(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE96

PENCW_16.PE96        Location/Qualifiers
FT   CDS_pept        join(complement(215671..216525),complement(212858..215596))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172007" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946711"
FT                   /orf_name="Pc20g00960"
FT                   /product="Pc20g00960 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85425.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001831D51"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR0"
FT                   /transl_table=1
FT                   /translation="MAPLENGQTNGLNGDAVPPASPLNNLRFSDIPDAIDIPASSFDSE
FT                   VEVSLLELPDDPTELCTLLENEKAAKNFWVIIALAYAKRKQIDHAIDILTKGLASVAHG
FT                   ATKEKLGLLGWICWMLLLKSRHAPRVAPEGELYSEAKTKDHYLQLATSTLNEASRLNPA
FT                   YPPLFLARGVLCLLRASLYPPRAVRPGAVDTSERVESLRQALKCFDESSKAFGGRNIMA
FT                   ILGRARAHYMLGRYADALEGYQKALIKMPNLTDPDPRIGLGCCLWQLGFKDQAKVAWER
FT                   SLSLNPESKVANVLLAVYYLHDSSRRATTDPMFGSMYKLAMTQYTQKAFKLDKEYPMTC
FT                   SMFASYFLLRKQYPTVETLARKAIEHTDVMSIASDGWYLLGRKSHYEGDNARAAEFYNR
FT                   SDQARGGVDKGYLPAKFGAVQMQITNKDFDGAKFRLEKIVQQSKNPEAMTLLAAIHAEE
FT                   VFAAQKSGSKEDKSTETKRAITLLESVRSMWKDEKQNISPDESVLVYLSRLYEGTAPDK
FT                   SMQCLTQLEQIQIAEIPEDARPDIEDQEKMNAALRESLPPQLLNNMGCFLYQNDKIALA
FT                   RGLFQSALNACVQSKEKEDGTDTDALVTTISYNLGRTYEAADMWDEAKKVYEGLLERHS
FT                   DYTEANARLTYIALRQSPTDEGPKKIGKLYEAESTNLEVRSLYGWYLSKAKKRVANLAE
FT                   DSEQRHFKHTLQYYDKHDRYALTGMGNVHLLAARDMRRDTDQEKEKRRKIYQRAVEFFD
FT                   KALQLDPKNAYAAQGIAIALVDDKKDHSSAVQILSKIRDTIKDPSVYLNLGHVFAELRQ
FT                   FSRSIEHYETALSKDRQRDVQILACLGRVWWLRGKQEANLAAMKTALDYATRARDIAPD
FT                   QLHLQFNVAFVQNQIASLAYGLQPTQKTLQDVQEAAEGLKEAIETFERLSKEKNPPYPS
FT                   AALEQRANMGRTISKQLDRAMQSQKEYEEKNAAKLQQAREAREAAARVREEELRKAQEV
FT                   EMERKKRIAEERAQMVEEVQRHALQRAEEERAREEAELTHDSETGDRVKRKKKPASKRK
FT                   KKGGDDFIADEGEGEAAHSAAESEGEAPKKRRRLGRRSGGKAQVDKPEKPGKYKSSEMV
FT                   VDSDDEEAARSAGEDKDDMFGDDEEPAEEAAPRRRGKASRRIADEDEDEDEDEEVQQEV
FT                   QAEKSVHEDDKDDDLFGEEPSKTTEDTEMQE"
     atggcgcctc ttgagaatgg ccaaactaat ggcctgaacg gtgatgctgt acctccagct        60
     agcccattga ataacctgcg cttttccgac atccccgatg ctatcgacat tcccgcctcc       120
     agcttcgaca gcgaagtcga agtcagcttg ctcgagctcc ccgatgaccc gactgagctt       180
     tgcaccctct tggaaaatga aaaagcggcc aagaatttct gggtgatcat tgcgcttgcc       240
     tacgcgaagc gaaagcagat cgaccatgcc atcgatatat tgactaaggg tctggcttcc       300
     gtcgcgcacg gggcgacaaa ggagaaactc ggtctgctgg gctggatctg ctggatgctg       360
     ctgctaaaga gccggcatgc tcctcgagtc gcacctgaag gggaactgta ctcggaggcc       420
     aagaccaaag atcactacct ccaacttgcg acgtcgacgt tgaacgaggc ttcccgactc       480
     aacccggctt atcctcctct ctttctggcg cgtggcgtct tgtgtctcct ccgtgcatcc       540
     ctatacccgc cccgtgccgt tcgtccaggt gcggttgata cctcggaaag agtcgagtcg       600
     ctgcggcagg ctctgaaatg tttcgacgag tcatccaaag cctttggtgg ccggaacatc       660
     atggctattc tgggacgagc ccgcgcgcat tacatgcttg gaagatacgc agatgcactt       720
     gaaggatacc aaaaggctct gatcaagatg cctaacctca cagaccctga tcctcgtatt       780
     ggtctaggat gctgcttgtg gcagctgggc ttcaaggatc aagccaaggt agcttgggag       840
     agatcactgt ctctgaatcc cgagtccaag gttgccaacg ttctgctcgc agtttactac       900
     ctccacgaca gctctcgccg agccaccacc gaccctatgt tcgggtcaat gtacaaatta       960
     gcaatgactc aatacaccca aaaggcattc aaactggaca aggaataccc gatgacctgc      1020
     tccatgtttg ccagctattt ccttctccgc aaacaatatc ccaccgtcga gacattggca      1080
     cgcaaagcca tcgagcacac ggatgttatg tctattgcca gtgacggctg gtaccttctc      1140
     ggtcgcaaat cgcactatga aggcgacaat gcccgtgctg cggagttcta caaccgttcg      1200
     gatcaagctc gtggtggggt tgacaaaggc taccttcccg ccaaattcgg cgctgtgcaa      1260
     atgcagatca cgaacaagga ctttgatggt gccaagttcc gactagagaa gattgttcaa      1320
     cagtcgaaaa acccggaggc gatgaccctc cttgctgcta tccatgcgga agaagtcttt      1380
     gctgctcaga agtcgggcag caaggaagac aagtcgactg agacaaagcg agccatcaca      1440
     ctgcttgagt cggtgcgctc tatgtggaag gatgagaagc aaaatatctc tcccgacgaa      1500
     tcggttcttg tttatctttc ccgcctctac gagggcacgg ctccagataa gagcatgcag      1560
     tgcctgaccc aactggaaca gatccagatt gctgaaatcc ctgaggatgc tcgacctgat      1620
     attgaagacc aagagaaaat gaacgctgct cttagggaga gtctcccgcc gcagctcctc      1680
     aacaatatgg gctgcttcct ataccagaac gacaagatcg cactggctcg tgggttgttc      1740
     cagtctgccc tcaatgcctg tgtgcaatcc aaagaaaaag aggatggcac tgataccgat      1800
     gccctcgtca ccacaatcag ctacaacctt ggacggactt acgaggcagc cgacatgtgg      1860
     gacgaagcca agaaggtcta cgaaggtctt ctggagcgtc attctgacta cacggaagct      1920
     aatgcgcgtc tgacatatat tgcccttcgc cagagcccta ccgacgaggg ccctaagaag      1980
     attggcaagc tttacgaagc ggaaagcaca aatctggaag ttcggtcgct ctacggatgg      2040
     taccttagca aggcgaagaa acgagtcgcc aacctcgctg aagatagcga gcaacgtcat      2100
     ttcaagcaca cgttgcaata ctatgacaag cacgatcgct acgcgttgac tggaatgggc      2160
     aatgtgcatc tcctcgccgc ccgtgacatg cgtcgtgaca cagaccaaga aaaagaaaaa      2220
     cgtcgcaaga tctatcagcg tgctgtggag ttctttgaca aggctctcca gctggacccc      2280
     aagaacgcat atgcggctca gggtattgcc atcgccttgg tcgatgacaa gaaagaccac      2340
     agctctgctg tgcaaatttt gtccaagatt cgggatacga tcaaggaccc cagcgtctac      2400
     ctcaacttag gacatgtctt cgctgagctt cgccagttct cacggtcaat cgaacactac      2460
     gagactgcct tgtcaaagga tcgccaacgc gatgtgcaaa tcttagcttg tcttggtcgt      2520
     gtatggtggc tacggggcaa gcaggaggca aacttggccg caatgaagac ggcactggac      2580
     tacgccacgc gcgcgcgcga cattgctccg gatcaactcc acctgcagtt caacgttgct      2640
     ttcgtgcaga accaaatcgc ctcgctcgca tacggtctac agcccaccca gaagacactc      2700
     caagatgtcc aagaggcagc ggagggtctc aaggaagcca tcgaaacctt cgagcgtctc      2760
     tccaaggaga agaacccacc ctaccccagc gctgcactgg agcaacgagc caacatgggt      2820
     cgcacaatca gtaagcagct tgaccgagcc atgcagagtc agaaggagta cgaagagaag      2880
     aacgccgcga agcttcagca agcccgtgaa gctcgggaag cagccgcgcg ggtccgggaa      2940
     gaggaactgc gcaaggccca agaggtcgag atggagcgca agaagcgcat cgccgaggaa      3000
     cgcgctcaga tggttgaaga ggtgcaacgg cacgccttgc agcgcgctga agaggagcgc      3060
     gctcgcgaag aggccgaatt aacccatgac tctgagaccg gtgaccgggt caagcgcaag      3120
     aagaagcctg ccagcaagcg caagaagaag ggcggggatg atttcattgc ggatgaaggt      3180
     gaaggcgaag ctgcacacag cgcggccgag agcgagggcg aggcgcccaa gaagcggcgc      3240
     cgcttgggac gccgatcagg tgggaaggct caagtcgaca agcccgagaa gcctggcaag      3300
     tacaagagca gtgagatggt tgtcgactct gacgacgagg aggctgctag gtctgctggc      3360
     gaagacaagg atgatatgtt tggcgacgac gaggagccgg ctgaagaagc tgccccgcgc      3420
     cgtcgtggca aggcttctcg tcgtattgct gatgaggacg aggatgagga cgaggatgag      3480
     gaagtgcagc aagaagtgca agccgagaag tctgtccatg aagacgacaa agatgacgac      3540
     ctgttcggcg aggagccttc gaagactacc gaggacacgg agatgcagga gtga            3594
//

If you have problems or comments...

PBIL Back to PBIL home page