(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE72

PENCW_16.PE72        Location/Qualifiers
FT   CDS_pept        join(complement(164091..164144),complement(163128..164027))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000018970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946703"
FT                   /orf_name="Pc20g00720"
FT                   /product="Pc20g00720 protein"
FT                   /function="prephenate dehydratase activity"
FT                   /biological_process="L-phenylalanine biosynthetic process "
FT                   /protein_id="CAP85401.1"
FT                   /db_xref="GO:0004664"
FT                   /db_xref="GO:0009094"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="UniParc:UPI0001831B95"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG19"
FT                   /transl_table=1
FT                   /translation="MAPFKVAFLGPLGSFSHQAAAESFCKLSADLQPQVSFPDAFAALQ
FT                   KKEVDYAVIPCENSTNGSVMQTLDLLADRDGSYKDVKVCGEYYLTVHHFLMVRKGTYPG
FT                   GWAEYDGSITKLYTHPQAWGQCEAFLTKYFKGIERQDVTSTSKAAEIVSKETTERGAAI
FT                   ANRFAAEQHGTDVLVENIEDRADNTTRFLIFRNVLDERTSEFKFEQPNPPTLEGELALE
FT                   TTHKTLISFTIDHSSPGALANALLIFKAHGLNLTSINTRPSLKKPWQYIFFVECGRTPS
FT                   DENKEAVHKALNDLRQVTETCRDLGTWKDQLSASNA"
     atggctccct tcaaagttgc cttcttaggg ccgctggggt ccttttcgca tcaggctgct        60
     gcagagtcct tttgcaaatt atccgccgat ctacaacctc aagtctcatt cccagatgcc       120
     ttcgccgcgc tccaaaagaa agaagttgac tacgccgtga ttccgtgcga gaactcgacc       180
     aatggctctg tgatgcagac attagacctt ttggcggacc gggatggttc atataaagac       240
     gtgaaagtgt gcggggaata ttacttgaca gtgcaccatt ttttaatggt gcgcaagggc       300
     acataccccg gtggttgggc agaatacgac ggctctataa ccaagctata cacacacccg       360
     caggcatggg gccagtgcga agctttcttg accaaatact tcaagggaat cgagagacag       420
     gatgtcacgt ccacatccaa ggcagcggag atcgtctcta aggagacaac ggaacggggc       480
     gctgccattg ccaatcgctt cgcggcagaa caacacggga cagatgtgct tgtggaaaat       540
     atcgaggacc gagcagacaa tactacccgc ttcctgatct tcaggaatgt gcttgatgag       600
     cgaacttcgg agttcaaatt cgagcagccg aacccgccta cattggaagg cgagcttgcc       660
     cttgaaacta cgcacaagac cttgatttct ttcacgattg atcattcatc tcccggtgca       720
     ttggcaaatg cgctgttgat cttcaaggct catggcttga atcttacgag cattaacaca       780
     aggccaagtc taaagaagcc ttggcagtat atctttttcg ttgagtgtgg aaggacaccc       840
     tcggatgaga acaaagaggc agtccacaag gctctcaatg atttgcgtca agtcactgag       900
     acatgtaggg acctggggac ctggaaagat cagctaagtg caagcaatgc ttga             954
//

If you have problems or comments...

PBIL Back to PBIL home page