(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE88

PENCW_16.PE88        Location/Qualifiers
FT   CDS_pept        192852..194792
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171963" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946707"
FT                   /orf_name="Pc20g00880"
FT                   /product="Pc20g00880 protein"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85417.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI0001831C78"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD8"
FT                   /transl_table=1
FT                   /translation="MSESPRSERYMYLTRYSTPVPELDDHRLQMQTPPRIEVPVERSYS
FT                   PHDTTQGPEILDRPDLLSAQDARRDGPIPRDFEKVDDNRSLNELNGLGRRFSVDHNATY
FT                   QTPRRISIVNPDLANASAASSVSARSSSPPNSVEAFADPRRRERANTLDSHAPPDLEAI
FT                   LQRTVSGGTHNRRPTFSNASAIHPQLGDVPFDTAEEACFEEPGRIPVIDYEELEEFVAL
FT                   NPSIKVADADRRKYSMSSQSKRPRIFYDLRPGAESPEIGAIKKNGSSDTLSEDEKKNAA
FT                   VTDEKERFKTRQNVNQRSRFGFFSSESQSTVHAADLGDLVLPGETFRDLFELGPEGGVW
FT                   WLDVANPTDEELGAISRAFSIHPLTTEDIQTQEAREKVELFKQYYFVCFRTFFQTDKTS
FT                   EEFLEPVNFYMVVFRDGVLTFSFEDNPHAANVRKRIGKLRDYVALSSDWICYAMIDDIV
FT                   DSFGPVIRDVELESEAIEDHVFIARVDDFESFLPRIGGLRKKVMSLMRLLGGKADVIRG
FT                   FSKRCNEQYSVTPRGDIGLYLGDIQDHVVTMMSNLAHFEKMLSRSHTNYLAQLNVTNLV
FT                   LGNHVNKVLSKVTLIATILVPMNLITGLFGMNVEVPGQHTDGLNWWFGILGVIAGIVVV
FT                   SFGLARWQKLV"
     atgtccgagt ctcctagatc cgagaggtac atgtacctga ccaggtacag taccccggtc        60
     cccgaactgg acgatcaccg cctccagatg cagacgcctc cacgcattga ggtaccggtc       120
     gagcgttctt acagcccgca cgataccact caaggtcctg aaattctcga tcgtccagat       180
     ttgctcagtg cacaagatgc ccgaagagac ggtccgattc cccgagactt cgaaaaggtc       240
     gacgacaatc gttcgttgaa tgagttgaat ggtctcggtc gacggttctc agtcgaccat       300
     aacgcaacct accagactcc tcgtcgcatc agcattgtga acccggatct cgccaacgct       360
     tctgctgcct cgtccgtgtc cgctcgatct tcctctcctc ccaattcagt tgaggctttt       420
     gccgacccgc gtcgccgtga gcgcgccaat accctggata gccatgcgcc tcccgaccta       480
     gaagctattc tgcagcgcac cgtttcgggt ggtacccaca accggcgtcc gactttcagc       540
     aatgccagtg ccattcaccc ccagttgggt gatgtgccat tcgacacggc agaagaggcc       600
     tgcttcgagg agccaggccg tattcccgtc atcgattacg aggaactcga ggagtttgtg       660
     gctctgaatc cgagcattaa agtcgccgat gccgatcgcc gcaagtacag catgagctca       720
     cagagcaaga ggccgcgcat attttacgac ctccgccctg gcgccgaaag ccctgagata       780
     ggtgcaatta aaaagaatgg ctcgtctgat acactgagtg aagatgaaaa gaagaacgcc       840
     gcggtgacag acgaaaagga gcggtttaaa acacgccaga atgtcaacca acgctctcgc       900
     tttgggttct tttcatccga atctcaaagc acagtgcatg ctgctgattt gggcgatcta       960
     gtgctccctg gcgaaacctt ccgggatctt ttcgagcttg gacctgaggg aggtgtgtgg      1020
     tggttggatg tggctaaccc caccgatgag gaattgggag ctatctcccg ggctttctct      1080
     attcacccgc tgacaacgga ggatattcaa acccaggaag cccgcgagaa ggttgaacta      1140
     ttcaaacagt actactttgt ctgtttccgg accttcttcc aaacggacaa aacaagtgag      1200
     gaatttcttg agcctgttaa tttctacatg gttgtcttcc gagacggtgt tctcactttc      1260
     tcctttgagg acaaccccca cgcagccaat gttcggaaac gtattggaaa gctgcgagac      1320
     tatgtggctc tcagtagtga ctggatctgt tacgcgatga tcgacgacat cgtggatagc      1380
     ttcggccccg tcattcgaga tgtggaattg gagtccgagg cgatcgaaga ccacgtgttc      1440
     atcgcccgtg ttgacgattt cgaatcgttc ctccctcgca ttggaggcct gcgcaagaag      1500
     gtcatgagct tgatgcgcct gctaggcggc aaggccgacg tcattcgtgg attctcgaag      1560
     cgctgtaacg agcagtactc ggttactccc cgtggtgata ttggtcttta cctgggtgat      1620
     atccaagatc acgtcgtgac catgatgtcg aacttggcgc atttcgaaaa gatgctcagc      1680
     cggtctcata ccaattactt ggctcagctg aatgtcacca acttggtgtt gggaaaccac      1740
     gtcaacaagg ttctcagcaa ggttaccctg attgctacga tcctggtccc catgaatttg      1800
     atcactggtc tgttcggtat gaacgtagaa gttcccggcc agcacacaga tggattgaat      1860
     tggtggttcg gcattcttgg cgtgatagca ggcattgttg ttgtgagttt cggtttagcc      1920
     cgctggcaga agctggtttg a                                                1941
//

If you have problems or comments...

PBIL Back to PBIL home page