(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE74

PENCW_16.PE74        Location/Qualifiers
FT   CDS_pept        join(165868..165902,165957..166135,166194..166279,
FT                   166655..166697,166751..167178)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824094"
FT                   /orf_name="Pc20g00740"
FT                   /product="Pc20g00740 protein"
FT                   /protein_id="CAP85403.1"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniParc:UPI0001831B97"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC5"
FT                   /transl_table=1
FT                   /translation="MDVFWAAPPVTRTLTALTLVQSALMYGGLLSFYWAPFLPSLIFSW
FT                   RPQIYRLVTPFLLTGPKLGFFFDLYIMYRYGSAAEKSMAPGEFLIYLLFVAFSIMLTAG
FT                   GYLGAAILLPPLTMAFVYTFSQTNRGTKTRFWFIDIPVVFLPYAMLLVTMVSNGWDAAL
FT                   VESTGILAAHTYDFLTRIYPTFGGGRNFITVPGFLERYFTEHDPNSGYRGYGTASRAPR
FT                   PAGQPSSASASGSTWGSWTSSSSWNGRGAGRRLG"
     atggatgtct tctgggcggc tcccccggtc actaggaccc tcacagcctt gactctggtt        60
     caatccgctt tgatgtatgg cggcttattg agcttctatt gggcaccatt cttgccgagc       120
     ttgatattct catggcgccc gcagatctat cggctggtca ccccatttct actaactgga       180
     ccgaaactag gtttcttctt tgatctttat atcatgtacc gctatggcag tgctgcggaa       240
     aaaagcatgg cccctggaga gttcctcatt tatctcctat ttgtagcttt cagcatcatg       300
     ctcactgcag gtggttatct gggagcggct atccttctgc cacctttaac catggctttc       360
     gtctacacct tctcccagac gaaccgagga accaagacaa gattctggtt catcgatatc       420
     cctgtcgtat ttttgccata tgcaatgctt ctcgtcacca tggtgtcgaa cggatgggat       480
     gccgctctgg tagaaagcac ggggatcttg gccgcccata cctatgattt cctcacacgc       540
     atctacccga cttttggcgg tgggagaaac ttcatcactg tcccaggctt cctggagagg       600
     tactttaccg aacatgaccc caacagcgga taccgaggat atggaaccgc gagccgcgca       660
     ccaaggccgg ctgggcaacc ctcgtcagcg tcagcgtcag gatcaacctg gggcagctgg       720
     acctcttcga gttcttggaa tggcagaggc gctggccgga gactcggtta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page