(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE92

PENCW_16.PE92        Location/Qualifiers
FT   CDS_pept        201091..202338
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128437"
FT                   /orf_name="Pc20g00920"
FT                   /product="Pc20g00920 protein"
FT                   /protein_id="CAP85421.1"
FT                   /db_xref="UniParc:UPI0001831C7C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE2"
FT                   /transl_table=1
FT                   /translation="MLVSMKRNPPSIRQAPKAIPIKSSSWVGDIHQYLKSTFVTYPILK
FT                   ALGLDLLDAFPVELVLSIADFLPLEDIYCLSLCNSRLLAIFRSWKKREYLDRKARLSFL
FT                   HRLERDHPRYLTCDDCLILHDLDSISEPLELSYSTKTYPPRIDCPALRPGYSTCGRSWI
FT                   NLHNDSSVQHTYALHFSHLQLAMRRFYSDSQYGISTDALSFTEVTNEFVEGDRVLKPTT
FT                   LFSVEAQICPEAPSLYLRIQDVVSMKDMRLLGDDKYYEEVEKEYFAALPICKHQQKTMG
FT                   IQSIPRDVLTHECSNCSDCNTDWEIELFENRPSGHVTMVMTRYIDLGPGLSLDDPRWSV
FT                   HAWTEWEESVCKLDSKYMISSPRHTFEALTDTSLEDLTSRNLSYLENERYQTVMVPGPR
FT                   SWSHSWVLWNGAAVHS"
     atgttggttt cgatgaaaag aaacccccct agtattaggc aagctcccaa ggccattcct        60
     attaaatctt cttcctgggt cggtgatata caccaatacc ttaaatccac ctttgttacg       120
     tatcctatcc tgaaagctct aggactggat ttactagacg cctttcctgt tgagctagtg       180
     ctatcgatag cagattttct tccacttgag gatatctatt gcctatctct ttgcaacagt       240
     cgattgctcg caatattccg gagctggaaa aagcgggaat acctggatcg aaaggcccgg       300
     ctgtctttct tacatcggct cgaacgtgat cacccacgat acttaacttg cgatgactgc       360
     ttaattcttc atgatttaga cagtatatca gagcccttgg agttatcata ctcgacgaag       420
     acctacccgc ctcgcattga ctgccctgcg cttaggcctg gctatagtac atgtggtcgt       480
     tcatggataa atctccataa cgactccagt gtacaacaca cttatgcatt acacttttct       540
     catcttcaac tcgctatgag acgattctat agcgattctc aatacggcat tagtacagat       600
     gcgctatcct tcaccgaagt gacaaatgaa tttgtggaag gagaccgggt cctcaaaccg       660
     actactcttt tctccgtcga ggcacagata tgccccgagg caccgagttt gtatttgcga       720
     attcaggatg tcgtgtcaat gaaagacatg cggctactag gcgacgacaa atactatgag       780
     gaagtggaga aagaatattt tgcagccctc ccgatttgca aacaccaaca gaaaacgatg       840
     gggattcagt ctatccctcg agacgtattg actcacgagt gttcgaactg cagcgattgc       900
     aacaccgact gggagattga attgtttgaa aaccgaccaa gtggtcatgt cacaatggtg       960
     atgaccagat acatcgatct tggccccggt ctcagcttag atgatccccg atggagtgtt      1020
     cacgcatgga ctgagtggga agagtcggtt tgcaaactgg actcgaaata catgatttcg      1080
     agtcctcgac atacattcga ggcccttacc gatacctcgc tcgaagattt gacttctcgc      1140
     aatctctctt acctcgaaaa tgagaggtat caaactgtga tggtaccagg cccccgcagc      1200
     tggtctcatt catgggttct gtggaatggg gcagctgtgc attcgtga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page