(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE84

PENCW_16.PE84        Location/Qualifiers
FT   CDS_pept        complement(186091..187497)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171930" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128435"
FT                   /orf_name="Pc20g00840"
FT                   /product="Pc20g00840 protein"
FT                   /protein_id="CAP85413.1"
FT                   /db_xref="UniParc:UPI0001831C74"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD4"
FT                   /transl_table=1
FT                   /translation="MSTQSPHSPTPKGSRNNRRPQKKNTTPHAQKPALLSTPPSSPPRN
FT                   MSSGAIQVDPSNNFNSSKKKPMRSGKKSRDNKASPAPHSGYHSNGYNSGPRHTPSRPAV
FT                   TSPQTKPSPAYAGPTFHASPAPSALPIPSFFSKSAPDANLVPPMETDSDDADVDPELEM
FT                   TPSKPRNRNNQSKGEEPKPSPLDFLFKAAVQARDQKSTSSPEVNKVLQSPQTEPRVVRP
FT                   NADGMFTFEMGNSDYNRNSNIGPSFAPSYQDRMNALRPSSTPQSPDMTEEERRTKTEEL
FT                   KHLLLNPPPQKPPSSAYASPEYAGPFGSRPSNVPPYATPMRTSSGPQLTASHGSFSSPQ
FT                   LQQQQISQNNGRRHYQYPTHSHSPLRREVDMVPPPSMPPYRGPVSNNTSNGGSPAPYGN
FT                   PYMTMSQQQQQQQQSGYASPHPDYAPSSFQIPVNSPSPSRVVDTAQIENDIRRVLKLDA
FT                   SGPPVTQSSA"
     atgtcgaccc aatctcctca ttctccgact cctaagggat cgcgcaacaa ccgccgtcct        60
     cagaagaaga acacgacccc tcacgcccag aaaccggcgc tcctctctac ccctccgtca       120
     tccccgcccc gtaacatgag ctccggagcc atccaggtgg atccttcgaa caacttcaac       180
     tcttcgaaga agaagcccat gcgttcaggc aagaagtccc gagacaacaa ggcttcacct       240
     gccccgcact ctggatacca cagcaacggg tacaacagcg gtccccgaca tacaccctcc       300
     cgccccgctg tcacctctcc tcagacaaag ccgagcccag cttatgcggg accgacgttc       360
     cacgcatcgc ctgcaccatc tgctttaccc attcccagtt ttttctctaa gtcggctcct       420
     gatgccaatc tggtcccacc catggagacc gatagtgacg atgcggacgt ggaccctgaa       480
     ttagagatga ctccgtccaa acctcgcaac cgcaacaacc aatccaaggg cgaagaaccc       540
     aagccttccc ctcttgactt ccttttcaag gctgctgtgc aagccagaga tcaaaagtcc       600
     acgagcagcc ctgaggtgaa taaggtcctt cagtctcccc agaccgaacc cagggtcgtg       660
     cggcccaacg ctgatggtat gtttacgttt gaaatgggaa actctgacta caaccgcaac       720
     tcaaacattg gcccttcttt cgctccttct tatcaagacc gtatgaatgc gctgcgacct       780
     tcgagtaccc cccagtcgcc tgatatgact gaggaggagc gacgaaccaa gactgaggag       840
     ttgaagcacc tgttgctcaa tccacccccg caaaagccgc cttcctcggc ttatgcgtcg       900
     cctgaatacg ctgggccctt tgggtcccgt ccttccaatg tgccgcccta tgccactcct       960
     atgcggacct catctggccc tcagttgacc gcatctcatg gctcattctc gtctccccag      1020
     ctgcagcagc agcagatttc tcagaacaat ggacgtcgtc actaccaata ccccacccac      1080
     tctcactcac ctctgcgccg tgaggttgac atggtcccgc ccccttcgat gcctccgtat      1140
     cgtggccccg tctccaacaa cacctcgaac ggaggttccc cggcgccgta tggcaatccg      1200
     tacatgacaa tgtcgcagca gcagcaacag cagcagcagt ctggctatgc ttcaccccac      1260
     ccagactatg ccccgtcttc attccaaatt ccggtcaact cgccatctcc ttctcgggtg      1320
     gtggacacgg cgcaaatcga gaatgacatt cgtcgggttt tgaaactgga tgcctcggga      1380
     cctccagtta ctcagagctc tgcgtaa                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page