(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE71

PENCW_16.PE71        Location/Qualifiers
FT   CDS_pept        join(160884..161004,161059..161108,161167..161538,
FT                   161593..162349,162423..162572,162630..162661,1
FT                   62691..162696)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946702"
FT                   /orf_name="Pc20g00710"
FT                   /product="Pc20g00710 protein"
FT                   /function="translation release factor activity, codon
FT                   specific"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85400.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016149"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniParc:UPI0001831B94"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG18"
FT                   /transl_table=1
FT                   /translation="MSAPPPNEAEKNIEIWKVKKLIKRLESARGNGTSMISLIIPPKDQ
FT                   ISRAAKMLAEEYGTASNIKSRVNRLSVLSAITSTQQRLKLYNKVPPNGLVVYCGEIITS
FT                   EGKERKINIDFEPFKPINTSLYLCDNKFHTEALSELLEADQKFGFIVMDGNGTLFGTLS
FT                   GNTREILQRLTVDLPKKHGRGGQSALRFSRLREEKRHNYVRKIAELAVQNYITNDKPNV
FT                   AGLVLAGSADFKNDLNQSDLFDGRLQSKVIKVVDVSYGGENGFNQAIELAGETLSNVKF
FT                   VQEKKLIGQYFQEISQDTGRVCYGIEDTLKAMELGAAEILIVHENLEITRWVMKNAAGN
FT                   QVIVHTNKVQESQKDLFQDKETGLDMEVVESGSFLEWLAEAYKDFGANLEFVSDRSGEG
FT                   NQFVKGFGGIGAILRYKVNFEQLADLSDDDEFYDESEDERPEAPAASLLTARPVDHASG
FT                   SRDGTKASVKDNQKRPGPRSLKLLRVSSKLQGTHTEV"
     atgagcgccc ctccgccgaa cgaagctgag aagaatatcg agatctggaa ggtcaagaag        60
     ctgatcaagc gtcttgaatc cgctcgtgga aatggaacct ctatgatttc gctcattatc       120
     ccccccaagg atcagattag cagagcagcc aagatgttgg ctgaagagta tggtaccgcc       180
     tccaacatta agtctcgagt gaaccgactt tccgtgctgt cggccattac ctctactcag       240
     cagcgtctga agctctacaa caaggtccct cccaatggac tggtcgtgta ctgtggtgaa       300
     attatcacct ctgaaggaaa ggagcgcaag attaacatcg acttcgaacc gttcaagccc       360
     atcaatacct ccctctacct ttgtgacaac aagttccaca ctgaagcatt gagtgagctt       420
     ctcgaggctg atcagaagtt cggtttcatt gtcatggatg gtaatggtac tttgttcggt       480
     actctcagtg gcaacactcg tgagatcctt cagcgtctga ccgttgatct gcccaagaag       540
     cacggccgtg gtggtcaatc cgctctgcgt ttctcgcgtc tccgtgagga aaagcgtcac       600
     aactacgtgc gcaagatcgc tgaactggct gttcagaact acatcaccaa cgacaagccc       660
     aacgtcgccg gcctggtgtt ggctggttcc gccgatttca agaacgatct taaccagtct       720
     gacctgttcg acggtcgcct gcaatccaag gttatcaagg ttgtcgatgt ttcctacggt       780
     ggcgagaacg gtttcaacca ggccattgaa ttggctggcg agaccctgag caacgtcaag       840
     ttcgttcagg agaagaagct tattggccag tacttccagg agatcagcca agacaccggc       900
     agagtctgct acggtattga agataccctc aaggcaatgg agcttggtgc tgctgaaatc       960
     ttgatcgtcc acgagaactt ggagatcact cgctgggtca tgaagaacgc ggcaggcaat      1020
     caggttattg tccacacgaa caaggttcag gaatcccaga aggacctctt ccaggacaag      1080
     gagaccgggt tggatatgga ggttgtcgaa tcgggatctt tcctcgaatg gcttgccgag      1140
     gcctacaagg acttcggtgc caacctggag ttcgtgtctg accgatctgg cgaaggaaac      1200
     cagttcgtca agggtttcgg tggtatcggt gctattctcc ggtacaaggt caacttcgaa      1260
     cagcttgctg atctcagcga tgatgacgag ttctacgacg agagcgagga tgaacggcca      1320
     gaagctcccg cggcgagtct tttgacggct cgccccgtgg atcatgcaag cggctcccgc      1380
     gatggaacca aggcatccgt aaaggataac cagaaaaggc ctggtccacg ctcattgaag      1440
     ctgctcagag tgtcgtccaa gctccaaggt acgcacactg aggtttaa                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page