(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE98

PENCW_16.PE98        Location/Qualifiers
FT   CDS_pept        join(218842..218968,219037..219151,219209..220259)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172029" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946713"
FT                   /orf_name="Pc20g00980"
FT                   /product="Pc20g00980 protein"
FT                   /function="NAD+ kinase activity"
FT                   /function="metal ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85427.1"
FT                   /db_xref="GO:0003951"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniParc:UPI0001831D53"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR2"
FT                   /transl_table=1
FT                   /translation="MLRAILRRSPRLALRQHFSTSRPRHEIKDIGSLSQRLIPKYQESC
FT                   DGELLCLQWPAPPRNIFLVRKDCAPAVTDSLIEFVNHVSSAYPSIAVILESKTAAEVHS
FT                   SLSFPVYSVSLDEKTTALHDKVDLTVTLGGDGTILHAASVFATCSNVPPVLSFSMGTLG
FT                   FLSEWKFSEFKRAFREVYMSGAGAGDRTHVLEGVPGAGLTEQESEMGPTGWSSVRGKSM
FT                   GSTRGARILMRNRLKVGLFAADGTETTPIRTKTDQGQGVYVMNELLIHRGKEPHLAVVD
FT                   VFVGGRFLTEAVADGIIISTPTGSTAYSLSSGGSIVHPLVPSILLTPICARSLSFRPLV
FT                   LPSSTPITLRLSEKNRGRELEVSLDGVHLGQGMAVGMEVRVWNEEMRHGKNEWQGGVPS
FT                   VMRRSVGCEAHEGWVGGLNGLLKFNHPFGEL"
     atgctccgcg ccatcctccg caggagtccc cgcctcgcct tgcgccagca tttttccacg        60
     tctcgaccac gtcacgagat caaagacatc ggctctttgt ctcagcgctt aataccaaaa       120
     taccaagaat cctgcgacgg agagctcctg tgtcttcagt ggccagcacc gccgcgaaat       180
     attttcctgg tgcgcaaaga ctgcgccccg gcggttaccg attccttgat tgaattcgtc       240
     aatcatgttt cctctgcata cccatctatc gcggtgattc ttgagtccaa gactgccgcc       300
     gaagtacatt cttcgctctc ttttcctgtc tactcggttt cccttgacga gaaaacgacg       360
     gcgcttcacg ataaagtcga cctcacggtg accctgggcg gcgatggtac gattctacat       420
     gcagcgtcgg tcttcgcgac ctgctcaaac gttccgcccg ttctctcatt cagcatgggt       480
     acattgggtt tcttgagtga gtggaaattc tcagagttta agcgggcttt ccgagaagtc       540
     tacatgtctg gagccggggc aggggatcgg acccatgtgt tggaaggtgt ccccggggcg       600
     ggactcacag aacaggaaag tgagatgggt ccgaccgggt ggtcatccgt ccggggcaaa       660
     tctatgggct ctacgcgcgg ggcccgcatt ctgatgcgca accggttgaa agtaggactg       720
     tttgccgctg acggaaccga aacgacacct atccggacca agaccgacca gggccaggga       780
     gtatacgtga tgaacgagct cctcatccac cgtggcaagg aaccgcactt ggctgtggta       840
     gatgtgtttg tgggtgggcg gttcctgact gaggctgtgg cagatggaat cataatttcc       900
     acgcccacgg gaagtacagc ctacagcctg agcagcgggg gtagcattgt gcatccacta       960
     gtcccatcca tcctcttaac gccgatttgc gcgcgtagcc tcagtttccg gccattggtt      1020
     cttccttcca gcacccccat cacactgcgg ctgagcgaaa agaaccgagg gcgcgaacta      1080
     gaagtcagtc tggatggtgt tcatttaggt caagggatgg cagttggtat ggaggtccga      1140
     gtctggaatg aggagatgcg tcatgggaag aatgagtggc agggtggtgt gcccagtgtg      1200
     atgcgaagaa gtgtggggtg cgaagcccat gagggatggg taggtggatt gaatggattg      1260
     ttgaagttca atcatccatt tggagagtta taa                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page