(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE89

PENCW_16.PE89        Location/Qualifiers
FT   CDS_pept        join(195772..196993,197047..197711)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946708"
FT                   /orf_name="Pc20g00890"
FT                   /product="Pc20g00890 protein"
FT                   /protein_id="CAP85418.1"
FT                   /db_xref="UniParc:UPI0001831C79"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD9"
FT                   /transl_table=1
FT                   /translation="MRRHYNALQCYITATISAIFLLFALTCDSVAYAYSDAPNGPDTES
FT                   TLNLRGVVTSDGAGLPFALDSFNGLELRESVEEDGESNGLELVRRNPNAAKALGNNQFE
FT                   APDLEIGAVHWFYLPKTVVNGKHDPKGAGLPAYMNATEGDNDANDSASELRKRDEDFSK
FT                   RALTTVYLSLTTCKKPHTNKTDSQGGFPQLQVYVSNSEKLQQPGPGKDDSQQDIHTAVG
FT                   GYVGITIDTDSDVFIGVAAPNSTDYTGSYTYQIAASIDDFFHNIVDNDPNLFFVDADVS
FT                   AALLVTNNLTQSAENSTNYQQWMNIVPPYTMFAHNINDTALQGLEKSFCALDTLSQVGR
FT                   ISNSTEVGMTNRGLGNKPKEQFYVTGLNRSSSYSGLLAMVGNSTASGNGIVGGGGKVWQ
FT                   PMNFTTKADDNCAVLFNLTFCSEVAYAVPSNPKISVDKLRTIYDDHAAAFYQNFTYSLQ
FT                   QVQCKTNEESMFSLAVNCSDCERSYKQWLCSVTIPRCADYSSNATYLAVRNAGQPFING
FT                   SSLPDDSPYRQSVASNTSRNSIIDEKIKPGPYKEVLPCQDICHTLVKDCPSALGFGCPE
FT                   GAWMNASYGYRNLDGIITCSYLGAVYYLSLGTRLGAWHWVFSLVVMGVMYLL"
     atgcgacgcc actacaacgc gctgcagtgc tatattactg caacgattag cgcgatcttc        60
     cttcttttcg cactcacctg cgactccgtc gcctatgcct attccgatgc ccccaatggc       120
     ccagatacag agagcacttt aaacctccga ggggtggtta ccagcgacgg ggccggactc       180
     ccatttgcgc tggactcgtt caatgggctg gaacttcgcg aaagtgtcga ggaagatggc       240
     gagtcaaatg ggctggagct cgttcgcaga aaccctaatg ccgcgaaagc gttgggcaac       300
     aatcagttcg aggcgccgga cctcgagatc ggcgctgtcc actggttcta cctgcccaag       360
     accgtggtga acggcaagca cgatccgaaa ggcgcgggac ttcctgcata tatgaatgct       420
     acggaaggag ataatgatgc caatgactcg gcatctgagc tacggaaacg agacgaggac       480
     ttctcaaagc gagcgttgac gacagtctac ttgtcgctca cgacctgcaa aaaaccacat       540
     accaacaaaa ccgactcaca aggtgggttc ccgcagttgc aagtgtatgt gtcgaattca       600
     gagaaactgc aacagccggg cccgggcaaa gacgactcgc agcaagatat acacactgcc       660
     gttggcgggt atgtgggcat cacaatagac acggacagcg atgttttcat cggcgtcgca       720
     gcgcccaatt caaccgacta caccggaagt tacacgtacc agatcgcggc gtctatcgat       780
     gactttttcc acaatatcgt ggacaatgac ccgaatctat tcttcgtcga tgcagacgtg       840
     tcagccgcgc tgctagtgac gaacaacctg acccagtccg cggaaaactc cacaaattac       900
     cagcaatgga tgaatattgt gcctccgtat actatgttcg cccacaacat caacgataca       960
     gcactgcagg gcttggagaa atcgttctgc gccctcgata cactttcgca ggtgggccga      1020
     atcagcaatt caaccgaggt tggcatgacc aatcgcggac ttgggaataa gcctaaagaa      1080
     cagttctacg ttactggact gaaccggagt tcatcgtaca gcggtcttct tgcaatggtg      1140
     ggcaattcga ccgcgtccgg gaatggcatc gtcggcggcg gcggcaaggt atggcaaccg      1200
     atgaatttca cgaccaaagc agatgacaac tgcgccgtgt tattcaacct aaccttctgc      1260
     tcggaagtcg catacgcagt cccctcaaac ccaaaaataa gcgtcgacaa gctccgcaca      1320
     atctacgacg accatgctgc cgccttctat cagaacttca cctattccct ccaacaagtc      1380
     caatgcaaaa caaacgagga atcgatgttc tccctcgctg tcaactgcag cgactgcgaa      1440
     agatcctaca aacaatggct ctgcagcgtc acaatccccc gctgcgcgga ctacagtagc      1500
     aacgccacat acctggccgt ccgtaacgca ggccagccct ttatcaatgg ctcttctcta      1560
     ccggatgaca gtccgtatcg ccaatctgtg gcgtcgaata catcccgcaa ctctatcatc      1620
     gatgagaaga tcaagccggg tccctataag gaggtcctgc cctgccagga tatctgtcat      1680
     accctggtta aggattgtcc gtctgcactt ggtttcgggt gtcctgaggg cgcgtggatg      1740
     aatgcttcct atggctatcg gaatttagat ggtattatca cttgctctta tctcggggct      1800
     gtgtactatt tgagtcttgg gacgaggctg ggtgcttggc attgggtgtt tagtctggtg      1860
     gttatgggag ttatgtattt gctgtag                                          1887
//

If you have problems or comments...

PBIL Back to PBIL home page