(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE75

PENCW_16.PE75        Location/Qualifiers
FT   CDS_pept        join(167606..167714,167770..167926,167994..168625,
FT                   168685..168911,168965..169261)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231224" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946705"
FT                   /orf_name="Pc20g00750"
FT                   /product="Pc20g00750 protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="RNA processing"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="CAP85404.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI0001831B98"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC6"
FT                   /transl_table=1
FT                   /translation="MAVVKTSEMDYAIKPEASVPSVDTSDWPLLLKNYEKLLVRTGHFT
FT                   PIPAGSSPLSRDLKSYISSGVINLDKPSNPSSHEVVAWMKRILRSEKTGHSGTLDPKVT
FT                   GCLIVCIDRATRLVKSQQGAGKEYVCVIRLHDKIPGGEAQFVRALETLTGALFQRPPLI
FT                   SAVKRQLRIRTIHESKNYEFDNERHLGVFWVSCEAGTYIRTLCVHLGLLLGVGAHMQEL
FT                   RRVRSGAMGEGEGMVTLHDVMDAQWVYDNNRDESYLRKVISPLESLLTGYKRIVVKDSA
FT                   VNAVCYGAKLMIPGLLRYEAGIECHEEVVLMTTKGEAIAIGIAQMSTVELTTCDHGVVA
FT                   KVKRCIMERDLYPRRWGLGPTALEKKKMKTAGTLDKYGRPNDATPAQWKSEYKDFNLPI
FT                   TGTAAVAPSAETKTETEAPKVESPEPVKEEVEDKKRKRDGETAEEKAERKKKKKEKKEK
FT                   KERRKSKQDDSDDSD"
     atggcagtcg tcaagacctc ggagatggac tacgccatca agcctgaagc gtccgttcct        60
     tccgttgata catcggattg gccgcttctg cttaagaact atgagaagct gctcgttcgg       120
     accggtcact tcacccctat ccctgctggc tcctctcctc tgagccgtga cctgaagtcc       180
     tacatcagct ccggtgtcat caaccttgac aagccttcca acccttccag tcatgaagtc       240
     gtggcttgga tgaagcggat ccttagatcc gagaagactg gtcacagtgg tacccttgat       300
     cccaaggtca ccggttgttt gatcgtctgc attgaccgtg ccacccgcct ggtcaagtcc       360
     cagcagggtg ccggtaagga gtatgtctgt gtgatccgtc tccacgacaa gatccccggt       420
     ggcgaggccc aattcgttcg cgctctggag accttgaccg gtgcgctctt ccagcgcccc       480
     cctcttatct ctgccgtcaa gcgccagctc cgtattcgta ccatccacga gagcaagaac       540
     tacgagttcg acaacgagcg ccacctcggt gtcttctggg tcagctgtga ggctggtacc       600
     tacatccgta ccctctgtgt ccacctgggt cttctcctcg gtgtcggcgc ccacatgcag       660
     gaacttcgcc gtgttcgttc tggagccatg ggcgagggcg agggtatggt tactctgcac       720
     gatgttatgg acgcccaatg ggtctacgac aacaaccgcg acgagtccta cctccgcaag       780
     gtcatcagcc ctctggagtc tctgctcacc ggctacaagc gtatcgtcgt caaggacagc       840
     gctgtcaacg ccgtctgcta cggtgccaag ctcatgattc ctggtcttct ccgctacgag       900
     gccggtattg agtgccacga ggaagttgtc ctcatgacca ccaagggtga ggctatcgcc       960
     attggtatcg ctcagatgtc aactgtcgag ctcactacct gtgaccacgg cgttgttgcc      1020
     aaggtcaagc gttgcatcat ggagcgtgac ctctaccccc gccgctgggg cttgggaccc      1080
     actgcccttg agaagaagaa gatgaagact gcaggaactc tcgataaata cggtcgcccc      1140
     aacgacgcca cccccgctca gtggaagagc gagtacaagg actttaacct tcctattacc      1200
     ggaaccgccg ctgttgcgcc ctccgccgag actaaaaccg agaccgaggc ccctaaggtt      1260
     gaatcccccg agcccgtgaa ggaggaggtc gaagacaaga agcgcaagcg cgacggcgag      1320
     acggccgagg agaaggccga gcgcaagaag aagaagaagg agaagaagga gaagaaggag      1380
     cgccggaagt ccaagcagga tgatagcgat gacagcgact ag                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page