(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE70

PENCW_16.PE70        Location/Qualifiers
FT   CDS_pept        join(complement(159741..159892),complement(158717..159687),
FT                   complement(158538..158666),complement(158388..158485),
FT                   complement(158171..158337),complement(157751..158120))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946701"
FT                   /orf_name="Pc20g00700"
FT                   /product="Pc20g00700 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85399.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI0001831B93"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG17"
FT                   /transl_table=1
FT                   /translation="MSRAERTDEDLDNEPVYGSLRIPAAAPSSYDYGHLNSGSPTAESE
FT                   IGGRQRSSSYSIRVRQAGGPNSIDNFARSWQRAAAFPEILPRRSSFVSAHSDDELAIAT
FT                   GQEYGSRSSPSWGRHSDVERPLLRGDSDSDQDDGDTRAPESSKRALPSTGLLSSSFDRS
FT                   FANSYGTISSRVSESTRRHAIQFHREHHPQVHVDGSGDSDRGPLLIKHVQHEDGTEEDI
FT                   VVGQSTLPQTIFNSVNVLIGIGLLSLPLAMKHAGWVLGLVFLIFSAVATSYTAKILAKC
FT                   LDVDRSVVTYADLAYISFGQHARLITSFLFCLELLGACVALVVLFADSLYALVPGLSIL
FT                   QWKIVCGVVLLPLNFLPLRFLSITSILGIISCTSIVVLICIDGFIKPDAPGSLRQPANT
FT                   FLFPENWATVPLSFGLIMSPWGGHGVFPNIYRDMRHPQKYGKSLWVTYIFTFALDCSMA
FT                   IIGWLMFGDIIRDEVTANILTITDYPQSLSVCIVVFISIIPLTKVPLNARPLVATFEVL
FT                   CGLGGGHVPAENGSKTLQKVSRAMVRVFVVATIVILAIVFPAFDRIMAFLGSFLCFTIC
FT                   IIFPLAFYLKIFGKEIGRGEYILDWVLLIVSSILAAVGTVWAFLPQDMLSAN"
     atgtcaagag ccgaaagaac agacgaagat ctcgacaacg aaccggtcta tggctcactg        60
     agaataccgg ctgcggcacc aagctcctac gattatggcc atctgaatag tgggagtccg       120
     acggccgagt cggagatcgg cggtagacag aggtcgtcgt cgtactcaat tcgagtccgc       180
     caagcaggag gtcccaacag tatagacaac ttcgcgcggt cttggcagag agctgcggcc       240
     ttcccggaga tcctcccacg gcggtcgtcg tttgtctctg cgcactcgga tgatgaactt       300
     gccattgcta ctggccagga atatgggtca agaagctccc cgtcctgggg ccgacactcg       360
     gatgtggaac ggcctctgct tcggggggac tcggactctg accaggatga cggggataca       420
     cgagcgccgg agtcctccaa gagggcgctt cctagtactg ggctactttc ttcgtcattt       480
     gatagaagtt ttgcgaactc gtatggtact atctcctcac gggtgagcga gtcgacgcgg       540
     agacatgcga ttcaattcca ccgagagcac catccccagg tgcatgtgga tgggtctgga       600
     gattcggatc ggggcccatt gcttatcaag catgtccaac atgaagatgg gactgaggag       660
     gatatcgtcg ttgggcaatc cacccttccg cagactatct tcaactcggt taatgtgtta       720
     attggtattg gtctgttgag tcttccattg gcgatgaaac atgccgggtg ggttttgggt       780
     ttggtattcc ttatcttctc agcggttgcc acttcctaca cagccaaaat actggctaaa       840
     tgtctggatg tcgaccggag cgttgtcacc tacgctgatc tggcttacat cagtttcggg       900
     cagcatgccc gtttgataac cagttttctc ttctgcttgg aacttttagg agcatgcgtt       960
     gcgctggttg tgctctttgc agacagttta tatgcccttg taccaggatt gagcatcctc      1020
     caatggaaga tcgtctgtgg agttgtacta cttccgctca acttcctgcc gctacgattc      1080
     ctgagtatca ccagcatatt gggcataatt tcgtgcacat caatcgtggt actcatttgc      1140
     atcgatggct ttatcaagcc agatgcaccg ggctccttgc ggcagccggc taatacattc      1200
     ctcttccctg aaaactgggc tactgtccct ctgagttttg gtcttatcat gtcaccatgg      1260
     ggtggccatg gtgtcttccc taacatctac agagatatga ggcaccctca gaaatacggg      1320
     aagagccttt gggtgaccta tattttcaca tttgctttgg actgctcaat ggcgatcatt      1380
     ggttggctca tgtttggcga tatcatccgc gacgaagtca ctgcaaacat cctcaccatc      1440
     accgactacc cgcagtccct atccgtctgt attgtagtct tcatctcgat catccccctc      1500
     acgaaagtgc cattgaatgc tcggcctctt gtggccacat ttgaagttct ttgcggactc      1560
     ggaggcggcc atgtgcctgc cgaaaacggc tcgaagacac tacaaaaagt ctcacgcgca      1620
     atggtccggg tttttgtagt ggccacgatt gttattttgg cgatcgtctt cccggctttc      1680
     gaccgtatca tggctttctt gggatcgttc ttgtgcttca ccatctgtat catcttccct      1740
     cttgcttttt atctcaagat ctttggaaag gaaatcggcc gaggtgagta catccttgat      1800
     tgggttctgc tcatcgtctc ctcgatattg gcagccgtgg ggactgtctg ggccttcttg      1860
     ccacaagaca tgctctctgc aaactag                                          1887
//

If you have problems or comments...

PBIL Back to PBIL home page