(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE85

PENCW_16.PE85        Location/Qualifiers
FT   CDS_pept        join(188262..188366,188422..188500,188562..188632,
FT                   188698..188796)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977343"
FT                   /orf_name="Pc20g00850"
FT                   /product="Pc20g00850 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85414.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001831C75"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD5"
FT                   /transl_table=1
FT                   /translation="MTDVEMKEAATGSSKGKAVAKGSDNADKKKFEVKKWNAVALWAWD
FT                   IVVDNCAICRNHIMDLCIECQANQGSSTTEECTVAWGICNHAFHFHCISRWLKTRQVCP
FT                   LDNRDWEFQKYGR"
     atgacagacg tggagatgaa ggaagccgct actggctcct ccaagggcaa ggccgtcgcc        60
     aagggctccg ataatgcgga caagaagaag ttcgaggtca agaagtggaa cgctgttgcc       120
     ctgtgggctt gggatattgt cgtcgacaac tgtgccattt gccgaaacca catcatggac       180
     ttgtgcatcg aatgccaggc caaccaaggg tcatcaacaa cggaagagtg cactgttgcc       240
     tggggtatct gcaaccacgc attccacttc cactgtatat cgagatggct gaagacccgc       300
     caagtctgcc cgctagacaa ccgagactgg gagttccaga agtacggccg gtaa             354
//

If you have problems or comments...

PBIL Back to PBIL home page