(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE91

PENCW_16.PE91        Location/Qualifiers
FT   CDS_pept        complement(199003..200487)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171985" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946709"
FT                   /orf_name="Pc20g00910"
FT                   /product="Pc20g00910 protein"
FT                   /protein_id="CAP85420.1"
FT                   /db_xref="InterPro:IPR019148"
FT                   /db_xref="UniParc:UPI0001831C7B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE1"
FT                   /transl_table=1
FT                   /translation="MASSSSQELVKQSAGQLMPPPPPPKRIKRPATVLDEDVYTNTLSH
FT                   IIARDFFPGLLETQIKQEYLEALESKDKSWIASSKKKLADVMRTPTPGSNARRKSDYAS
FT                   VPSTPQHFPAGRAGDTPHGWGGDTPMSVISTSTSATETQDRNIPDVSNMGLVAFQAKYT
FT                   SEDNESFNKVLDKQNEKRREKYPWLWSGNKVPSARQIAHHQQEIKRITAQGGKPEMGLI
FT                   KRDEHVQSAIKTDLDARPAKPNSWKSRPDNTLMFLPSSVEDTHETLAQKAEITSRAGPK
FT                   RTLYQNTRLLDPHAAAAADAANAVPPSPSLSAIQDAIAGRPHLSESEAASAFAGSETPR
FT                   VNGYAFVDEDEPEPEFTYGSSSKTDDDMEADWRLLGPTSEKPNPFQLGETRKREALHHR
FT                   MVDRVARNKRAEKAARVTKTPVSLTPRFASSPRLDFGSASTPGAGSSRGSVYAGGHQGK
FT                   MLTPAAQKLLQQVGTPRPRERKSGLGNAWTPTPKRK"
     atggcgtctt cttcttcaca ggagctagtt aagcaatctg ctggccagct tatgcctccc        60
     ccaccacccc cgaagcgaat caaacgcccc gcgactgttc tcgacgaaga cgtctacacc       120
     aacactttgt cccacattat tgcccgcgac ttctttccgg ggttactcga aacacagatc       180
     aagcaagagt atctagaagc ccttgaatcg aaagataaat catggatcgc aagttcaaag       240
     aagaagttgg cggatgtcat gcgaacgccc actcccgggt ctaatgcgag acggaaatca       300
     gactatgcat ctgtcccgag cacaccccag catttcccgg ccggacgggc tggtgatact       360
     ccacatggct ggggaggcga tacccccatg tccgtcatat ctacttccac atcagcaact       420
     gaaacacaag accggaatat tcccgatgtg tccaacatgg gactggtcgc cttccaagca       480
     aagtatacca gtgaagacaa cgagtccttc aacaaagtcc tcgacaagca gaacgaaaag       540
     cgacgagaga aatatccctg gctttggagc ggaaacaaag tcccctcggc ccgacaaatt       600
     gcgcaccatc aacaagaaat caagcgcatc acagctcaag gcggaaagcc ggaaatgggc       660
     cttatcaaac gagacgagca tgtccagtcc gctataaaaa cagacctgga tgctcgtccc       720
     gcaaaaccaa actcgtggaa aagccgtccg gacaacaccc taatgttcct tccctcctcg       780
     gtggaggata cccacgagac actcgcgcag aaagcagaaa ttacatcccg agcaggcccc       840
     aagcgaactc tctaccaaaa tacaaggctg ttagacccac atgcggcagc agcagcggac       900
     gccgccaacg ccgtgccccc ttcaccctca ctatccgcca tccaagacgc catcgctggc       960
     cgaccgcatc tcagcgagtc cgaagccgca tccgccttcg caggaagcga aaccccgagg      1020
     gtgaacggat acgccttcgt cgacgaagac gagcccgagc ctgaattcac atatggctcc      1080
     agctctaaaa ccgacgacga catggaagct gactggcgcc ttctcgggcc gacctctgaa      1140
     aagccaaatc ccttccaact tggcgagact cgcaagcgcg aagccctgca tcaccgcatg      1200
     gtcgatcgag tggcgcggaa caagcgtgct gaaaaggccg cccgcgttac gaagacacct      1260
     gtctcgttga cgccgcgatt tgctagtagt cctcggcttg actttggttc tgcttctaca      1320
     cctggagctg gctctagtag gggctctgtc tatgctggag ggcatcaggg aaagatgctt      1380
     acacctgcag cgcagaagct gttgcagcag gttgggacgc cgaggcctag agagcggaag      1440
     tctggactgg ggaatgcttg gacgcccacg ccgaagcgaa agtga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page