(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE76

PENCW_16.PE76        Location/Qualifiers
FT   CDS_pept        join(169815..169868,169927..170466,170524..170718,
FT                   170771..171202)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000241232" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977338"
FT                   /orf_name="Pc20g00760"
FT                   /product="Pc20g00760 protein"
FT                   /protein_id="CAP85405.1"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="UniParc:UPI0001831B99"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC7"
FT                   /transl_table=1
FT                   /translation="MAAELTSTKLNPESHIILDQPLLRLPHELARRNFKTVQRAVEREK
FT                   EYIIPAIKETAAASLSNTQTPDQTLAALDAMISRMQGLKRKMESLQEEEKKIHNQSRKR
FT                   IQHLETLHKIPSLADVKYDQWSRVRLDRLLVDHMLRSGYSESAKQLAQDRGVEELVDLG
FT                   VFTQCQRVVDSLRRGETKEALQWCGENKAALKKSQHNLEFELRLQQYIEMVRTQDKSKK
FT                   IEAIIHAKKYLIPNHQSQNSEIMRAAGLLVFTQDTRAEPYKSLFALDRWRVLAQLFIQT
FT                   HHELLSLPSQPLLHIALSAGLSALKTPLCHSAYTSSSSNSQSTSTSVCPICSTELNELA
FT                   RKMPYAHHSKSYVESDPIVLPNGRVYGKQRLMEISRKMGSVGPGKVKDPTTGEVFHESE
FT                   MKKVYIM"
     atggcagcag agctgacatc caccaagctc aacccggaga gccacatcat cctggaccaa        60
     ccactccttc gactaccaca tgaactagcc cgcagaaatt ttaaaaccgt acaacgagct       120
     gtcgagcgag agaaagaata tatcatcccc gcaatcaaag agaccgccgc cgcctcactc       180
     tccaacaccc aaacccccga ccagaccctc gctgcactcg acgcaatgat atccagaatg       240
     caaggtctta aaagaaaaat ggaaagtctc caggaggaag agaagaaaat ccacaaccaa       300
     tctcgaaagc gcattcagca cttggagacc ttgcataaga tcccgagcct agccgatgtc       360
     aagtacgacc agtggtcaag ggtacggctg gaccgcttac tggttgacca tatgctgcgc       420
     tcgggttact ctgaaagtgc gaagcagctg gcccaggata ggggggtgga ggaactggtg       480
     gatctcggtg tattcacgca gtgtcaacga gttgtcgata gcttacggcg cggggaaacc       540
     aaggaggcgt tgcagtggtg cggagagaat aaagctgcac tgaagaagag ccagcataat       600
     ctcgaatttg aactccggct acagcaatac atcgaaatgg tcaggacaca agacaagtct       660
     aagaagattg aggcaataat ccacgcgaag aaatatctca taccgaacca tcaatctcag       720
     aattccgaga ttatgcgggc cgccggatta ctggttttca cacaggacac aagagccgag       780
     ccttacaaat ctctctttgc gttggaccgc tggagggttc ttgcgcaact tttcatccag       840
     actcaccatg aactgctttc attgccgtca cagccattat tacatattgc actttccgca       900
     ggactttcag ctcttaaaac acctctgtgc cattcagcct atacatcgtc cagctcaaac       960
     tcacagtcaa cgtcgacatc tgtgtgtcct atctgctcaa cagaactgaa tgagcttgca      1020
     cgcaaaatgc catacgccca ccactcaaag agctatgtgg aaagtgaccc aatagttcta      1080
     ccaaacggcc gagtctacgg gaagcaaagg ctgatggaga tcagccggaa gatgggatca      1140
     gtgggaccag gcaaggtcaa agacccaaca acaggagagg ttttccacga gagcgagatg      1200
     aaaaaagtgt acattatgtg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page