(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE97

PENCW_16.PE97        Location/Qualifiers
FT   CDS_pept        join(complement(217379..218238),complement(216925..217312))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172018" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946712"
FT                   /orf_name="Pc20g00970"
FT                   /product="Pc20g00970 protein"
FT                   /function="acyltransferase activity"
FT                   /protein_id="CAP85426.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI0001831D52"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR1"
FT                   /transl_table=1
FT                   /translation="MEPTEVRQRKPPTTKDAGELQKLSTKPPSEPRLKHGIPMQILRSL
FT                   LLITWADCCIMAICVTQLIGCPLYLINRYYYYSYMAYTKQCFGLVLGSVTQWSSPTLFR
FT                   VSGDASVRGQIHLSKDGLLETRFPERLVMISNHQVYTDWVYLWWVAYTNQMHGRIFIIL
FT                   KESLKYIPIVGTGMMFYGFIFMARKWMSDKPRLQHRLDKLKTAYTGSNSARPQYDPMWL
FT                   LIFPEGTNLSINTKRRSDIWGEKQGLPSFKHVILPRSTGLFFCLQQLRGTVDWVYDCTM
FT                   AYEGPPKGSYPDKYFTLRSTYLQGRPPTSVNMHWRRFQVSKIPLDDQKEFEEWMTARWA
FT                   EKDQLMDQYFETGRFPTELAGSIKADHAVDGQQAAALAGYVESYGSLHHWSELGLIFVV
FT                   LVSVAVLCKFVTSWMQ"
     atggagccta ccgaggttcg acagcgcaag ccaccgacca ctaaggatgc cggggagctc        60
     cagaagctct cgaccaaacc accttccgag ccccgtctca agcacggcat tcccatgcag       120
     atacttcgct cgcttctgct gataacgtgg gcggattgct gtattatggc gatctgtgtg       180
     acgcaactaa tcggttgccc gctgtatctg atcaacagat attactacta ttcatatatg       240
     gcatatacaa aacaatgttt tgggttggtt ctcggttctg tcacccaatg gagctcccca       300
     acgctcttcc gggtcagtgg tgatgctagc gtgcgtgggc aaatccatct atccaaagat       360
     ggattgctgg agacgaggtt cccggagcgt ctcgtcatga tctcaaacca ccaggtatac       420
     actgactggg tttacctctg gtgggttgca tacaccaacc agatgcatgg ccgcatcttc       480
     atcatcttga aagagtcgct taagtacatc ccgattgtcg gcacgggcat gatgttctac       540
     ggttttatct tcatggctcg caagtggatg tccgacaagc caaggctcca acatcgtttg       600
     gataagctga agactgccta caccggctcc aactcagctc gcccgcagta cgatcctatg       660
     tggctgctaa tcttccccga agggacaaac ctgtccatca ataccaagag acgcagcgac       720
     atttggggtg agaaacaagg actgccttca ttcaagcacg tgattcttcc gcggtctacg       780
     ggtctgttct tctgtcttca gcagttgcgg ggaaccgtag actgggtgta tgactgcacc       840
     atggcctatg aaggaccacc aaagggaagc tatcccgata aatacttcac tcttcgctcc       900
     acatacttgc aaggacgacc gccgacctca gtcaatatgc attggagacg ctttcaggtt       960
     tcaaagattc ctcttgatga ccagaaggag tttgaggaat ggatgacagc acgctgggcc      1020
     gagaaggatc aacttatgga tcagtacttc gaaacgggcc gcttcccaac cgagttggcc      1080
     gggtcgatca aggctgatca tgcagtagat ggccaacagg ctgctgcttt ggctggatat      1140
     gtcgagtcct atggtagcct acatcactgg agtgagcttg gtcttatctt tgtggtgctg      1200
     gtcagtgttg ctgtgctctg caaatttgta acaagctgga tgcagtga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page