDFPIGPHGLDQDFYNTLAAAFGSKVEACGHRVPVMTGYFGTIPG
FT                   GLLDQIGRGYTDLCAALVAVGTRAQELQVWKEVDGIFTADPRKVPTAHLLPAITPAEAA
FT                   ELTFYGSEVIHPFTMEQVIRARIPIRIKNVMNPKNEGTIIFPDSVAELERTTPGHDPRL
FT                   FRTRSPSLANTPKRPTAVTIKHNILVINVHSNKRSLSHGFFAGIFSVLDKWRLSIDLIS
FT                   TSEVHVSLALHSEMPLLNGNGRDEYQVIDDDLQGALNDLKRYGTVDIIPEMAILSLVGK
FT                   QMKNMIGVAGRMFTTLGENSVNIEMISQGASEINISCVIEERDADRALNIIHTSMFTFL
FT                   D"
     atggctacca cgattcttga ttcaaatttg ccagtgaccg cgcaggccca cagcagctgg        60
     gtcgtgcaga aattcggcgg cactagtgtg ggcaagttcg cgcggaatat cattgagcag       120
     gtggtcgaac ctagccttgt aaacaacaga gttgccgtcg tatgttctgc gaggagcagt       180
     tctacaaaag ctgaaggcac caccaaccgg ctgttgcggg cagcaaggga cgctgaaagt       240
     cctcgttcac ggcaatatct gacattggtg gaagctgttc ggttggagca tgtccaagtc       300
     gcccaggaag aattgaagtc ggtcgaaata agagatcaag tgattgcaga catcaccgga       360
     gaatgcgaac gagtactcaa gttccttgag gccgctcaga ccctggggga gattagtgcg       420
     cgctgtgtgg ataaggtgat gagtaccggc gagaagctga gctgtcggct catggccgcc       480
     ctactacaag accgcggggt tgattcgcag tatgtggatc ttgcagaaat catcgatttc       540
     cccatcggtc cccatggctt ggatcaggac ttttataata ccctggcagc agctttcggc       600
     agcaaagtcg aagcctgcgg acatcgagta cctgtgatga ctgggtactt tggtaccatt       660
     ccaggtggtc tgctcgatca gattggtcgt ggatataccg acctctgcgc cgcccttgtc       720
     gcagtcggaa ctcgcgcgca ggagctgcag gtgtggaagg aggtggatgg tatctttacc       780
     gcggacccgc gtaaagtgcc aacggctcat ctgctcccgg ccatcacccc cgctgaagcc       840
     gctgaattga ctttctatgg atccgaagtc attcatccgt tcaccatgga gcaagtcatc       900
     cgcgcaagga tccctattcg cattaagaac gtcatgaacc caaagaacga aggcactatt       960
     atctttcctg actctgtggc cgaactggag agaaccacac caggacatga cccacgcctg      1020
     ttccggaccc ggagccccag tcttgcgaat acaccgaaac gtccgaccgc agtcaccatc      1080
     aagcataata tcctggtgat caacgtgcat tccaacaagc ggtcgctctc ccatggtttc      1140
     ttcgccggca ttttctcagt attggacaag tggcgtctat ccattgattt gatctcgacc      1200
     agtgaggtcc acgtgtcctt ggcacttcac tcggagatgc cccttctgaa tggaaacgga      1260
     cgggatgagt atcaggtcat tgacgatgat ctccagggag cattgaatga cctgaagaga      1320
     tacggaactg tggacattat ccctgagatg gccattctta gtttggtcgg caagcagatg      1380
     aagaatatga tcggtgtcgc agggcgtatg ttcaccactc tcggggagaa cagcgtgaat      1440
     atcgaaatga tctcgcaagg tgcaagtgaa atcaatatct cctgcgttat tgaagaacga      1500
     gacgccgacc gtgccctgaa tatcatccat acgagcatgt tcaccttctt ggactaa         1557
//

If you have problems or comments...

PBIL Back to PBIL home page