(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE86

PENCW_16.PE86        Location/Qualifiers
FT   CDS_pept        join(complement(189470..189517),complement(189331..189390),
FT                   complement(189072..189269))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171962" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128436"
FT                   /orf_name="Pc20g00860"
FT                   /product="Pc20g00860 protein"
FT                   /function="peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="signal peptidase complex"
FT                   /protein_id="CAP85415.1"
FT                   /db_xref="GO:0005787"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR009542"
FT                   /db_xref="UniParc:UPI0001831C76"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD6"
FT                   /transl_table=1
FT                   /translation="MDELLAPIQDVIEGQIDFHGQRLAELLSTVLLVISGAASFVIGYI
FT                   YQDIHLTLWTGLAGTLFTAFVVVPPWPVYNRNPEKWLGSTSANAAPGITVDGVKVQ"
     atggatgaat tactcgcgcc tattcaggat gtcattgagg gccaaatcga cttccacggc        60
     caacgtctag cagagctact ttcaacagtc ttgctggtta tctctggggc cgccagcttc       120
     gtcatcggat atatctacca ggacatccac cttacgttat ggaccggttt ggcgggcaca       180
     ttgtttacag ctttcgtcgt tgtcccgccc tggccggtat ataaccgcaa cccagagaag       240
     tggctgggct caacaagcgc aaatgcagct ccgggtataa ctgtggatgg ggtgaaggtg       300
     caataa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page