(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE77

PENCW_16.PE77        Location/Qualifiers
FT   CDS_pept        join(complement(172515..172740),complement(171294..172264))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171895" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946706"
FT                   /orf_name="Pc20g00770"
FT                   /product="Pc20g00770 protein"
FT                   /protein_id="CAP85406.1"
FT                   /db_xref="InterPro:IPR019446"
FT                   /db_xref="UniParc:UPI0001831C6E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC8"
FT                   /transl_table=1
FT                   /translation="MPRNNKKVKNAPPPRPRGPSKPAGLSSYPAKGQQHGNGQKQGNSN
FT                   ANVPKKASMQANQRPIVPFLRKDRILLIGEGDFSFGRSLAKQYKCRNLCATCYDSKEAL
FT                   YDKYPQAPQNVSDILSASAKPKPASDETEKQPEENKSEDQDSTNPSQQTPKVVFSVDAR
FT                   KLGAPTGGGKEIRTGFARRERKRPAWYQQNEPAGPPYQPGGPWDVICFNFPHVGGLSTD
FT                   VNRQVRANQELLVAFFKACVPLVSKPPPLMDAEDDEWVYADGEESDEEDEDEDEEGGEG
FT                   EELGKDDDTTGKGFRTGPGQILVTLFEGEPYTLWNIKDLARHAGLVVVTSFRFPWTSYE
FT                   GYSHARTAGHIEGKDGERGGWRGEDREARMYVFEVKQKEPAKKGGKKRSRDDDSSDSE"
     atgcctcgca ataacaagaa agtcaaaaac gcccctccgc cgcgccctcg cggaccaagc        60
     aagccagctg gcctatcttc atacccagcc aagggacagc agcatggcaa tgggcaaaag       120
     cagggcaact ccaatgccaa tgtacctaag aaagcttcta tgcaagcaaa tcagagacct       180
     attgtaccat ttttgaggaa ggatcgaatt ctgctgattg gtgaaggtga cttttcattc       240
     ggccgttctc tagcaaagca atacaagtgc cgcaacctat gcgccacatg ctacgattcc       300
     aaggaagcac tgtacgacaa gtacccacaa gcccctcaga acgtctcaga tattctgagc       360
     gcatcagcaa agcccaaacc agcaagcgac gagacagaaa agcagccaga agagaataaa       420
     tccgaagacc aggactcaac caaccccagc cagcaaaccc ccaaggtcgt cttctctgtg       480
     gacgcgcgca agctcggcgc tccaacaggc ggtggtaagg aaatccgcac aggatttgca       540
     cgtcgtgaac gcaaaagacc agcctggtac cagcaaaatg agccggcagg accaccgtac       600
     cagcccggcg ggccgtggga tgtgatctgc ttcaatttcc cgcacgtggg cgggctctct       660
     acggacgtga accgacaggt tcgtgcgaat caggagttgc tagttgcgtt cttcaaagct       720
     tgtgttccgc ttgtttcgaa gccgccgccg cttatggatg ctgaggatga tgagtgggtg       780
     tatgcggatg gggaggagag tgatgaggag gatgaggacg aggatgagga aggaggagag       840
     ggtgaggagc tggggaaaga tgatgatact accgggaagg gcttccggac tgggcctggt       900
     cagattcttg tgactctgtt cgagggggag ccgtataccc tttggaacat taaggatttg       960
     gcaaggcatg cggggctggt tgttgtgact agtttccggt ttccttggac ttcttatgag      1020
     gggtattcgc atgcacgaac tgcgggtcat atcgaaggga aggatgggga acgtggagga      1080
     tggaggggag aggatcggga ggctcggatg tatgtcttcg aagtgaagca gaaggagccg      1140
     gccaagaaag gagggaagaa aagaagcagg gatgatgatt ccagtgatag cgagtag         1197
//

If you have problems or comments...

PBIL Back to PBIL home page