(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE99

PENCW_16.PE99        Location/Qualifiers
FT   CDS_pept        join(220869..220885,220946..222959,223018..223527)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234202" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946714"
FT                   /orf_name="Pc20g00990"
FT                   /product="Pc20g00990 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85428.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831D54"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR3"
FT                   /transl_table=1
FT                   /translation="MTSYGNNMYSSEQFMNPGPAPRPPTDRPPKLTLPTNNTATSFGQM
FT                   SLDSPSTPAPSTANLSLFPNTSSPSLAMTRSNTGQNGISIIKEGTVRCKEDKFLATWNT
FT                   RYLILREYKLEFLKSDSGKVVITFPLSSVTAVARSEDSKMAFEVTRLANPKDANSKASL
FT                   LARDLPTKTITCEVKSDDEIYEWIDKIYERCPGMGGVSNPTNFSHRVHVGFDPNTGAFV
FT                   GLPPEWEKLLTSSAITKEDYKNNPQAVIEVLEFYSDIKMREQNPQYYAGINSPSNGQPK
FT                   AYGSSVGSSIAPPRPPPPGPMQRLDSSQSKSDGSMRSASSSVGQSDRAADHQQQVERMK
FT                   EMADQERRRVEEERRNKEEQDAYNASIPKSRPNMAQQELGGYGGDEASQNSRYQPSRPA
FT                   PQAPGSAARQQDPRQLTAQRPAPAPPSQSPYGQNAPRAPGAPRTDDRQGSPSSRYPPSD
FT                   PRAPGSASRHQQNGSKGQAGPPPTRLPAPVQAVKPLNIANKQNGNKQNVPDGVRQAEAA
FT                   LTKKADQPRQKEVRMSAMSENEVMERLRSVVSKDNPNESYSKQRKIGQGASGSVYVARV
FT                   KESAPSSVAHELYRTYGPRCQVAIKQMDLRSQPRKELIVNEIIVMKDSQHPNIVNFLDS
FT                   FLQESSNELWVVMEFMEGGALTDVIDNNQVITEGQIATICAETCKGLAHLHNQSIIHRD
FT                   IKSDNVLLDRVGHVKITDFGFCAKLTETKNKRATMVGTPYWMAPEVVKQKEYGPKVDCW
FT                   SLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKKPEKLSKELKSFLSVCLCVNVQ
FT                   SRASADELLAHEFLQTGCSLASLAELLRWKKATG"
     atgacttcgt atggaaacaa catgtactcg tcggagcagt tcatgaatcc ggggccagcc        60
     ccccggcccc ctaccgatcg accccccaag ttgactctac caaccaacaa cacagccacc       120
     tccttcggtc agatgagctt ggactctccg agtacaccgg ctccgtcgac ggcaaatctt       180
     tcgcttttcc cgaacaccag tagtccttcg ctggctatga ctcggagtaa taccggccaa       240
     aatgggatct caatcatcaa agaaggcacc gtccgctgca aagaggacaa attcttggca       300
     acctggaata cacgttactt gatcctacgt gaatataagc ttgaattttt aaagagtgat       360
     tctggcaagg tagtgattac gttccctttg tcctcggtca ccgctgtcgc tcgctccgag       420
     gattccaaaa tggccttcga ggtcactcgc ttggccaatc cgaaggatgc aaactccaaa       480
     gcctcacttc ttgcccgcga tctacctacc aagaccatca cttgcgaagt caaatccgat       540
     gatgaaatct acgagtggat cgacaagatc tacgagcgct gccctggaat gggcggcgtc       600
     agcaacccga caaactttag tcaccgtgtt cacgtcggct ttgacccaaa taccggcgcc       660
     tttgtaggtt tgcctcccga gtgggagaag cttctgacat cctccgctat cacgaaggaa       720
     gactacaaga acaaccccca ggctgtcatt gaggttcttg aattctactc ggatatcaag       780
     atgcgcgagc agaacccgca atactatgct ggaatcaact ccccatccaa cggtcaaccc       840
     aaggcatacg gtagtagtgt cggtagctcc atcgcacccc cgcgtcctcc accaccagga       900
     cctatgcagc gccttgatag cagtcagtcg aagtctgacg gttctatgcg ctctgcatca       960
     tcctcagtcg gacagtcgga ccgtgcggca gaccaccaac agcaagttga acggatgaag      1020
     gaaatggccg accaagagcg tcgccgtgtg gaagaggaac gtcgcaacaa ggaggagcaa      1080
     gatgcttata atgcttccat cccgaagagc cgtcctaata tggctcaaca agagcttggt      1140
     ggatatggcg gcgacgaggc atcacagaat agccgctatc aaccaagccg ccccgctcct      1200
     caggctccag gatctgctgc acgccagcaa gacccccggc agctcacagc acagcgtccc      1260
     gcaccagcgc caccgtcgca gagtccctac ggccaaaacg cgccccgagc accgggtgct      1320
     cctcgcactg atgaccgcca aggctcccca agctctcgct acccccccag tgaccctcgg      1380
     gccccaggat cggccagccg tcatcagcaa aacggttcca agggacaggc cggaccccct      1440
     ccgacacgcc tgccggctcc cgttcaagct gtgaagccat tgaacattgc caacaagcaa      1500
     aacgggaaca agcagaacgt ccccgatggt gttcgccagg ccgaagctgc tcttaccaag      1560
     aaggcagatc agccacgtca gaaggaggtg cgcatgtcgg ccatgtcaga gaacgaggtc      1620
     atggagcgac tgagatctgt cgtatccaaa gacaacccga acgagtctta cagcaagcag      1680
     cgcaagattg gtcagggtgc atctggatcc gtgtatgtgg cgcgcgttaa ggaaagtgca      1740
     ccttccagtg ttgcccacga gctttaccgg acgtatggcc cgcgctgcca ggtggccatt      1800
     aagcagatgg acctgcgcag tcagccccgc aaggagttga tcgtcaacga aattattgtc      1860
     atgaaggaca gccagcaccc gaatattgtc aatttcctcg actcgttctt gcaggaatca      1920
     agcaatgaac tctgggttgt catggagttc atggagggtg gcgcgttgac tgacgtgatt      1980
     gataataacc aagtaattac tgaaggtcag atcgcgacaa tttgtgctga gacttgcaag      2040
     ggtctggccc atctgcacaa ccagagcatc attcaccgtg atattaagag tgacaatgtc      2100
     ctcctcgacc gtgtcggcca cgtcaagatc accgatttcg gcttctgcgc caagctgacc      2160
     gaaaccaaga acaagcgcgc caccatggtc ggcacccctt actggatggc acccgaggtg      2220
     gtcaagcaga aggagtacgg cccgaaggtc gactgctggt cgctgggcat catggccatc      2280
     gaaatgatcg agtcagagcc cccttacctg aacgaagagc ccctgaaggc cctctacctt      2340
     attgccacca acggaacccc ccgtctcaag aagcccgaga agctcagcaa ggagcttaag      2400
     tctttcctga gcgtctgcct ctgcgtcaac gttcagagcc gcgcttccgc ggatgagctc      2460
     ctcgcccacg aattcctgca gaccggatgc agcctggcta gtctggctga gctgctccgc      2520
     tggaagaagg ccactggcta g                                                2541
//

If you have problems or comments...

PBIL Back to PBIL home page