(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE69

PENCW_16.PE69        Location/Qualifiers
FT   CDS_pept        156841..157692
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946700"
FT                   /orf_name="Pc20g00690"
FT                   /product="Pc20g00690 protein"
FT                   /protein_id="CAP85398.1"
FT                   /db_xref="InterPro:IPR021867"
FT                   /db_xref="UniParc:UPI0001831B92"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG16"
FT                   /transl_table=1
FT                   /translation="MAPQKRSKRPMLLSHSRPRIVKSKDAALSAKATRTLIRTHHRLLK
FT                   VRAQALAAGDEARVSSIDAQIEANGGLESYQIASKLGQSMDRGGDSSKVLIDWIKPQLK
FT                   QWNKAIPKLRVLEVGALSTKNACSTHPALDVTRIDLNSQEPGILKQDFMERPLPSSDDE
FT                   RFNIISLSLVLNYVPDATGRGEMLKHCVKFLTSKCPIELVPSLFMVLPIACVDNSRYLN
FT                   EERLGEILTCLGFRLAQSKRTSKLVFHLWEHTGTYAPKAFKKEELRSGKTRNNFAVILN
FT                   KK"
     atggctcccc aaaaacgatc caagaggccg atgttgttgt cgcatagtcg accacgcatc        60
     gtcaagtcca aggacgctgc tctttcagcc aaggctaccc gaactctgat tcgaacccat       120
     catcgactgc tcaaagtccg ggctcaagct ttggccgccg gggacgaagc ccgagtcagc       180
     agtattgatg ctcaaatcga ggccaatggt ggtctcgaaa gctatcagat cgccagtaag       240
     ctaggtcagt cgatggaccg cggtggggac tccagcaaag tcctcatcga ctggatcaag       300
     ccgcaactga agcaatggaa caaggcgatt ccaaagctcc gggtccttga ggttggagct       360
     ttgagcacca aaaacgcctg ctctacgcac ccggcattgg atgtcacccg gatcgatttg       420
     aattcccaag agccagggat cctcaagcaa gatttcatgg aacgaccttt gccctctagt       480
     gatgatgaac gtttcaacat aatcagtctg tcattggtac tcaactatgt tcccgatgct       540
     acgggacggg gtgaaatgct caagcattgt gtcaaattct tgacgtcgaa atgccctatt       600
     gaacttgtcc ccagtctttt tatggtattg cctatcgcgt gcgtggacaa ctcgcgctac       660
     ctcaacgagg aaagactggg ggagatcttg acttgcctgg gcttccgtct agcacaaagc       720
     aagcggactt cgaagctggt ttttcatctc tgggaacaca ctgggaccta cgcgcctaag       780
     gcttttaaga aggaagagtt gaggtctggc aaaacaagaa acaatttcgc cgtcatcctc       840
     aacaagaagt ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page