(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE87

PENCW_16.PE87        Location/Qualifiers
FT   CDS_pept        join(complement(190997..191414),complement(190588..190886),
FT                   complement(190187..190531))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000247199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977344"
FT                   /orf_name="Pc20g00870"
FT                   /product="Pc20g00870 protein"
FT                   /function="ATP binding"
FT                   /function="homoserine kinase activity"
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85416.1"
FT                   /db_xref="GO:0004413"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001831C77"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD7"
FT                   /transl_table=1
FT                   /translation="MSSFVIKIPCSSANIGPGFDVIGLALSLHLDLHVTIEAKPSSQEP
FT                   FNCAITYEDQSKSVEQISLDPEVNLITRVALYVLRCHDQRAFPVETKVHIVNPIPLGRG
FT                   LGSSGTAVVAGVMLGNEVGKLGLSKERLLDYCLMIERHPDNVAASLFGGFVGTYLNELK
FT                   PEDVARKEIPLSEVLPAPAGGVDTGIRPPEPPMAIGHYRKFNWAPEIKAIAIIPDFVVP
FT                   TANARNVLPQSYSREDVVFNLQRAALLPAALGSSPPDPDMIFLAMQDKVHQPYRKTLIP
FT                   GLTEILQFMTPATQPGLLGICLSGAGPTILALATERFTEIADRIIAQFASNGISCQWKL
FT                   LEPAHDGATVAYN"
     atgtcttcct ttgtgatcaa gatcccttgt tcctctgcca acattggccc tgggtttgat        60
     gtgatcggct tggcattgtc cctccacctg gatctccacg tcacaatcga ggccaaaccc       120
     tcatcccagg aacccttcaa ctgcgccatc acctatgagg accaaagcaa gagtgttgag       180
     cagatcagtc ttgacccaga agtcaatctg atcacccgtg tagccctgta tgtcctcaga       240
     tgccatgacc agcgggcctt ccccgtcgag accaaggtgc atatcgtcaa ccctatcccg       300
     ttaggccggg gtctgggctc ttctggtacc gccgtggtcg ccggtgtcat gctgggcaat       360
     gaggttggta agctgggtct gagcaaggaa cggttactcg attattgttt gatgattgag       420
     cggcaccccg ataacgtggc tgcttccctc ttcggtgggt tcgtgggcac ctatctgaat       480
     gagcttaagc ccgaggacgt ggcacgcaaa gagatccccc tcagtgaagt cctgcccgct       540
     ccagcaggtg gtgtggacac cggcatcaga ccccccgagc cacccatggc cattggtcat       600
     tacaggaagt tcaactgggc cccagagatc aaggccattg ccattatccc tgactttgtg       660
     gtgcctactg ccaacgcccg taatgttctc ccgcagagct actcgagaga ggacgtggtc       720
     ttcaatctcc agcgcgctgc actcctcccg gcggccttgg gaagttcccc tccggatcct       780
     gatatgatct tcctcgccat gcaggataag gtgcaccagc cgtatcgcaa gacgttgatc       840
     ccaggcttga ctgagatcct ccaattcatg acccctgcca ctcaacccgg tctgctagga       900
     atctgtctct ccggtgccgg acctaccatc ctggcactgg ccacggagcg cttcaccgag       960
     attgctgacc gcatcatcgc acagttcgct tccaacggta tctcgtgcca gtggaagctg      1020
     ctggagcccg ctcatgatgg cgcaactgtc gcctataact aa                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page