(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE73

PENCW_16.PE73        Location/Qualifiers
FT   CDS_pept        join(164406..165090,165156..165532)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171873" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946704"
FT                   /orf_name="Pc20g00730"
FT                   /product="Pc20g00730 protein"
FT                   /protein_id="CAP85402.1"
FT                   /db_xref="UniParc:UPI0001831B96"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC4"
FT                   /transl_table=1
FT                   /translation="MKTNPLRPLISLRGGRHACRTYSSLSERLHYELTTRKLPLTYDYL
FT                   HPQPSHLLNLTLRDLLPQSKNSSGYATLPTLQNPSPLPVGHHLIYFPPQVTLSQLLPDC
FT                   TDTLHTPGEPFNRRLWAGGNLRFPVRSPPLDGSRAVCIESIRNVTVKGREGDEKVTVTI
FT                   ERRIGNVAEQETAEETWERIWKENEDNSGESSVIENRDLIFMRLKTSAQIEADKAQFGK
FT                   PGRTVKPPSGATFRHALIPTKALLFRFSALTFNAHSIHLDKSYTQNQEGYPNLLVHGPL
FT                   TLTLLLSVLQQQLSRLNLCISDIEYKNIAPLFVEQELVICGKPKNDTGAWDVWIEGPDG
FT                   GLAVRGTARTRLE"
     atgaagacaa atccactccg acccctgatc tctttgcgag gcgggcgtca tgcatgtcgg        60
     acttactcct cgctctctga gcgcttgcat tatgaactga ccacaagaaa gctcccgttg       120
     acttacgact atctacaccc ccaaccttcg catcttctga acctaactct ccgtgatctt       180
     cttccacaat ccaaaaattc ctctggttat gcgactctac cgacattgca gaacccttcc       240
     ccgctccccg tcggtcacca cttaatctac ttccccccgc aggtgacctt gtctcaacta       300
     cttccggact gcacagatac gttacacacg cccggcgaac catttaatcg gcggctttgg       360
     gcaggtggaa atctaagatt ccctgtgcgc agtccgcctc tggatggcag tcgcgcagtt       420
     tgcatagaat ccatccgcaa cgtgacagtg aagggccgcg aaggggacga gaaagtgacc       480
     gttaccatcg agcgacgcat tggcaatgtt gctgagcaag aaacagccga ggagacttgg       540
     gaacggatat ggaaagagaa cgaagacaat tcgggagaat cttcagtaat tgagaaccgg       600
     gacctcattt tcatgcgcct aaaaaccagc gctcaaatcg aggccgataa agcgcagttc       660
     ggaaagcctg gtaggactgt gaaacctccc tctggtgcaa cgttccgcca tgccctcata       720
     cctactaaag cgctgctatt ccgattctcg gcgttgactt tcaatgcaca ttccatccac       780
     cttgacaaga gctacactca gaaccaggag ggatacccaa atcttttagt gcatggtcca       840
     ttgacactga cgctgctgct tagcgtgctc cagcaacagc tgagtcgatt gaatctctgc       900
     atcagtgaca ttgaatataa gaatatagca cctctttttg ttgaacagga gctggttatc       960
     tgtggcaagc ctaagaatga caccggggct tgggatgtgt ggattgaggg tccagatgga      1020
     ggattggccg ttcggggtac tgcacggacg aggttggaat ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page