(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE9

PENCW_16.PE9         Location/Qualifiers
FT   CDS_pept        join(complement(28359..28502),complement(27948..28316),
FT                   complement(27837..27881))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187741" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128431"
FT                   /orf_name="Pc20g00090"
FT                   /product="Pc20g00090 protein"
FT                   /protein_id="CAP85338.1"
FT                   /db_xref="UniParc:UPI000183182F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER7"
FT                   /transl_table=1
FT                   /translation="MMPPSDSLRHQLHKLAEVRASRNTSSISTSTPTSTSTPGTAPPPY
FT                   TLSNDMDDPWASPINIYIDHSITVTGDENTIMVSSPGMDSPTDPTHQEAPRLSSIAAVI
FT                   IAALNRANALHDDMGYPRPVNIRALAGIRVNGRNNRVCVGGEINKSQNETADAGVRESN
FT                   GRKRRASSEPVDAPSAQRSRSF"
     atgatgcctc catcagactc tttgcgacac caactgcata agctcgccga agtccgggca        60
     agtcgcaata cttcttctat atctacctct acacctactt ctacttccac tccgggcaca       120
     gctccacccc catacacatt gtctaacgac atggacgacc catgggcttc ccccatcaat       180
     atttacatcg accactcaat caccgtaact ggtgatgaaa acaccatcat ggtgtcgtct       240
     cctggaatgg attctcccac tgatccaact caccaggagg cccctcgcct gagttccatc       300
     gctgctgtca tcatcgctgc gctgaaccgc gcaaatgctc tccacgatga tatgggttac       360
     ccccggcctg tcaatatccg cgctctcgcg ggtattcggg taaatggccg aaataaccgc       420
     gtttgtgttg gaggagagat caacaagtct cagaatgaga ctgctgacgc cggagttaga       480
     gaaagcaacg gtcgcaagcg gcgcgccagc tcggagcctg tggatgcccc ttcggctcag       540
     cgttctcgtt cattttag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page