(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE68

PENCW_16.PE68        Location/Qualifiers
FT   CDS_pept        join(complement(156451..156475),complement(156071..156120),
FT                   complement(155712..155998),complement(155566..155653))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671393"
FT                   /orf_name="Pc20g00680"
FT                   /product="Pc20g00680 protein"
FT                   /function="nucleotide binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85397.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR005633"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniParc:UPI0001831B91"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG15"
FT                   /transl_table=1
FT                   /translation="MAPTDNKTGKNKANAAAKAVAKGASLHKSRKVRTSSTFHRPKTLQ
FT                   LSRSPKYPRVSVNHGPALDFNKIVLYPLNTESAMKKIEENNTLVFIVNVKSNKRQIKQA
FT                   LKKLYDVDTVKINTLIRPDGTKKAFARLTPDVDALDIAATKLAIV"
     atggccccca ccgacaacaa gaccggcaag aacaaggcca acgccgccgc caaggcggtt        60
     gccaagggcg cttcgcttca caagtcccgc aaggtccgca cctcgtccac cttccaccgc       120
     cccaagaccc tccagctgtc gcggtccccc aagtaccccc gtgtgtccgt caaccacggc       180
     cccgctctgg acttcaacaa gattgttctg taccccctga acactgagag cgccatgaag       240
     aagatcgagg agaacaacac cctcgtcttc atcgtcaacg tcaagtccaa caagcgccag       300
     atcaagcagg ctcttaagaa gctgtacgat gttgacaccg tcaagatcaa cactctgatc       360
     cgccctgatg gaaccaagaa ggccttcgcc cgtctcaccc ccgatgtcga tgctcttgac       420
     attgccgcca ccaagttggc cattgtctaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page