(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE7

PENCW_16.PE7         Location/Qualifiers
FT   CDS_pept        join(22478..22653,22684..22818,23041..23110,23218..23382)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946672"
FT                   /orf_name="Pc20g00070"
FT                   /product="Putative uncharacterized protein Pc20g00070 "
FT                   /protein_id="CAP85336.1"
FT                   /db_xref="UniParc:UPI000183182D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER5"
FT                   /transl_table=1
FT                   /translation="MGLCRSSPYRNRRLKECDVDDLENNGEDAQLYTLASMLNYITGRS
FT                   HLPIRHFENKGTQSFKNVNSHGSSWEHAAGYFIRMKYPWSLRPITTGLVLEGRGDGIVR
FT                   KIKESRVIMAWIHAKRAPTGITKYGLYHEMEKTPELKLCKNMIAMGWKGGSWVRRLGHI
FT                   PELPNCSFFGERAMVLSM"
     atgggactat gtcgctcgag cccctataga aacagacggt tgaaagagtg tgatgtcgat        60
     gatttggaaa acaatggcga agatgcgcag ctatatacat tagcaagtat gctaaattac       120
     atcactggca ggagccattt gccaattcgg cactttgaaa acaaaggcac tcagagtttc       180
     aagaatgtca attcccatgg ctcgagctgg gaacatgcag ctggttactt tatccggatg       240
     aagtatccat ggtctttgcg gccaataacc acaggacttg tactagaagg ccgaggtgac       300
     ggtattgtca ggaagatcaa agaatctcgc gtaattatgg catggataca cgccaaaaga       360
     gccccaactg gcatcactaa gtacggtcta taccatgaga tggaaaagac ccctgagttg       420
     aagctctgta agaatatgat agctatgggt tggaaaggtg gttcatgggt aaggcggctg       480
     ggccacattc cagaactgcc aaattgctca ttcttcggag agagagctat ggttctgtca       540
     atgtag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page