(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_17

ID   PENCW_17; SV 1; linear; genomic DNA; GRV; FUN; 6387817 BP.
XX
AC   AM920437_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 19)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c22, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920437.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6387817
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        join(<4..11,22..141,317..627,734..960,1085..1612)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940254"
FT                   /orf_name="Pc22g00010"
FT                   /product="Pc22g00010 protein"
FT                   /protein_id="CAP97289.1"
FT                   /db_xref="UniParc:UPI0001832B8D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HNZ1"
FT                   /transl_table=1
FT                   /translation="CGARLGIHRAVGQAVAAAKRDGSQLEAPVDEVDAAVRRQWRTCFD
FT                   SFLSFGFGRPQSTQFESVDDQAFLKARLSHPLPRPGTPASLSLYGDAYIAATARLAHVA
FT                   RSFVLWVEEQEPVGSLDGQSLLSMLSNLNGKLDDWCKLWVWSGSSHALYLGASARIARL
FT                   QAEHLRLSINAMALRSSTHSDGHESSVTYLRKALNAAKSTIQTHFESSQTDLALSFATD
FT                   YMTMAFAQAAVFLIRLTKASPLVQQVVSLDPAVVSHYLTMSVDLLEVGDMSETRLSTYF
FT                   ARTIRGISRAAGLAIRPDDSTTIAGVAGDGRGDQPYVPEQSMSLVSADGIGDAGLYDAE
FT                   TFGAGHDPFDLSCVLGLSGVGVAQDTEWLDPALGNLGPFTQPTTPLNMMFGTGEGSV"
FT   CDS_pept        complement(2876..3964)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234523" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940255"
FT                   /orf_name="Pc22g00020"
FT                   /product="Pc22g00020 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP97290.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI0001832B8E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HNZ2"
FT                   /transl_table=1
FT                   /translation="MASSQKDTSISRLPLLAVAYLHRGHRQDQKWTYRQALTNTALKVS
FT                   LRMFTALHMRPHLSLKPNLEGKQFVLIEPAKPELYIGVAVDEQVKPETIGGTWYPERLS
FT                   PETLVPEGDYVVLHLHGGSYVLGDGRTASCRFLANNLLSHTPATYVFCLQYRLAVDPRG
FT                   RFPAQLQDVISAWYYLIHTMHIPSSRLVLSGDSCGGDLVLGLLRYIVQYDNPSLLPAPK
FT                   CSWVFSPWCNVLNAHNTHAWIESQNYKTDCIPASFPAWGAKQFLGDLEITEPIEQFVAP
FT                   IRHPFPLPSPVLIVTGGREVLCQAHQELAYAFGKLPQNASSVELFVEENVPHDVLMVGW
FT                   IMNFREEARRCSERAGAFMTGV"
FT   CDS_pept        complement(4347..6086)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185918" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822533"
FT                   /orf_name="Pc22g00030"
FT                   /product="Pc22g00030 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97291.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI0001832B8F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HNZ3"
FT                   /transl_table=1
FT                   /translation="MADTRAPEHPDNTGKVISRHLHPRFTGAYDGITEYDGDVRDTQAT
FT                   DYDGNRRSTFIGHGQQSSLKLQGGDIHRDLYRTEARLKRAGLDQRAATFSHPPRLETDD
FT                   DLDITIHGEPGAFRRQFLRRNKRDFANKYAPNSFVEFLELYGRFAGEDLIESEDETDVE
FT                   SAGIPGNEVEPEIRPLLPIRESSQGDASDMKTFFTLLKAFIGTGIIFLPKAFRNGGMLF
FT                   SSIALVTVSILTTISFHLLLQCQRRYGGGYGDIGESISSSHLRSLIRLSIATTQLGFVC
FT                   AAIAFTANNLRSFIEGVATYNINTPSISTIIALQLVIIVPLAFIRKISRLGPVALLADV
FT                   FIFIAIGYIYYYDISEISQRGLQPTVKLFDSNTFTLTIGSSIFMFEGIGLILPIQSSMS
FT                   QPDRFDHILYIVMALITFLFATLGILSYGAFGSQTKINIISNFPQSDKFVNSVRLLFSL
FT                   AVLVGTPVQLFPALRIMERKLFGRKSGQRDLLIKWKKNTFRTGIVVLCALVAALGARDL
FT                   DKFVALVGSISCVPLIFVYPAYLHWKGIATTWWEKGGDMLIITVGVACMVYTTMVTVFL
FT                   QFN"
FT   CDS_pept        join(complement(8314..8858),complement(7175..8247),
FT                   complement(7104..7135),complement(6839..6925))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000237402" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975750"
FT                   /orf_name="Pc22g00040"
FT                   /product="Pc22g00040 protein"
FT                   /protein_id="CAP97292.1"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="UniParc:UPI0001832B90"
FT                   /db_xref="UniProtKB/TrEMBL:B6HNZ4"
FT                   /transl_table=1
FT                   /translation="MDGSSRRNQRSPEATEAWVLGSGTASLASAVYLITHAKLRPSAVH
FT                   ILDEHLSLQETIHRQGSAHAGYDQFAACLPVPIGSELKEFLDAIPSAVAEGQSFLDDIQ
FT                   QEEKRLAIDRTGRTCFIAQKDGRFKHLPTDSLNLSWNHRINLVRLLMKREKTLQGVAIR
FT                   DLFRRSFFESTFWTIWSIQFGFQPWHSAAEFRRAIRQYLSGFRSLSISSCLDITGHYQY
FT                   ESLHLPIYFFLQSQGVDFQFGTKIRNIETTLNQNQYAITQLSLSRHGLDFQKKLGPSDL
FT                   VLATLGSTVSGCAIGTNDHPPPWHSIEASDHLDANWSLWLEVGNKYQGIGNPYTFCTRK
FT                   SESILESFTVTTEDMEFFDRLESLSQCPCQAGAMIIMKDSSWGLSICLPVQPVFPQQPQ
FT                   DVRVLWGFALLPEIEGDHVKKTMLSCSGAEVMSEILYHLDLPGDMAMEALQRSIVIPRA
FT                   MPRMSSTLLTRSLEDRACITPKSISNVGLVGSFVETPGRSCVDVSYAVHAARIAVSHLM
FT                   GLEPWAEESPSPSISRLLITLLWVGPLRLKSGTLMGDYFNDTYKRPVRQYAQYRKDAYI
FT                   IK"
FT   CDS_pept        complement(10223..10456)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669785"
FT                   /orf_name="Pc22g00050"
FT                   /product="Pc22g00050 protein"
FT                   /protein_id="CAP97293.1"
FT                   /db_xref="UniParc:UPI0001832B91"
FT                   /db_xref="UniProtKB/TrEMBL:B6HNZ5"
FT                   /transl_table=1
FT                   /translation="MPYLSGHTCLLETNQKDLGNWTWMFTNNNQWHELSFVLTELCLRP
FT                   LGTDADCAWRAVDYVLLPCGCRKVHARSRRLG"
FT   CDS_pept        join(complement(11269..12076),complement(10979..11222),
FT                   complement(10663..10927))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940256"
FT                   /orf_name="Pc22g00060"
FT                   /product="Pc22g00060 protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP97294.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI0001832B92"
FT                   /db_xref="UniProtKB/TrEMBL:B6HNZ6"
FT                   /transl_table=1
FT                   /translation="MTSRNPSYLIIGAGVFGVSTAYHLIQKYPNASVTLVDRDAYDAES
FT                   RVAASWDWNKVIRADYDDKVYCRLALEAQEIFKSDPLWQPHFHQTGVYWTCRSEYAQNV
FT                   ITNHKELGRNDDIIALPVAEARKLYGGVFDNADYTGVKEVLVNRASGWAAAGDALRAVT
FT                   KRCLELGVSYITASVTNLEFDGRGSCTGVKTRTGDTLSASHVVVAAGAFTPTLLEWSAV
FT                   KSGNAGLRAGERIVAAGITTGMAQLNEEQYQKFKDMPVGFQGYTPDEGKPFIGSIPPTK
FT                   DRELKWWGSKIFTNTREVFPGHYISSPPPTQDYNQWKVPGPLKQDIVESRNLWYGPESA
FT                   TWEMTKHRICWDAFTTTSDFIISPHSASKGLYIATCGSFHGYKFFPVLGKYIMQMLEGE
FT                   LAPELIERWAWDRQRPDSSQNVEYPNSEMKHLLEPAAKL"
FT   mat_peptide     join(complement(11269..12013),complement(10979..11222),
FT                   complement(10666..10927))
FT                   /db_xref="UniProtKB/TrEMBL:B6HNZ6 "
FT   sig_peptide     complement(12014..12076)
FT                   /db_xref="UniProtKB/TrEMBL:B6HNZ6 "
FT   CDS_pept        join(complement(14298..14498),complement(14206..14242),
FT                   complement(14080..14147),complement(13648..14022),
FT                   complement(13338..13586),complement(13099..13261))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(15432..15639,15706..16809)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(19571..19660),complement(17403..19517),
FT                   complement(16854..17252))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975751"
FT                   /orf_name="Pc22g00090"
FT                   /product="Pc22g00090 protein"
FT                   /protein_id="CAP97297.1"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="UniParc:UPI0001831F1C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP71"
FT                   /transl_table=1
FT                   /translation="MPPNQDNQDTQIIGYAEPWIVSPGDPVDIKVSSSEKGYDHRLVRL
FT                   VQGYSGPHAPPVVLEDITEVPVGHHEDGRYQDACPGSYALIPSWAEVTPTVKEGIEVEF
FT                   HVQPYLLDVNYYCQTLISCLDISSRTGFAVVLRNSNIEFFIGTGNRIQVIQSQLVVNRW
FT                   RWLQIRLSVLNNTFTSNIRQLNRLAEIAPNGETMTTAMLAPMILGSNSLLFGAGMFKDI
FT                   GHQSSKPSCFYNGRIDSPSFTMAGSSRRTLAQYDFSKDIPSDSIADVSGNGRHGVLVNA
FT                   PTRAVKGFDWDGTQPDWTKASYGYGAIHFHEDDLDDAKWATNFSVTIPSTARSGAYAVE
FT                   VKCSDGTSDMVTFFVRPGPSSTAQVALVLTTFTYLAYANERMFDETKSSAMTTPDGVSI
FT                   GQGNEYYKNLARRPDLGLSAYDVHTDGSPCAYSSARRPILNLRPGYVHWALDRPREFSA
FT                   DLLMVGFLERSGIPYDIITDHCLSSRGREATSQYTTIITGCHPEYHSLGSLDAFSAFAK
FT                   SGGNMMYLGGNGFYWVADVVNEQPHRLEVRKGDQGCRSVTFPAGERMHSLTGSLGGLWR
FT                   SRGRAPNYLWGIGPCAFGAGKGKPYTADLRYVQDAQFSWIFKGMDPTEPIGENGFGGGA
FT                   SGDEIDRLDYALGTPSNTVLLARSQQHDDSFGLFNEDSMFPMVNTLGSNCDMVRSDLVY
FT                   YDTAGGGAVFSVGSINWYCSLGWDDYSNNVATMTGNVLREFHMSRIRPRGPGAPGKGPG
FT                   DKYIFLFMPQVDTNNLPEATSILFSFSIASQGWILKAIISLHTKAIHSVDAITFQYTNL
FT                   YAESEAPGQTGFLVFLPGKIDLVELTARHAWIKWIVIYMAHIVCPIQLLRHELTE"
FT   CDS_pept        join(20852..20974,21154..21599,21649..22582)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940257"
FT                   /orf_name="Pc22g00100"
FT                   /product="Pc22g00100 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP97298.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001831F1D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP72"
FT                   /transl_table=1
FT                   /translation="MENQDIESLADSKSTHAKTDLDKSAPGMVEEGVMVTLTNEEVLDK
FT                   GVLGTASIFNLQEDTGLVGSQYSLVSSIAPIAQLAWQPFSAWLIVKVPPRILMPSMVLG
FT                   WGVAAASTAACNSFAGLVTVRFFLGLFEAGCMPLFTILTGQWYRRVEQPLRVSIWYSMN
FT                   GTATMVASALSYGLGHIPSDALKPWQTIFLVVGLITIVSAPVVYWKLDNDITSARFLTE
FT                   HERQQGVERLRANKTGASSYNFDWSHVLEVALEPKSWLWVVMALLPNMGSAMTSTFGPL
FT                   IVKGFGFDAYQTSLLNIPFGAVQTVVIVASCWASYKLKLKSAVLAGFMLPVVAGIGMLY
FT                   GLRHDDQSNQGPLLLAYYLCAFLFSANPLLLSWVVGNTAGAAKTSTTMALYQVGTSAGA
FT                   LAGPLLFTAEQSPSYLPGIRAILGLFIALVGCVALQVLNLAFLNRQHSKRRVSNGKSAE
FT                   VQDRSMTNAFEADGKVQVPLSDEAAPFLDLTDRKNDEFVYIY"
FT   CDS_pept        join(complement(24163..24366),complement(23918..24110),
FT                   complement(23607..23860),complement(23463..23543),
FT                   complement(23050..23385))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126795"
FT                   /orf_name="Pc22g00110"
FT                   /product="Pc22g00110 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97299.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0001831F1E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP70"
FT                   /transl_table=1
FT                   /translation="MAPLPEGVAKSLAETKVEYRRLGNSGLRVSVPIVGCMSIGNPEWA
FT                   NWVIGPEKALPLLKAAYDRGVNTWDTANIYSNGDSERVIAQAIKEYEIPRHKLVLMTKA
FT                   YSCVGEQQFHAYPIIEDLKKTKDYVNQFGLSRSAIFTALNDSLKRLETDYIDVFWIHRF
FT                   DPDTPIEETMHALHDLVIAGKIRYLGASSMWAYQFAMMQAYAEKNGLTKFIAMQNRYNL
FT                   LYREEEREMIKYCNATGVAVVPWGPLAEGQLARPLNIRGTTTRSAGGNETPSSLRPESM
FT                   EIINRVDELAKRKQWTMSQVTLAWQLKRVTTPIIGFSSVARIEDALSARGKELTAEEEK
FT                   YLEEVYTPVEVEGHF"
FT   CDS_pept        join(25421..25516,25559..26188,26247..26340,26397..26739,
FT                   26794..27217)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975752"
FT                   /orf_name="Pc22g00120"
FT                   /product="Pc22g00120 protein"
FT                   /protein_id="CAP97300.1"
FT                   /db_xref="UniParc:UPI0001831F1F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP79"
FT                   /transl_table=1
FT                   /translation="MSPPPLVAREDTRRRPYGPRSRNGCLTCKRRKRLNLECDWKVNEP
FT                   QRHPSLQNDPVSLKSNVALEVNQLSPSPFLFDFHPMPAPTEGFHMFQNVYFPDFGDFTA
FT                   LGNTYQQARSSDADSPSSSLPPRQSSQHSPVANPEVQTSLHLHLPPILDPVENGPRCAS
FT                   ARELLENMATSSQMLRSSIAAFEAIQSGSGGGPAGYQQHYENAATELSQRFGESAGDVI
FT                   ISDNELRYVLATIFFLTYINFLTSRLDLAYLNLAKAHNALQASQRSGLGSTELRIISWI
FT                   RLLDARAASAGGEGVLVNDTSGIYTSPQGSSYPSSTPQSIGSASNPGAHEVIYDLLCQP
FT                   GITFFQEVQTITGRITRIAHNHRSRGSVEDETEVMAIAADILADLSSFDTLAEPLASTI
FT                   VRSFQTYLANFYACYIHLHRVAHRHLVRSKAAVTALCKIKEIVHRMVNNNESIPVNMLW
FT                   PLFLWGTEEDDSDEFQWILQTIRGLQHVFTNANMTADVLQETQRRQREGGKRVDIRSVC
FT                   LELFYTTFAIV"
FT   CDS_pept        join(complement(28257..28410),complement(27663..28207),
FT                   complement(27332..27607))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173607" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940258"
FT                   /orf_name="Pc22g00130"
FT                   /product="Pc22g00130 protein"
FT                   /function="lyase activity"
FT                   /protein_id="CAP97301.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001831F20"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP73"
FT                   /transl_table=1
FT                   /translation="MASSSTKTNKPFPPGIHGPSVTFFEDDQQQDIDWATQERHLEYMI
FT                   TSGMHGVVLAGSSGESATLSVEEKGMLVKRAREIADAHGKTDFTVTMGCLAGSTRDILV
FT                   QIETAYKNGADFTLVLVPSVFHWAMTQKAITDFFEEVADRAPIPIVIYNFPNLLSGLDV
FT                   NSDMLEKLAAHPNIAAVKLTCGGVGKATRVAARFEPSQFTSLPGMSDWLVAAFAAGSTG
FT                   CISGVANIFPRVMVEIYDLFMAGKVAEATALQKKLVQPEWGIGTSDVNGMKWIIAKERG
FT                   YPLSSAHCRRPFPKFAETEKQDCVVRLVAPLLPVEEELKSKKV"
FT   CDS_pept        join(29135..29705,29766..30418)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000054183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940259"
FT                   /orf_name="Pc22g00140"
FT                   /product="Pc22g00140 protein"
FT                   /protein_id="CAP97302.1"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="UniParc:UPI0001831F21"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP74"
FT                   /transl_table=1
FT                   /translation="MLSSLMYLARECSILRAISLCAILAVATPAASASVTAKHTLATNG
FT                   KGLFPQYRIVALASLGNGVLLASYDGRPDGGDSPSPNSILQRRSTDGGKTWGNPTYIAR
FT                   GQPASSTLQQYGFSDPSYVVDSGTGKVFNFHVFSKNQGFLNSEIGNDDTDLNIVSAEVS
FT                   VSTDGGLSWTTDPDHESSLPPVASADVANVGGITGMFASSGEGIQLKYGKHAGRLVQQF
FT                   LGKVIQSDGSKVSQAYSVYSDDGGAIWKMGKVIGTGMDENKVVELSNGNLMLNSRPSDG
FT                   SGYRKVATSTDGGETWSTPASETQLPDPGNNGAITRMYPDAAHGSANAKILLFTNANSK
FT                   TSRSNGTIRYSCDDGKTWSSGAVFQSGSMSYSTVTALGDDRFGIFYEGDSNDLVYIEVS
FT                   KDFIGVSC"
FT   sig_peptide     29135..29233
FT                   /db_xref="UniProtKB/TrEMBL:B6HP74 "
FT   mat_peptide     join(29234..29705,29766..30415)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP74 "
FT   CDS_pept        join(complement(33520..33670),complement(33406..33493),
FT                   complement(32703..33208),complement(32258..32635),
FT                   complement(31972..32060),complement(31745..31872),
FT                   complement(30953..31691))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126796"
FT                   /orf_name="Pc22g00150"
FT                   /product="Pc22g00150 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97303.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI0001831F22"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP75"
FT                   /transl_table=1
FT                   /translation="MDDTIRLNRASGGALQCLQGSPSRFGNDDISRSGRRGVGYLTPSG
FT                   DIIAERGFSLVKTKYMPGNYDIEYASPWAGANYMPDMYLPPSDVMISDQGKRTNSLGFA
FT                   QSDCHTCASLGEKCDRRRPRCSTCLGQGRRCGGFVMPLSWDPRRMWSNNPSVAGASRDL
FT                   PNGEIVTSSFPNAVPTAFTTSDSPKRFRFVKGVSKPKKRRKANSPKEQSVATETSSVTP
FT                   EVVLRTTAQNLDIFDDLQQGNGLSGLELQDGHLFDDFSLFDSILPNIFASTPFLDIEPQ
FT                   KTLTAEVSGVMETPRMTPLSSADRPIEPALQNLQTCPVNVDPMFRDEEEQSAPADLVPR
FT                   TFQEPTIPYSSAGLQAVPMISEISSNDHEKLLDLWRLAGSWPSEAAEHRRKAIQLLECA
FT                   LQSRPCTLSASGNWSTHLMRAHSVLQTHGGPSALTTPRIRSQVAMLTWWDATLALISRQ
FT                   SPIMDQAYLDFLVRWEKQDEWSFFNLTGCPRELLVHLFQLAELAKQCEIGLSMKWLTFN
FT                   MTPVTKIEHELIGWKNDIDPPSSDDDPTLGEEEAIRQLHERQDRYHCAEAWRYALLLYL
FT                   EYIFKSDRKRRSISVHRLVRKTIDHIRSCRRTSQTQKQLLIPVFLAGSETTDEDMRHFV
FT                   KKYCAYWGEKSRYSMFNSVPVLFDEIWATGKWWGAVIDSKTRPSSGDGQETTQLLFG"
FT   CDS_pept        33835..34794
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000276706" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940260"
FT                   /orf_name="Pc22g00160"
FT                   /product="Pc22g00160 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP97304.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="UniParc:UPI0001831F23"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP76"
FT                   /transl_table=1
FT                   /translation="MATMEKIFAAYHERQKLLAANTHPFAKGVAWVEGELTPLHEARIP
FT                   ILDQGFMHSDLTYDVPSVWDGRFFRLDDHITRLEASCTKLRMKLPLPRDEVKQILVDMV
FT                   AKSGIRDAFVEIIVTRGLKGVRGSRPEDIVNRIYMFIQPYVWCMEPEVQPVGGSAIIAR
FT                   TVRRVPPGCIDPTVKNLQWGDLVRGLFEASDRGAEYPFLTDGDTNLTEGSGFNIVLVKD
FT                   NILYTPARGVLEGVTRKSVIDVARASGFDIKVELVPVQMAYDADEIFMCTTAGGIMPIT
FT                   SLDGKPVNDGKVGSVTKKIWDGYWAIHYDPAYSFEIAY"
FT   CDS_pept        join(complement(35640..35829),complement(35057..35590))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(36592..36674),complement(36124..36470))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(37746..38037),complement(37432..37688))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178274" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940261"
FT                   /orf_name="Pc22g00190"
FT                   /product="Pc22g00190 protein"
FT                   /protein_id="CAP97307.1"
FT                   /db_xref="UniParc:UPI0001831F24"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP77"
FT                   /transl_table=1
FT                   /translation="MQLKNLAIAASVSAVASAAPSTQSKTFGVLAIHSGSGVQYSAFNA
FT                   AKSSIFAGLPSQGASCARPEEQQATFYINDGALYLYDQSATPQEIYVDRSGMGQGKIGY
FT                   TTGAQPTPKNSERKGWTEKDGHLQFGGNDLIACPNSIDGAWSIWASAGVANPAGNTNCV
FT                   GIAARVVETENPNGCLYTQ"
FT   mat_peptide     join(complement(37746..37983),complement(37435..37688))
FT                   /db_xref="UniProtKB/TrEMBL:B6HP77 "
FT   sig_peptide     complement(37984..38037)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP77 "
FT   CDS_pept        join(complement(39166..40539),complement(39042..39101))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822534"
FT                   /orf_name="Pc22g00200"
FT                   /product="Pc22g00200 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97308.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI0001831F25"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP78"
FT                   /transl_table=1
FT                   /translation="MGLENISNDHDADKVMGTEGEKAAYVPPPPFEGDMVGEMSEAERN
FT                   IYDHGIKKFSRLGWKRLTIVLIVEAIALGSLSIPSTFATLGMVPGVLCCVGIGLIAIYT
FT                   SYIVGMVKLAFPEVANYADAGRLLGHRLGCGRFGYELVNGMLGLQLIFLTASHCLTGTI
FT                   AFLDITKSGICSIIFAVVSAIILLLLAVPPSFTEVAILGYVDFASIILAIGITIIGTGV
FT                   EATNSPSGLSGVAWSAWPKDHLTFTEAFIAVTNIIFAYSFAMCQFSFMDEMHTPRDFVK
FT                   SIWTLGITEIVIYTVTGATIYAFVGQDVSSPALTSAGTTLSRVAYGVALPVIFISGSIN
FT                   TVVFGRLVHGRIFANSPIRFINTKMGWLTWLAVITAATIVAFIIAEVIPFFNDLLSISS
FT                   ALFISGFTFYFPAMMWFMLLRKGSWKEPKNIILAVVNIMIFLIGMVVLVAGTYSSVDDI
FT                   IIKYDKGEVGGVFSCAAPE"
FT   CDS_pept        join(complement(43916..44233),complement(43368..43848),
FT                   complement(43063..43305),complement(42922..43011),
FT                   complement(42752..42867))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940262"
FT                   /orf_name="Pc22g00210"
FT                   /product="Pc22g00210 protein"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAP97309.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001831F26"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP80"
FT                   /transl_table=1
FT                   /translation="MASQTITRNVATQSWFDQARFIQPDAIFALTAQYLADTSPKKVNL
FT                   GQGTYRDEHGNPWVLPSVRKSRKLLSELDHEYLPILGLADFRKEAAKLALGPDLFQKQQ
FT                   DKLATCQSLSGTGALHLAGLLLRACKTPLPKVYIPEPTWSNHHQVFSSLGFQCESFRYY
FT                   NAKTRDLDIDSYYSALKLAEPNSVFIIHACAHNPTGCDPSKEQWRELARLFKERQLFPL
FT                   FDAAYLGFNSGNVDSDAFAIRLFIEETNLEAGVCLSFAKNMGLYGERVGCFLLATSTEQ
FT                   AAVKTQSMLEMLQRSEVSNPPAYGAKVARTILADATLREAWQDDLVTMSSRIRSMRSEL
FT                   YESLVSSGALGSWEHLIRQSGMFGFLGLSPSVVLRLREQYHIYMADNSRISIAGLNNQN
FT                   VDYVGKSIAECLKQEC"
FT   CDS_pept        join(44625..44630,44698..45738)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173607" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822535"
FT                   /orf_name="Pc22g00220"
FT                   /product="Pc22g00220 protein"
FT                   /function="lyase activity"
FT                   /protein_id="CAP97310.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001831F27"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP81"
FT                   /transl_table=1
FT                   /translation="MADWCNTVFPTYTSTTSTSSMGSHTVSPQPHVPSSGVWCPAVTFF
FT                   HHDTDSLDLVSQSKYFAYLSKTGLAGLVILGTNSEAFLLTREERSQLISTARAAVGPDF
FT                   PLMAGVGAHSTKQTLELAQDAAAAGANYLLVLPPAYFGKATNMNVVKRFFSEVAAKSPL
FT                   PVVIYNFPGVCNGVDMDSETIAAIARESASAHASGRSNVVGVKLTCGSVGKITRLAASF
FT                   APEDFATFGGQSDFLIGGLAAGSAGCIAAFANVFPKVTARIYALYQRGQIEEAVELQRK
FT                   AALAESAIKSGIASTKHAVACYSAQLAGIQDAAGNLAPRHPYEEVGEGAKTMIRQVMAE
FT                   VAEIEKSL"
FT   CDS_pept        46682..48478
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940263"
FT                   /orf_name="Pc22g00230"
FT                   /product="Pc22g00230 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP97311.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831F28"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP82"
FT                   /transl_table=1
FT                   /translation="MEVSETATSLQLPNSIPFWRLVLKPGAITQEVADHHYVGSGTEQD
FT                   PYVVDWMPKDFRNPLQLKTSMKWFITVVAALETLVVALVSSAYTGGIVQIQERFGATTE
FT                   VATLGVSLYVLGFALGPLIWAPMSEIFGRQLVFVTTYCGLTIFCAACTGAENIETLLVF
FT                   RFLSGAFGSSPLTNSGGVIADMFMARERGLALSAFALAPFLGPVIGPIAGGFLGMSSGG
FT                   WKWVMGLLGILCAVMWFLGAALKPETYAPVLLRQRANTLSKLTGQVYCSKLDIDQGRLT
FT                   LKAALKISLSRPMILLFQEPIVLLLSIYLAIIYGTLYMLFGAFPIVYQIHRGWNQGVGG
FT                   LAFIGVMIGMIGAVAYSIPENQRYAKLLKKNGGYAPPEARLPPCMLASIALPIGLFWFA
FT                   WTNSPSVHWLVSVASGVPFGFGMLLVFLSVFNYLIDAYTIFAASVLAANTLLRSLFGFA
FT                   FPLFTKYMYQDLGIHWASCVPAFLALACVPFPFLLYKYGLSIRKHCKYSAQSEAFVQNL
FT                   VRGLQEPIESAEIGPEMSQTLSAIDEVTSLSHNKEAPADVRSIHHTLSRTSTNATHAMH
FT                   RVPTYEANPYNVDRVHTRESFK"
FT   CDS_pept        join(complement(50284..50347),complement(49908..50227),
FT                   complement(49075..49779))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179549" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940264"
FT                   /orf_name="Pc22g00240"
FT                   /product="Pc22g00240 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97312.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831F29"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP83"
FT                   /transl_table=1
FT                   /translation="MSQYIPSIPTDCLAKKVVLITGGANGIGSSLVTQCLERGANVCIG
FT                   DLDNIAGDRLLKKCCDQFHPEEEDMPPRAIFQTTDVTNYSAVLALFDLAFKTYKRIDHV
FT                   VSAASIVEIGNWFDTSLTLETVRQTPTHKVMDVNLLGSMYVTRIASVYLRHNRGSNCDR
FT                   SILLFSCASGFKDSPSLFVYQASKHGVTGLMRSLRTYISSPYKHYLRINTVCPWVTQTD
FT                   SIKKVEAQWKQAELPINSPEQVATVATGVLADRSLNGTSMFIEGGRAWEIEQNIDRLES
FT                   EWLGEAPSKVLALGQELLDDGSIWTAPERRRKKSTISVGVPPGVPLDKINGIANGVTNG
FT                   MSNGMSNGLTNGVTNGLANGVH"
FT   CDS_pept        join(complement(54417..54518),complement(53895..54345),
FT                   complement(53481..53842),complement(52536..53382),
FT                   complement(52296..52479),complement(51598..52240),
FT                   complement(51410..51547))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162144" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940265"
FT                   /orf_name="Pc22g00250"
FT                   /product="Pc22g00250 protein"
FT                   /function="chitin synthase activity"
FT                   /biological_process="chitin biosynthetic process "
FT                   /protein_id="CAP97313.1"
FT                   /db_xref="GO:0004100"
FT                   /db_xref="GO:0006031"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="UniParc:UPI0001831FE2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPE0"
FT                   /transl_table=1
FT                   /translation="MSFPHRGTSPHSPHSGNSSHSPQASEASGYGPREFVQQQAYGYEE
FT                   KPENIDSQQSLLYRNQPSPFNASFDDPYASTDSLRRYTLHDPGVTIFPDGPYQESAGGL
FT                   NRRSGIPSIQSPMSETPSEAWQNRQAPGSGLRRYATRKIKLVQGSVLSVDYPVPSAIQN
FT                   AIQKEYRESEEGFPEEFTHLRYTAATCDPDEFTLRNGYNLRPAMYNRHTELLIAITYYN
FT                   EDKVLTARTLHGVMQNIRDIVNLKKSEFWNKGGPAWQKIVCSLVFDGIDPCDKNTLDLL
FT                   ATIGIYQDGIMKRSVDGRETVAHIFEYTTQLSVTSNQQLVRPQGNESSNLPPVQMIFCL
FT                   KQKNSKKINSHRWLFNGFSRILNPEVVILIDAGTKPGKKSLLALWESFYNDKNLGGSCG
FT                   EIHAMLGKGWKNLMNPLVAAQNFEYKISNILDKPLESAFGYVSVLPGAFSAYRYRAIMG
FT                   RPLEQYFHGDHTLSKQLGKKGIEGMNIFKKNMFLAEDRILCFELVAKAGFKWHLTYVKA
FT                   SKGETDVPEGAAEFISQRRRWLNGSFAASLYAMMHFGRIYKSGHNILRLFFLHIQMTYN
FT                   FMGLVMTWFSLASFWLTTTVIMDLVGTPSQSNYYKGWPFGNEASPIVNNFLKYGYIFFL
FT                   MLQFILALGNRPKGSRLAYTLSFIYFSILQSYIIVLSFYLVKNAFTGGTLDFSMDQGVG
FT                   HFLKSFFSSSGAGIVLIALVSTYGIYFLASFLYMDPWHMFTSSWAYFAGMTCSINILMV
FT                   YAFCNWHDVSWGTKGSDKGDSLPVAETKKDDAKSNFIEEVDKPQADIDSQFESTVKRAL
FT                   EPYVEPEDNDEPSMDDGYKAFRTNLVLIWIFSNLILALCITSEGVKRLCLTNTSTVRTS
FT                   KYFAAILWTTAGLSIFRFIGSLWFLGKSGILCCVSRR"
FT   CDS_pept        join(56336..56735,56786..57300)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000219459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669786"
FT                   /orf_name="Pc22g00260"
FT                   /product="Pc22g00260 protein"
FT                   /protein_id="CAP97314.1"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="UniParc:UPI0001831FE3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPE1"
FT                   /transl_table=1
FT                   /translation="MSPQRPAFDDLPLRKDGPPGNAWGMFGDQDQMGMLNLLTPENTAA
FT                   AAREIVDGVRVSTDWALNSMATPCFGRSAFEHIVKNKAPRVVNDDILIFNTQSSSQWDG
FT                   FRHYGSKQGTYFNGCTQDDIQDSTRNGIHVWVENGGVVGRGVLLDYAGWAAANGKEVKC
FT                   FETQSIPASVLQEVATSQNTTFRPGDILFIRTGWTRAYEQLSRAECQQLADYAAPPVIG
FT                   VESSEAMLRWIWDRELAAVVGDMPSFEAYPCQNQAFFLHEWLLAGWGVPIGELFDLEQL
FT                   SQECRKRNRWTFFFSSVPLKVRV"
FT   CDS_pept        join(57574..57722,58021..58061,58117..58248,58310..58818,
FT                   58867..58991,59055..59121,59349..59733,59800..60308)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669787"
FT                   /orf_name="Pc22g00270"
FT                   /product="Pc22g00270 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97315.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831FE4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPE2"
FT                   /transl_table=1
FT                   /translation="MTQSNIGDCSSSVRCWLREVGPRREVKKRGIRGFPPRSELRCHST
FT                   FHPMFYYRQLQAQAPASREGSHSTPSSEPSISNRYSHEGPPERDDWWYKGTDNLFLNRS
FT                   GEHHFVGASSTTHLAKRLNPGSANLAWDVRPLYDDPSSLRRPVGGSLPQLPPFEFAKRL
FT                   FWVQYAYIGTIFSLIKPLEFEARLDLVYHQPLDFSHRESCLVYCQTLLVISFGLMYSVN
FT                   QWIGEEGPPGFKYFKHALRFLPDIHEEGSILFVEVLCYVAYYMQNLNRRDAAFLYIGLA
FT                   LRMAISLGLHQEVSDPSISEPDRNRRRRAWWSVYSLDRVKSGNPITIHDEDIGITWPTD
FT                   VMATSEIYRKKPGSGSNLIASVQSITNDLSAWLRQVPDRLRIDFTTLDTHINRESVSIN
FT                   LHFYSCVNMTARPLVFYVIQRRLDAEALGSTTEDWKEGLAPNTVAVIDSCITAARATTM
FT                   IMDAAAKHNLVATYGYLDGEYIFSAALLLVMVNAAFPPNETSAWAMETALNLLRGMADR
FT                   GNTYLDSRHSLLLELWAAIGPRRAEEKDTDAASSLAAGQNGPVTPMSENAANPSEDVPD
FT                   PSAESAASQVPTYNWPQQPDIPSFRDIAFQFDLNDDPALWEGALDQIDIDMDTDWIENT
FT                   LKR"
FT   CDS_pept        61094..61603
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(61889..64399,64451..65770)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000047200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940266"
FT                   /orf_name="Pc22g00290"
FT                   /product="Pc22g00290 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP97317.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniParc:UPI0001831FE5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPE3"
FT                   /transl_table=1
FT                   /translation="MSDSGKITISIDRGGTFTDVHAIQPGRPDIILKLLSVDPSHYQDA
FT                   PTEGIRQILELVTGEPHPRGQPLKLDRIGCLRMGTTVATNALLERKGARSVLFTTKGFR
FT                   DLLKIGDQSRPAIFDLSMARPGVLPESVVEVNERVLSCHPSADSDCFSECRMVEGITGE
FT                   KFRVVQELDLVQVKAELQRLKEQGILSISVALLHSYAYPEHERQIGELAQEMGFSVTLS
FT                   SKLQPMIKIVPRGMSAAADAYLTPVIKTYIDSISSSFEGGLESQQDCRFEFMQSDGGLV
FT                   DFRKFSGLKAILSGPAAGVVGFAATSWDPSEKTPVIGFDMGGTSTDVSRFDGHLEHVFA
FT                   SKVAGVMIQSPQLDINTVAAGGGSILTWRNGLFYVGPESASAHPGPACYRKGGPLTVTD
FT                   ANLFLGRLLPEYFPKIFGPHENEALDTETTARLFNELTQKINIERKQQGQSEFSPEEVA
FT                   LGFLNVADESMSRPIRNLTEARGFETASHHLACFGGAGGQHACSVAKTLGITRIIIHKY
FT                   SSVLSAYGLALAEVVKESQEPVSSTYLSSQPALLQHLDHLSASATKDMESQGFPSTQVR
FT                   HEQYLNMRYEGSDTSLMIRKPESSGDFLEEFRIRHRREFNFNSDRPVLVDDVRVRTIAS
FT                   SKVRTEQSPLVQLKEANMRDVATAPNNTTSAYFGQASRVDTPVYLLGELERNSRIHGPA
FT                   VIIDQTQTIVVAPNAVANLLDTCIVIDLNNEPTSSGSALPSEIDPIRLTIFGHRFMSIA
FT                   EQMGRTLQKTSVSTNIKERLDFSCALFSPDGGLVANAPHVPVHLGSMQFAVRYQHEKWL
FT                   GNLKDGDVLVANHPSCGGTHLPDITVITPVFDRPGGSEIMFYVASRGHHADIGGILPGS
FT                   MPPKSTELWQEGAAIEGDKIVSDGILDEARLIELLVTKPSQYPGCAGARCLSDNLSDLK
FT                   AQIAANTRGINLIQTLFNEYGTQTVQRYMYAIQATAESAVRSLLKELYQKFNGQPLESV
FT                   DYMDDGTPIRLKVTIDGTNGSAVFDFEGTGPEVYGSWNAPIAITHSAIIYCLRCMINAD
FT                   VPLNQGCLAPIDIRVPSSSILSPSKTAAVVGGNVVTSQRITDVVFKAFQACAASQGCCN
FT                   NLTFGTDAKLDPTTGAVITPGFGYYETIAGGSGAGPTWKGESGIHVHMTNTRITDPEIL
FT                   EKRYPTMLRQFTLRGGSGGQGKNPGGEGVIRDIEFLSPIQCSILSERRVHRPYGLEGGQ
FT                   DAQTGFNLWITRDPDTGNERRVNIGGKNTVSMKTHDRVVINTPGGGGWGAV"
FT   CDS_pept        join(complement(66068..67115),complement(65883..66019))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217463" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126797"
FT                   /orf_name="Pc22g00300"
FT                   /product="Pc22g00300 protein"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97318.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001831FE6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPE4"
FT                   /transl_table=1
FT                   /translation="MANNIPHPSLCVTTTDFEKVAKNVLPEKSWVYASSSAATGLSMTT
FT                   NLDDWSLINFRPRILRSVDSMDTRRNILGHTSQFPFFVSAMGTLGSSHPGAEPLLVRGA
FT                   TRKGLHTMISTASTKPLEEIMDAHLDEQRLLGNKSPSNLSFQLYVPVDRTRAKSLIRRV
FT                   KTAGYQSLWVTVDTSTLGKRTADRYLQARENLDAGVAENARDIHSENDFAPAFGGRQVP
FT                   GSVDGGLTWEDLDWISSEWGGPMVLKGIQSVEDVKLAVQHGVQGILLSNHGGRQIHSAP
FT                   SSLMTLLEIRTYYPEAFDKLQVFVDGGLRDGADVLKALCLGATAVGVGRPYYYALAAYG
FT                   AEGVERCTDIITEELEITMKMLGVSSLDQLGPDMVNTSRLANEMWRPAFGNSKL"
FT   CDS_pept        join(69084..69116,69427..71214)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822536"
FT                   /orf_name="Pc22g00310"
FT                   /product="Pc22g00310 protein"
FT                   /protein_id="CAP97319.1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI0001831FE7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPE5"
FT                   /transl_table=1
FT                   /translation="MGAQPGDEGLLVSNYFHYAASAAHQPSRHGARLDAADKDWHLTSP
FT                   SPFDPPLSYGGWIQSRALGVRIGSLLRARQFTGEDPESPHSHHPTSDKQANPTPASSDL
FT                   LHRYNVIVHTSPYLRCLQTAIGVSAGIHQASGAEASEGASSAPTVPTVSSTPDQRCLLR
FT                   VDAFLGEWLSPDYYDQITPPPGSDRMVASAKGELLRRAEIIPATNGLTRALSGHFPGGW
FT                   RSQSHPTSPDGEDRLHSSTSQRQRANTHDTFQNPIAKHAKKSLGRLETNLPPTLDAYYV
FT                   PPTPSYAVSASDPIPTGYVAHARNACTRIDYQWDSMRTPYWGTGGEFGEEWSTMHERVH
FT                   DGFQHMINWYREQDLSEPGSTAESNEVSDCNAQTVLVIITHGADCNALISSLNGHSVLV
FT                   DINTASLTMAVRRNRVNKPAHDMGHTPKSPGPDNQSVSREYSLQLVASTDHLRPGINPS
FT                   QLSSLSSPSVPVLSPPPVPSYRNRLGARPSLLQETSTNGPHSTSSGPWTLAMRPSTGST
FT                   TSQGASGLWNSISSPTDKADDNLVPNFGDRPVSQDSELSDRSDKSSDLAWTKQLPQRTL
FT                   SQRGLWGSAQPLGDREGGTKRRWTVTEQKL"
FT   CDS_pept        join(71518..71621,71696..71906,71963..72156,72237..73728)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000247215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940267"
FT                   /orf_name="Pc22g00320"
FT                   /product="Pc22g00320 protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="nucleotide catabolic process "
FT                   /protein_id="CAP97320.1"
FT                   /db_xref="GO:0009166"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="UniParc:UPI0001831FE8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPE6"
FT                   /transl_table=1
FT                   /translation="MSNIETDGLSVTYSSDRTGSPDLRLIHYNDVYHVESGSAEPVGGV
FT                   SRFQSLVNHYRHHPQFAGQPDILTFFSGDAFNPSIESTITKGRHMVPFLNTVGTDVACV
FT                   GNHDLDFGVVQFRHLASQCHFPWLLANVLDPALGEDTPIADSGKSRMLISSNGLKIGVL
FT                   GLGEREWLGTINSLPPDLIYKSASQTARVLAKQLRDEGADLVVAVTHQREPNDFKLANN
FT                   LSPDLVDIILGGHDHFYGHAVVNGIHVMRSGTDFKQLSYIEAFRKRDGLPGWDFNIMRR
FT                   DVVRSIPEDPDTVAMVARLTSSLKAKLDKPIGFTVSPLDGRFSTVRQRESNLGNFVCDL
FT                   MRFYYAADCAMMAGGTIRGDQIYPPGILKLKDLLNCFPFEDPVVLLRVRGHALLAALEN
FT                   GVSQLPALEGRFLQVSNINYGFKLDAPSGSRITFARIGDEPIDLERDYILATRGYMARG
FT                   KDGFASLLIQAEGGDVEELVSEENGVLISTILRQYFLSLKVLGKWNRWSASLGRHWGIV
FT                   HRNLHGEGWLKPASLKNDEKNASDRVNRQPNPRRTARSAYYYGRFPEEVEQVDIITGDE
FT                   ANGNAMDSDSDEDPDILTSSGPITNYVTQPAKSSAEEEHRLQVARRVVRKWMRHAGLQC
FT                   TRLNTMNGEGEFTPAWTSGISPRLEGRIVVE"
FT   CDS_pept        join(complement(75116..75505),complement(73922..75085))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217905" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669788"
FT                   /orf_name="Pc22g00330"
FT                   /product="Pc22g00330 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP97321.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0001831FE9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPE7"
FT                   /transl_table=1
FT                   /translation="MDHTADVQEISARVADFHSRQQPFRIYHGATNSTRPSNRSLSNTV
FT                   STEPLTRILEIDIDRYTAIVEPNVSMGALVAATMVHGLVPLVVVEFPNISVGGGFSGTS
FT                   GESSSFREGFFDHTVNWIEMVLADGQTGSELADNRSDLFWGAASSFGTLGVVTLLEIRL
FT                   KKSQPLVELKYYVNSNMKDAVRAFEEASADPSTEYLDGIVYARNKIVVCAGRQIEQTSN
FT                   VKPQRFTRRQDDWFYLHVERIAQSKISKISDGESSPHMDAVDYIPLTDYLFRYDRGGFW
FT                   VARYAFRYFCVPFTSLTRWLLHRFMHTKVMYHALHVSGLARRYIIQDVGVPISTAAEFL
FT                   DWLDRPDNFGQYPLWLCPLPPGSAGGLEGDPADGKGVNTRLLNFGIWGPAATTDEAGFV
FT                   AQNRQLEHKVHSLGGKKWLYAHTYYTEDEFWSIYNKPGYDSLRARYHAQHLPSLYEKVR
FT                   VRGSDLPGPHRGEFENGWKGSVKRALWDVWPFCGLYGVYKAWRGGDYLLQKEIPKKKAD
FT                   "
FT   CDS_pept        join(complement(77458..77789),complement(77270..77342),
FT                   complement(75764..76948))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216724" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669789"
FT                   /orf_name="Pc22g00340"
FT                   /product="Pc22g00340 protein"
FT                   /protein_id="CAP97322.1"
FT                   /db_xref="UniParc:UPI0001831FEA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPE8"
FT                   /transl_table=1
FT                   /translation="MGQTPVLDQFLGSLQELVQNRDGAKVQDFLQLEPPLSDIYQRMVS
FT                   ELRQYYAPGSKADTELLQRCEPLVPRSKGGSWTAFPTFAKLYLIFLRDMNTDNLLETYN
FT                   QLKALLNQCVLALGDSQMGVVVLPTVLYLSKCGKLRNAEQMFASISAQSPPLAYFPASQ
FT                   RVTYLYYLGRYLFANNLFSPARLALQAAYDQCHRQAISQRRLILSYLIPCNIILGRFPS
FT                   QALLQRPEAQGLAEHFQPLCRLIVRGDYLAFRQHLFLGSPTAQWFARKGILFTLRNRCE
FT                   TLVWRSFARKVFMYGGSYGGPQAQAQKGPPPVLNLKKLVVAIRWLQTQHASSGTGTTST
FT                   MVASNLYGSQVVSEPTDLDYARLEGADGRASPATDREILGKYGDFLAPDGFYTEEGRPQ
FT                   PNLPGQLVDGDPEENYGDYELNPYAYDFDDRIETDASMMQEIESIFASLITQGLMGGYL
FT                   LHREPRFAVPGAKIKGILPTGFPNVWQTISARESHDSSVPGWVQPRAPTIVGAAGGGRV
FT                   VNLAGARPVGLQ"
FT   CDS_pept        join(78796..79083,79135..80377)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940268"
FT                   /orf_name="Pc22g00350"
FT                   /product="Pc22g00350 protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP97323.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI0001831FEB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPE9"
FT                   /transl_table=1
FT                   /translation="TKYSINYITTPSYTKESNRLIKRINLTLFNRVRALLIXSKTPSYL
FT                   XREVLXATTYIYNRSLYKVLGYKIPYKVFYNKRPSIXNIKVXGSLAYYYINKYRTKLSL
FT                   RKEEAIVIGYSNYKHYKLXDYKRLKYLXSRDIIIYKSKFLDRLPRNLNPYKNTSPYKET
FT                   KLISLEKVNIDPISPNKEDKVLTRGENSRRITIDPNYRIEVXIPKLYTIKDTILTNYIS
FT                   LIKSNIDSRFILTTLILLEPNNYXKAINSLEKDEXLKAYYTRVEELEKXGTYNIIDILP
FT                   SINPIKGKXVFKKKPINNLNPDKNYITNSDKTIRYKARXVIXGFHXKLEVDFLETFSTI
FT                   YRTKLXYLILIIAINKGXYVLXYNIKNAFIYTNIDTNIYTILLIGVYKDNLRKCYFLK"
FT   CDS_pept        join(complement(81320..81332),complement(81055..81267),
FT                   complement(80583..80992))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216721" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126798"
FT                   /orf_name="Pc22g00360"
FT                   /product="Pc22g00360 protein"
FT                   /protein_id="CAP97324.1"
FT                   /db_xref="UniParc:UPI0001831FEC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF0"
FT                   /transl_table=1
FT                   /translation="MENPVADIPTVIRSLTQSTPSLQETVLKRYFTNNASFVHPFCRVP
FT                   NFEGSRWWVSKIFQWYKIMSPRIELEIHSIAFDEDKLKLYVNMSQIFSIWLVPFHVAPV
FT                   TLTTVLDLTYDSDKSDTTTNGDHKLYYISKQEDLYQTSEFVKFLMPHIGYWIIFGWHLI
FT                   ATLFCLLGVTLLWPILWLEEQHYIPAHFLRGGNLAYDMGKKIPEIKGQ"
FT   CDS_pept        complement(81861..83000)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216720" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940269"
FT                   /orf_name="Pc22g00370"
FT                   /product="Pc22g00370 protein"
FT                   /protein_id="CAP97325.1"
FT                   /db_xref="InterPro:IPR007146"
FT                   /db_xref="UniParc:UPI00018320AA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF1"
FT                   /transl_table=1
FT                   /translation="MASAQAPARPQSLSTLLETLNTCLSTTASSLPKPHKDVPSDVTIE
FT                   PPQDGISLLDTKSEILLSYLQNLVFLIIFQLRNVSAKQTPKGNSQSTDNSLEDDIRKKL
FT                   IELRVFLERGVRPLEGRLKYQVDKVIKAAEDAERAEKVQPVKTKKSRKAATSGSEASSD
FT                   EDEDASGSEEEEDIDEMAYRPNVSAFSRGVAEQKKAQPSKGAVEGPGDGIYRPPRIMPT
FT                   SLPTTERRERQDRRPIRSNVIDEFVSAEMSSAPMAEPSIGSTIIDGGRTVKSKKDRERE
FT                   AERTTYEETNFVRLPKETKKELAKRGRGKDTTYGGDEWKGLNEGADNIERLTRRSKSNG
FT                   AALEKSRKRVRNEDGQRGDGVGMGQIFDKRRKKVDSWKR"
FT   mat_peptide     complement(81864..82910)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF1 "
FT   sig_peptide     complement(82911..83000)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF1 "
FT   CDS_pept        join(83363..84464,84519..84856,84921..85356,85413..85480)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216679" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940270"
FT                   /orf_name="Pc22g00380"
FT                   /product="Pc22g00380 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97326.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004240"
FT                   /db_xref="UniParc:UPI00018320AB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF2"
FT                   /transl_table=1
FT                   /translation="MRFTDRAFLLSSTLLAIPSLTTAFYLPGVAPTSYDEGQAVPLYVN
FT                   HLTPSLSRDDQLHSVFSFDYYHPAFGFCRPADGPKDVRESLGSILFGDRIRTSPFELHM
FT                   AKNETCKSICAEAKFDARSAKWTNRRIAQGYNINWIVDGLPAAQLNYDGVTKTKFYNPG
FT                   FSLGELDDNGQALLNNHYDIVIDYHKVGFGGKDKYRVVGVLVQPESRKDSRNLEGGAAE
FT                   CGTPGNGLTLNEDGETTVTWTYSVYWKESPTAWATRWDKYLHVYDPKIHWFSLINSAVF
FT                   VVFLVGMVSMILVRALKKDIARYNRLDSFNLEDLDSTSAAIEDGVQEDSGWKLVHGDVF
FT                   RCPKSPLLLSVMVGNGAQLFMMTGVTVAFALLGLLSPSNRGFLATAILLISALFGGIGG
FT                   YVSARVYKTFGGDAWRRNIIMTPLFIPGIVFGTFFTLNLFVWAKGSSGAVPFGTMLALV
FT                   LIWFVISVPLSVAGSWLGFKQSPLEGRTKTNQIPRQVPPMSGSLRTIPSILLTGILPFG
FT                   AIFVELYFIMTSLWTNKIYYMFGFLFLCYGLMIITSAATTVLLVYFLLCAENYRWHWRA
FT                   FMGAGMTGGYVFVNALIFWATRVSFGGLTGAVLYVGYSALIAFIVFILTGSIGFFASWA
FT                   FIHRIYGSIKVD"
FT   sig_peptide     83363..83431
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF2 "
FT   mat_peptide     join(83432..84464,84519..84856,84921..85356,85413..85477)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF2 "
FT   CDS_pept        join(86018..86028,86223..86308,86389..86684,86739..86918)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233019" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975753"
FT                   /orf_name="Pc22g00390"
FT                   /product="Pc22g00390 protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAP97327.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR001125"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00018320AC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF3"
FT                   /transl_table=1
FT                   /translation="MGKSQSKLSPTQLDELQRATHFDKKELQQWYKGFLKDCPSGTLTK
FT                   EEFQKIYRQFFPFGDPSSFANYVFRVFDSDNSGMIDFKEFICALSVTSRGKMEDKLDWA
FT                   FQLYDIDGDGKITYDEMLAIVEAIYKMVGSMVKLPEDEDTPEKRVRKIFRMMDKDENGS
FT                   LDIEEFKEGSKRDETIVSALSLYDGLV"
FT   CDS_pept        join(complement(90601..90610),complement(90466..90560),
FT                   complement(87986..90411),complement(87695..87923))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216718" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940271"
FT                   /orf_name="Pc22g00400"
FT                   /product="Pc22g00400 protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="CAP97328.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI00018320AD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF4"
FT                   /transl_table=1
FT                   /translation="MNQMVARFRPQNKVELASGGKPIVEFENEESCSINSREGTGAFTF
FT                   DRVFPMDTAQNDIFDFSIRPTVDDILNGYNGTVFAYGQTGAGKSYTMMGSDIDDEIGKG
FT                   IIPRMIEQIFASILTSPSNIEYTVRVSYMEIYMERIRDLLVPQNDNLPVHEEKARGVYV
FT                   KGLLEVYVSSVQEVYEVMRRGGAARAVSATNMNQESSRSHSIFVITVTQKNVETGSAKS
FT                   GQLFLVDLAGSEKVGKTGASGQTLEEAKKINKSLSALGMVINALTDGKSTHIPYRDSKL
FT                   TRILQESLGGNSRTTLIINCSPSSYNDAETISTLRFGVRAKAIKNKAKVNAELSSSEMK
FT                   LLLRKAQSQMTNFESYISALEGEISMWRSGDSVPKDQWTPARGSEIVSAAKTEARAPRP
FT                   GTPSRLQETARSETPRPDSRVGDRSSTPSLVLEKDEREEFLRRENEFQDQLSEKESHIV
FT                   NVERSLREARDELRSMKENGARTGKDNERLGTEVNELRMQLEKVSYESKEATITMDGLR
FT                   EANSELTGELDEVKQQLLDVRMRAKETTAALDEKEKKKSEKMAKMMAGFDLGGDVFSDN
FT                   ERKLQDLIQRVDALHQISSEGEVIAPDDILDLRTNLLEAQGFIRQAELTVNDRSDFGEL
FT                   QDSRRADLEKRLDDLQREYEGLLTRNLGEGDVEEIRGRLEQVYVTKKEADTAAAEDLRS
FT                   DILRKDEELTKLRQSLVDTQSRTSTNGAASKTLQQQITEFDAMKKSLMRDLQNRCERVV
FT                   ELEISLDDAREQYNNVLRSSNNRAQQKKMAFLERNLEQLTHVQRQLVEQNSSLKKEVAI
FT                   AERKLIARNERIASLEALLQESQEKLTQANHRFEAQLTAVKERLEAAKQGSTRGLPSMD
FT                   GNASFSFGGSRIAKPLRGGGDGPANANVAGIQSQEATGKRSSWFFDRR"
FT   CDS_pept        join(complement(92252..92293),complement(92013..92077),
FT                   complement(91723..91947),complement(91536..91662))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975754"
FT                   /orf_name="Pc22g00410"
FT                   /product="Pc22g00410 protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAP97329.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00018320AE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF5"
FT                   /transl_table=1
FT                   /translation="MSTSARRRLMRDFKRMQTDPPAGVSASPVADNVMTWNAVIIGPAD
FT                   TPFEDGTFRLVMNFEEQYPNKPPGVKFISQMFHPNVYGTGELCLDILQNRWSPTYDVAA
FT                   ILTSIQSLLNDPNTSSPANVEASNLYKDNRKEYTKRVRETVEKSWEDN"
FT   CDS_pept        join(92802..92948,93006..93950,93999..94199)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000012238" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940272"
FT                   /orf_name="Pc22g00420"
FT                   /product="Pc22g00420 protein"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /protein_id="CAP97330.1"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniParc:UPI00018320AF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF6"
FT                   /transl_table=1
FT                   /translation="MISPGLSARLPKRAFPAFRAQRQFSSARPTCKEIQEAYILSASRT
FT                   PTAKFNGSFASVSAPELGAVAIKSALDKSKVPVEKITDVYMGNVLQGSVGQAPARQASI
FT                   FAGLPSTIEATTINKVCASGLKAVALAAQNIQLGLAEAQVAGGMENMTRVPYYMARASQ
FT                   LPPFGEIKLEDGLIKDGLWDVYNKFHMGICAEHTAKNYDISREDQDLYAIQSYERAQEA
FT                   WKESKFADEIAAVTVKGKKGDTIVERDEGFENLRADKLKTLKPAFLRDGTGTVTAGNAS
FT                   TMNDGASALILGSKDLAREYGVGSRVLARIVSTADAAIDPVDFPVAPAKAVPIALERAG
FT                   ITKDQVAVWEFNEAFAAVIKANEKILGLQNAQVNMLGGAISLGHALGSSGSRILVTLLH
FT                   QLQPGEYGVAAICNGGGAATAMVVQRLDRVD"
FT   CDS_pept        join(94800..94907,94958..95875,95937..96126,96229..96924,
FT                   96984..97180)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216717" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822537"
FT                   /orf_name="Pc22g00430"
FT                   /product="Pc22g00430 protein"
FT                   /protein_id="CAP97331.1"
FT                   /db_xref="UniParc:UPI00018320B0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF7"
FT                   /transl_table=1
FT                   /translation="MLNPVALSLSPSCHDAISWSTDGELAIAAGEYFQILTPKKGRDEE
FT                   SAPNSTQDWLMTRVRANLFTNSEWPTYLPGNRDEFSVAADLSESNVVGLAWSPAGLGKY
FT                   RRSVLAVLTSNLVLSLWEPIGLKKQWTRVAVANHVFWSQLQPSQDPNSHGFRKVNIRSF
FT                   TWCESLKPSTPSAGSSFPHSHESRWGIPLLTVVNDFNEVMLVRVRRSDPTNSPSKPYDL
FT                   QILARHSLKNPETEESPLCSGSLFGKEIKDRQRTTALSCGPWQISPATRPGNFGCAVAM
FT                   IAAVCGTQLRLMKLEVSLESSLGETSQQYTLVTDLIEHPLDQLNEEWAYHNIAGPLRWL
FT                   HTRSSTTIALVAGAMAGFIAISMPHATYTGSVTNSDAFGFRDYPVHEPETEDNKAHQAR
FT                   HLEPISGTLGGIGLVAELHQLPSDGALQQPQWKRMIEEFQDDYDLEHDLGGMSVSRIWG
FT                   LAAYRNMTAAIFTSHPTDMIEYRITSDDRSMIVFSQEGEPTRDTQTLFDARMPDGQPSD
FT                   LIQTGEVIRFVLPGEDGNIEPDTESQRLIYAVACRAIVGEEDKSLRLQARRSLERLAVV
FT                   AGADLRDEISKCDGHPAPISARSIDQVTGPGGHIYEKCEVCDAGIGWPSAQLAQCANGH
FT                   IWERCGLSFLAIQEPGVSKYCSVCRKEALDEELVACMREGKQGRAFDALFETFDICLHC
FT                   AAKFQASY"
FT   CDS_pept        join(complement(98613..98859),complement(98353..98549),
FT                   complement(97338..98282))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216716" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126799"
FT                   /orf_name="Pc22g00440"
FT                   /product="Pc22g00440 protein"
FT                   /protein_id="CAP97332.1"
FT                   /db_xref="UniParc:UPI00018320B1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF8"
FT                   /transl_table=1
FT                   /translation="MIETLISIVFCLSSALTVLILLLPSQYQPAQAGSPSRPHAAKRHK
FT                   TCVQILVLGDIGRSPRMQYHALSIAKHGGEVVIIGYNESDPHPDIISHPSISIVPLRSH
FT                   PALLQTSNKLLFTIYGPLKVLFQIVCLWKCLAYTTKPSRWLLVQNPPSIPTLAIASLVC
FT                   FLRQTRLIIDWHNFGYSILALKLGQTHPLVKMSMWYEKVFCKSASAHFCVTNAMASVLK
FT                   KDFNLPVPVLPLHDRPASHFNPILDPNARTDFLTTLPETKEFHSALKAGSLRVLVSSTS
FT                   WTADEDFSVLIDALLRYSELATTVQPHLPEVLAIITGKGPQKEMYLGQIAALEKASKLQ
FT                   KVTIRTAWLSVPEYARLLASASLGVSLHTSSSGVDLPMKVVDMFGAGLPVVGWDRFEAW
FT                   PELVTEGVNGLGFGSSKELAGHLVELFGKSDKLESLRLGAQKESSRRWDDEWNPIAGSL
FT                   IGLT"
FT   mat_peptide     join(complement(98613..98763),complement(98353..98549),
FT                   complement(97341..98282))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF8 "
FT   sig_peptide     complement(98764..98859)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF8 "
FT   CDS_pept        join(99311..99717,99768..100916,100972..101190,
FT                   101240..102083)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216715" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940273"
FT                   /orf_name="Pc22g00450"
FT                   /product="Pc22g00450 protein"
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP97333.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI00018320B2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPF9"
FT                   /transl_table=1
FT                   /translation="MSTGAPSPSVDLTQSSNGHNHNHGHSRSRGHRSNRWAQPPPPLSQ
FT                   PADASLPEHPEPINAVNSSYSYGHTSQTSSHSHHTHSHSHSHSSTHHGHNHSVSSLHND
FT                   VLDDHHLKDFTGVYGMLSTDTTIQADYSSEKIHEILTSTLIVLPWVVFSWYQRQDVQSP
FT                   KLSGEGIPGTTASIPIGQVGQKTCLLTAITLTLFGFGQIIRTNHQKAGSFTLASVNLPK
FT                   LNVKSVQASFSQITSVALPIFAALQLGGFLVAFALLLAAASGVPSIINKASRTQEKYSR
FT                   KILSVALLVTVIVSSFLGLNHPWDVSPVIGYAALLGSVFVAPPPFPSLRHNGPIPEPGL
FT                   VAAQSKASRPVYSSAVVTTDAPLAVVSGCSLALLTILFNRGFAFSVSELVYLLIPTGIL
FT                   ATSLMISLPSSLRSPKKTGLAICAGAAAFLCSPHAQDDLLMVYATRGILATASFFASRR
FT                   DDMHLHLDAHVHNHTHSHSRSHTTSESSQVSKWLLHKSEPYPLLYSILKEKDSRSIFYF
FT                   MCLNFTFMLVQLSYGFLTGSLGLLSDSIHMFFDCLALVVGLCAAVMSKWPPNARFPYGY
FT                   GKVDTLSGFANGIFLMIISVEIIYEAVERLSSGSEMHRLGELLIVSIAGLAVNLVGIFS
FT                   FEHGHAHHGHDHGHDHSHGNENMHGIFLHILADTLGSVAVVISTILVHYSGWAGYDPLA
FT                   SCFIAILIFASAVPLVSSTAKTLLLTMPADTEYNLRETLAGVSTLRGVVSYTVPKFWLD
FT                   DTGAVSSGHSHSHGEHHHGHSHSQHHHGHDHEPHHDHDHDHHDHTHHDHDHDHNHEHGH
FT                   EKNSQNIFGVIHVVASRGADLEDVRQRTVDFLREKNMDTLVQVERDGDARCWCSGGNKG
FT                   F"
FT   CDS_pept        102870..104114
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940274"
FT                   /orf_name="Pc22g00460"
FT                   /product="Pc22g00460 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP97334.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018320B3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPG0"
FT                   /transl_table=1
FT                   /translation="MSSTSAKATYADEVVRGGYAKIFEGHTAFLTGATGCLGGCLLYKL
FT                   ALQLPTRKVFALVRGNSQQAIRKLRESMPNHAQAILSTGKVEFVIGDMKTVNFGIETAI
FT                   LRQLQDQVTLVIHAAAKIKLEGPIRDALESNCLPALEMARIASEFRRLKLFIQISTSYV
FT                   NSHLPDGTVLERIYPLGGEEDPEEELASVLTLGTSPHDGKFSSTYTQAKHLMERLLLSR
FT                   FPRLPILLLRPTIFGPAFRHPYSLYGSEDSTPLTKFTRLWFSDRGSTQVWHATEGYKTG
FT                   TNILDEIPVDLVANACLLHAAARTTGIVQVGSQLYHSFTFDDVFRIGLENSTPAAQRDF
FT                   PKIVFTEDRSTPQCFLAELIQVGTRNWLFDCGRSYWLKQVSGPLSMQVCKHEADALNLI
FT                   RTHDVLGPRKEKARI"
FT   CDS_pept        join(complement(105882..109315),complement(105477..105828))
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15940275"
FT                   /gene_name="aa7"
FT                   /orf_name="Pc22g00470"
FT                   /product="ABC transporter sequence aa7 from patent
FT                   WO200132904-A2-Penicillium chrysogenum "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97335.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00018320B4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPG1"
FT                   /transl_table=1
FT                   /translation="MASISEQEILAQQITTPIIKINYLQLFRYATKKDWFIIGVSFLAA
FT                   TIAGAITTMPALLTGLLIGSIQASWSGGPSQDRSNSELTRFTIYFVYLFLGEIVSCYIA
FT                   NIGFIRTGIILSSRIRERYLAALLSQNIAFFDNIGAGEISTRITADANLIRDGISEKVS
FT                   VAVQCSASVVAAFVISFMRDWRLTLILASSLICIALVFAAAGIMLTKYRQQWLGETAES
FT                   GTIVEEVFSSIRTVVGLNAQSELVARYDGSLAKAERFANNARLISGALLGAVFAVIYLA
FT                   IGLGFWMGSRFLVAGTSSYVDVLTIILATVTGIACLGGIVPPLQVFTIATAAGSRLYST
FT                   IDRRPSGTANRFSEGSLDSVLGHIELQNVRHIYPSRPDIVVLDNLSLDIEPGKTTAIVG
FT                   PSGSGKSTIIELLERFYDPVSGDILLDGHKLSELSPNWLRQQISLVQQSPTLFATTIFE
FT                   NIRYGLVGTPDENASRENIENIVYGATRLANAHDFITKLPDGYDTLVGEAGVLLSGGQK
FT                   QRIAIARALISDPRILLLDEATSALDSMSESIVQAAIEKASQGRTTIVVAHRLSTVKSA
FT                   DKIIVLSGGQLIEQGNHDFLQRLNGVYSRLAKSQAVNLSEKKPPDDDDSLGVPIPHAKS
FT                   VSVESEKEAPPLVGSGGPLFDTVRKGADALASLDRPPHQYSMQTLLRFVNSFHKDSIKL
FT                   VSMGFLASIQTGAGAPVQAVFLAKCLVALARPPTESPQLRSETNLWAGMHVVLAFVQFF
FT                   AYSAQASALGKCTERLIRRLGDLSFRALLETDMSFFDMEEHGVGALVSFLGTEPASMAG
FT                   MGCYAIGNYIMALTTLIGAIATSMAVGWKLGLVGAATVPVLLMCGFLRFRVMAQLEAHL
FT                   RQVYQETASLASEAVSAIRTVLSLNRESEVARVFHHKLAEQDSKSIRSSLTSSGLFAFS
FT                   QSAPLLCTALGLWYGGTLVISGEYGLFQFILSFAAVNICGDAAGSIFSSSPDLAKAKLS
FT                   ATRLKGLLDRQPQRPLDFVEPATLLQGTIEFRNVHFSYPTRPDRQILKGLDLTVHKGKY
FT                   IALVGPSGCGKSTIVALLERFYHPLAGIVTMDGLDLSSMDMSAYRNQVALVDQEPTLFQ
FT                   GTIRDNLLLGLDASKYSQEELEIICKDANILDFIRSLPLGFNTMCGGKGNNFSGGQKQR
FT                   LAIARALLRRPSVLLLDEVTSALDSESQSVVQAALDQAAKQRTTVAIAHRLSAVRNADL
FT                   ICFLEDGVITESGTHAELIRRRGRYFAMLSLQNLEK"
FT   CDS_pept        join(complement(111229..111297),complement(110072..111154))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940276"
FT                   /orf_name="Pc22g00480"
FT                   /product="Pc22g00480 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97336.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000183217D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPG2"
FT                   /transl_table=1
FT                   /translation="MPPRRAHTKSRQGCDQCKRRRVKCDEKGPPCSNCISRELSCTYFR
FT                   APPRPDSQTSQTPAPLAIIDPSPLRTRIPSLASSVSPTTSGVRDLELMHKFSTETFRSL
FT                   CSSNSEHHVWQIAIPRLALQYDFLMNGILALGALHIAATIEPPASLVYIDVALQYHNLT
FT                   FAPYRAAVDSINPLNCEAALAQSIITTVIGIALPRVTAARGESSSITENIVVVFELLQG
FT                   VRKIHRIGQSWMKLELFRRRNYWDAGSAGLDSDTRVALDRLGTLNDETLAGIDPDQHQV
FT                   NKDAIVYLRHFSTRVADSVDPANVLAWLAMIDKEFVDNVRRRQPLALLVLMHWGVLLGE
FT                   LDGQHWWARGSGRALVSELLDTLHPEDIEWANAVAWPQKKMGL"
FT   CDS_pept        join(112135..112844,112898..112972,113034..113124)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940277"
FT                   /orf_name="Pc22g00490"
FT                   /product="Pc22g00490 protein"
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97337.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI000183217E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPG3"
FT                   /transl_table=1
FT                   /translation="MASYATCSEVGPQCPVELTTYGYYPNFGGNIFFIVFFGLLGICQT
FT                   GLGVYYRTWTFLTALLVGTFMEMAGYIGRVLMHDNPWSGPAFKLQIVCLVLAPTFVAAG
FT                   VYLTLKHIILSLGAEHSILKPRLFTWIFIGCDIGSLVLQAAGGGVAAAAGNTNFELLKA
FT                   GDDIIIAGIAFQVATMTVCGFFAVVFFWRVFKRGDGFSGEKNLDFSPIVPKWMPFVVGA
FT                   EVFAYFTVLIRCIYRIPEMAGGWGNPLMQKENEFLVLDGMMIALACLAFTIFHPGVFLP
FT                   SLRFAPKNRA"
FT   CDS_pept        join(complement(114124..114280),complement(113893..113985),
FT                   complement(113574..113827))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975755"
FT                   /orf_name="Pc22g00500"
FT                   /product="Pc22g00500 protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAP97338.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000183217F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPG4"
FT                   /transl_table=1
FT                   /translation="MATSPAGRMLSRQLQQMQSDKDIPGISCGLVDNNVFEWEVMLMIS
FT                   DDVKLYGGGFFRARLSFPPEYPHRPPKMKFESPIFHPNIYENGDVCISILHPPEEDKYG
FT                   YESASERWSPVQTPETILLSVISMLSSPNDESPANVEAARLWREDPAEFKKRVRRCVRL
FT                   TLDD"
FT   CDS_pept        join(complement(115701..115853),complement(114699..115649))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216712" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822538"
FT                   /orf_name="Pc22g00510"
FT                   /product="Pc22g00510 protein"
FT                   /protein_id="CAP97339.1"
FT                   /db_xref="UniParc:UPI0001832180"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPG5"
FT                   /transl_table=1
FT                   /translation="MSVTNALMRRGAELVATHMQSSDKPQQQQPNGGVVALFSITVVLF
FT                   CFAFWAVEYTYGMVVATLAVVEDTNPDIYVRITPSPDPTKPTNDEDPELVAPTPPKPIT
FT                   SKLRTTVKHLRSRAGYWSRFRGMTMFVGYTVVRGFLSSLIPVPTTSYLGQFIVQSILSV
FT                   LLATWQMAWVHIVISEPSPKSAYQRIPSYKTWIKIAPAAALQDILTAAAFFIPMAIAKF
FT                   AGWLDAAGDQDVPPMVAIYRFMGAGVIPALLAFLISMPARVIFVRVAASMLPEEDETIV
FT                   PFDRSFGGKVSPAITGGSGKIGLMDAWTTFDWAARVRFAKVIGKTFAMEVALGIFAALV
FT                   LGAQVFWMFKTAKPVNSDAPGFQMSWE"
FT   CDS_pept        join(complement(117682..117930),complement(117575..117623),
FT                   complement(117479..117495),complement(116741..117403))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940278"
FT                   /orf_name="Pc22g00520"
FT                   /product="Pc22g00520 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97340.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001832181"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPG6"
FT                   /transl_table=1
FT                   /translation="MSTSTTPTQELKDELKVVETKAVNQTIVQLRSLAAGAAGGLCAVI
FT                   VGHPFDLVKVRLQTAEKGIYSGAMDVVRKTVAREGLARGLYAGVSAPLVGVTPMFAVSF
FT                   WGYDVGKTLVNKFSTVPIKNDTPQYSIAQISSAGFFSAIPMTLITAPFERVKVLLQIQG
FT                   QKTLAPGEKPKYSGGMDVVRQLYKEGGVRSVFRGSAMTLARDGPGSAAYFAAYEYIKRS
FT                   LTPKDAEGNVTGELSLSAVVCAGGAAGIAMWIPVFPVDTVKSRLQSAPGKPTMSGVIRS
FT                   VYASGGFKAFFPGFGPALARAVPANAATFLGVELAHKGMKKLFD"
FT   CDS_pept        join(complement(119857..119940),complement(119618..119795),
FT                   complement(119301..119554),complement(118977..119249))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940279"
FT                   /orf_name="Pc22g00530"
FT                   /product="Pc22g00530 protein"
FT                   /protein_id="CAP97341.1"
FT                   /db_xref="InterPro:IPR008427"
FT                   /db_xref="UniParc:UPI0001832182"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPG7"
FT                   /transl_table=1
FT                   /translation="MKSFTPVALALMAASGAMAADPSASECASMCLSNMSNQAADLGCK
FT                   AGDLACLCKSDNYKFGIRDCTKEACPNDDAEKVLAMAVAKCPGGVAGSDADSDSSSSSA
FT                   SGSGAGASTTGSDASATGTDASGSKTATGSDASATGSDASGSKTASGSGASGSVTGSAS
FT                   TTGSVSTVTSTDASGSMVTRTSTGASSTSTGSGSGSESDSESGSESGSGSATESGSGSG
FT                   SDSSASGSASPSASEGAAAPMATVGGGAMGVLGMLAILAL"
FT   mat_peptide     join(complement(119857..119883),complement(119618..119795),
FT                   complement(119301..119554),complement(118980..119249))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPG7 "
FT   sig_peptide     complement(119884..119940)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPG7 "
FT   CDS_pept        join(120202..120309,120448..120814,120900..121033,
FT                   121427..121585)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940280"
FT                   /orf_name="Pc22g00540"
FT                   /product="Putative uncharacterized protein Pc22g00540 "
FT                   /protein_id="CAP97342.1"
FT                   /db_xref="UniParc:UPI0001832183"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPG8"
FT                   /transl_table=1
FT                   /translation="MKVWIALAGPVGTVLLPNVAIGARENPLPDPYEVITISDFGFFHD
FT                   VLHYWSPLPSCRWRTPCGCRGNQGLIGGSWWLMVAHGWFMGAVHGVPKVFRSFSADLNN
FT                   VERSKRVGIDPNRGTGSTSVNLNCRIAGPPDRTIEIWETQLFATVAEQRHTHQLGLFQS
FT                   CVSVSMYRVVKYSVPSADQGLSRRTPGKGLERFEIHNIYYYSVLTGMFPLLSKPASIEA
FT                   PIRADIIPGNLHRFTLPLANSDTAIPNFLCPQG"
FT   sig_peptide     120202..120267
FT                   /db_xref="UniProtKB/TrEMBL:B6HPG8 "
FT   mat_peptide     join(120268..120309,120448..120814,120900..121033,
FT                   121427..121582)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPG8 "
FT   CDS_pept        join(121840..121968,122036..123442)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200322" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669790"
FT                   /orf_name="Pc22g00550"
FT                   /product="Pc22g00550 protein"
FT                   /protein_id="CAP97343.1"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR021860"
FT                   /db_xref="UniParc:UPI0001832184"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPG9"
FT                   /transl_table=1
FT                   /translation="MVLRSSNLPLTLEFDALVQQQMDKWKVPGLSMAVVHGSSTWSKAY
FT                   GFAQFPDRRMTTDSLFSTCSTTKAFTAAAMSLAIDDSRNTESPLRWDTPMASILRDDFV
FT                   LGKDYNTMHTTIEDALSHRSGLSTHDACLSLAHPQRSLREAVRNLRHLPIAYAPRTIFS
FT                   YNNNMYIAVSHALEQIEGRTLGETLKKRIWDPLGMNDTYFSVTGVAEDPSLRPRLVQGY
FT                   TWDADTETYIAEPYMNDAAITGAGAMVSSVLEYTKWLRAIIYQKGPISPQGHIELLKPR
FT                   TVITDWEELVGPPPVPCHLYALGWFVSSYRGKPLYWHSGSFAGFGIMVGFVPSNGFGFA
FT                   MMGNTANARNAQVEVYMHLLDQFTGGPGIPHSVGQATEPENRRMKARSECMEEAIKRLY
FT                   PSLPDPAIPHALQLSQYAGRYEHPAYSSITLSLRNGCLVADLLDRAVPSLITLAHASGE
FT                   FFVAHHYQPRKIGSLSGYYATEFIVGSNGIATAMGMDVEPALNGEKMWFGRKC"
FT   tRNA            complement(123765..123836)
FT                   /gene_name="tRNA-Arg (ACG)"
FT   CDS_pept        join(complement(125003..125128),complement(124087..124953))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126800"
FT                   /orf_name="Pc22g00560"
FT                   /product="Pc22g00560 protein"
FT                   /protein_id="CAP97344.1"
FT                   /db_xref="UniParc:UPI0001832185"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPI7"
FT                   /transl_table=1
FT                   /translation="MLLWTILCLGSAVASSIPNPHRLRLPFVPSSHNLEDGVRSRISIS
FT                   LSIQNGSLYANEHQVYPPSEIMQLHAPLYEFNPSDKTVELSYTLETQTLPTDEMESTAD
FT                   MIRVRVEWFDLQGNLVSPDAVVVDLLAFQNEKYEMTRIRVEPAHGSDQGDHVSQKSQTW
FT                   VMNYWRTRFGSIFDKPKIKSKTTAPARDSAPLTESSAQNRAIRVISSKATTDSGSETRF
FT                   FSFWATPAHLHHHPEHRRPHHNSHHKNSFMRIIRPIILPALLGTAAGLVACLVGFFIGE
FT                   LLMSLGVRLGWQKVLGDRSRIISVEEGTVSEKTPMVPHVYVTDTTQSNV"
FT   mat_peptide     join(complement(125003..125080),complement(124090..124953))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPI7 "
FT   sig_peptide     complement(125081..125128)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPI7 "
FT   CDS_pept        join(complement(128025..128126),complement(127472..127966),
FT                   complement(126342..127418))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822539"
FT                   /orf_name="Pc22g00570"
FT                   /product="Pc22g00570 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP97345.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI0001832186"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPH0"
FT                   /transl_table=1
FT                   /translation="MVTVLLLTLASACLASKLPVVDLGYEIHQAISFNSSHGLYNFSNI
FT                   RYAAPPVGDLRFQAPILPKENREHIQNGSVGKICPQAAPLWSTNVQPAFLLSYFYNQSF
FT                   SQSTNISSYGYKAAEQDPRTTEDCLFLDVVVPKDIFERTKNKTATSRKNLAPVLVWIYG
FT                   GGYVGGDKSSSNPTGLIQRSRLGNNDGIVYVALNYRLGAFGWLGGDSITANGTANAALH
FT                   DQRFALDWVYKNIHLFGGDATRVTVMGESAGAGSILHQITAYGGTRGAAPFKQAILQSP
FT                   GWVPVIGEEQQEDTLQQFLGILNVSTIEQARKLPSDKLIAANAYQVATKSQWGQFTYGP
FT                   VVDGSFVPALPGQLLLRGDFDHNLNIMVGHNANEGLVFTSPDSVNSTGLETQMKTLSPN
FT                   IPANVSDFVLDVLYPPVYNGSYGYTDSVARTALVISDLIFQCNTDYINRAFYNETYAYK
FT                   FSIPPALHGQDVSYTFYNNGSGSSPSGVANVTVALAMQDYFTSFVQHGVPKSPLAPVFR
FT                   EHGQHARLMNIGNHTIQPTRDLTNNPRCRFWQNAPYYKET"
FT   mat_peptide     join(complement(128025..128081),complement(127472..127966),
FT                   complement(126345..127418))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPH0 "
FT   sig_peptide     complement(128082..128126)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPH0 "
FT   CDS_pept        join(complement(129631..129949),complement(129457..129577),
FT                   complement(128977..129432),complement(128610..128922))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000269213" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940281"
FT                   /orf_name="Pc22g00580"
FT                   /product="Pc22g00580 protein"
FT                   /protein_id="CAP97346.1"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="UniParc:UPI0001832187"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPH1"
FT                   /transl_table=1
FT                   /translation="MTESSLSSIQVDLSPNVTIQPPLSRCGHGPGLILIRPLCYATCQQ
FT                   QNKTLDPEPLKKWAEESFIVAQITLDEKSAIDISSLRELLQEAERGLTERLECDTEKVG
FT                   LIVYGSKKDYAPQFEDSLQGALVQGTALIAAVFFDSWNIPFFHPMEGEKKEGEGKTTHI
FT                   YSDVPAPSFMIPGHPDFKISTAGVAHTRSVGFVKKHVGGPFFDLEKIWDEHTYYEFEVR
FT                   SVEKTMATMVSEPYVNHVPTLTGGIGRARLSHFYLNHFIFNNPDDTALELISRTVGTDR
FT                   IVDEFIFVFTHVKEIDWMIPGIPPTGKHVRVPFTSVVNIRGDRLFHEHIAWDQATVLVQ
FT                   LGLLPEYLPFPYALPDGSVPAHGKRFEYRVPAAGTESAAKLQNEHEVPSNQMFEYKIRE
FT                   VDG"
FT   CDS_pept        join(130247..131110,131135..131188)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126801"
FT                   /orf_name="Pc22g00590"
FT                   /product="Pc22g00590 protein"
FT                   /protein_id="CAP97347.1"
FT                   /db_xref="InterPro:IPR019258"
FT                   /db_xref="UniParc:UPI0001832188"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPH2"
FT                   /transl_table=1
FT                   /translation="MNALVQSALTDVESKLNALLTSLTTSPTAAGAPAAAVALLDSDDA
FT                   LTSAIETLRQHQENHAKILRLRNEVQQLEDRVKGIVGDIEGFEKEVRTACGDNGDSDSD
FT                   FDSDSDDDLGGKNSLLRGIKEIDYKLLLDFARRISKYNHEAAADAATGVVKRQEQGKPL
FT                   ADKDVTMTGMNGEQPTDEGAEPVASVTKNATQWLDDSANVTRQVYMLPYPMEERIRMGL
FT                   MGQIQLSVGDDPEKEVERLLRESEGLGAAEPPAAVEPAESTKQADEAARAAAQAGSSAA
FT                   GMPRAHAPKAMLDLDLYDPEEDED"
FT   CDS_pept        join(complement(131583..131596),complement(131465..131551),
FT                   complement(131322..131412))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940282"
FT                   /orf_name="Pc22g00600"
FT                   /product="Pc22g00600 protein"
FT                   /protein_id="CAP97348.1"
FT                   /db_xref="UniParc:UPI0001832189"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPH3"
FT                   /transl_table=1
FT                   /translation="MYMVVTRTVAIESYLHYRCKHQRSAGSLSSSPRRSVVFCTIPFYL
FT                   YGKRFRGWAAKSSVHKMQ"
FT   tRNA            131866..131937
FT                   /gene_name="tRNA-Thr (CGT)"
FT   tRNA            132408..132479
FT                   /gene_name="tRNA-Thr (AGT)"
FT   tRNA            133319..133390
FT                   /gene_name="tRNA-Thr (AGT)"
FT   tRNA            133514..133585
FT                   /gene_name="tRNA-Thr (TGT)"
FT   tRNA            134097..134168
FT                   /gene_name="tRNA-Thr (AGT)"
FT   CDS_pept        join(134947..134983,135032..135575,135630..136788)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201551" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940283"
FT                   /orf_name="Pc22g00610"
FT                   /product="Pc22g00610 protein"
FT                   /protein_id="CAP97349.1"
FT                   /db_xref="UniParc:UPI000183218A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPH4"
FT                   /transl_table=1
FT                   /translation="MSPGFRVPQDPCFCPNCGNLLAIAKADMDRNNPTEVSLFPEGLKV
FT                   ICRTCPYTCSIREIVLEEVDSDSTEENNDHNDIASSQADPHNELSRYTQTVMEEIRQLQ
FT                   GGQIPCFLADKLYPDQAFQFPSRATNPRLNNPPLQLIAKDLLRKVRLHETQCQRYGEFP
FT                   ESNQGIEDALYNALTPTAKEALEKPSIGLAELIDIGGSPERDEGTGIYLHILKAHTLFY
FT                   LYVGQGIVFSERISFHNDPAKRARHPSLHYKIWELLEKMDGFESIFVKLATFDDRPRGP
FT                   AEQLPLNLQEMFLACVLQTLKPSDLEIWLPEDEGAQRPWAGLGLNIALPLWQGYSSEDN
FT                   VPYDQVKMTGTEFSAMLRDSDGLRRQWAIAVRDAYQSLRTHPDSRIQGLWFSDFRKFLE
FT                   ARITDSLPAGYHTHQIRAREGVKALFAGKSLQMWQTQWGYYHAQYCDYAFTLRHIKRFS
FT                   LDQYVAEKSGKKNDHYGKVCGKTVFIRPVLSERPTSLRYARKAVSTDPCVRLMVLADMD
FT                   NGDGTGPLHILSSSGDAAVTKLNRMVDIFEGIGYYQSLALGHVHVPKRPSRQNCSEVDV
FT                   EEH"
FT   CDS_pept        join(137946..138985,139034..139158,139209..139321,
FT                   139381..139510,139561..139826)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126802"
FT                   /orf_name="Pc22g00620"
FT                   /product="Pc22g00620 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP97350.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183218B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPH5"
FT                   /transl_table=1
FT                   /translation="MSHHEDPFSNHDQADGDVEKQDDGDGDIHSHGGASRPSRRKKEGA
FT                   DGVVDGQDREELKEWECYDKLGYSFSWWKKWGILSVIFAVQTSMNFNASFYASSITLYA
FT                   AHFSISEQAARVGQMAFLVSYAFGCEFWAPFSEEFGRWPIMQLSLLFVNIWQLPCALAP
FT                   NFGTIIIGRILGGVSSAGGSVTLGMVADMWEPEGQQYAVAFIVLSSVAGSVIAPVVGGF
FT                   VATFLDWHWNFWIQLILGGFVQILHFFIPETRCGILVTREARRRRKNGSMVWSGDELKK
FT                   TRMSFRWVFMVWIRPFVMFVREPIVLCLSLLSGFSDSLIFTFLQSYTPVYKQWNFTTIT
FT                   TGLAFLPLMVGYFLAYFSFIPWIYRHCKIREKDPDALQPEARLYWLLWTAPLLTIGLFG
FT                   FAWTSLGPPHVHWIAPMIFSTLIAIANYAIYMATIDYMIASYGPYAASATGGNGFARDF
FT                   LAGIAAMYSMPMYMNMGKTHNLEWASTFLGFMAIIFTIPIYIFYWKGPRIRELSPFAQT
FT                   LASDRKKAGRRVSSCGSGDPDPVERYLSERSSSETRTRSG"
FT   CDS_pept        join(complement(142675..142731),complement(142452..142619),
FT                   complement(141865..142397),complement(141330..141809),
FT                   complement(140358..141276))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216699" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126803"
FT                   /orf_name="Pc22g00630"
FT                   /product="Pc22g00630 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97351.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000183218C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPH6"
FT                   /transl_table=1
FT                   /translation="MPGVPSNKACERCKKRHLKCDETRPHCQRCTTAGVECPGYVQTRK
FT                   FIDQGATVRRRYAPYGEPHPKPGSAFSSSKVPTELVSDATQPKGSQVGPNEQVLQWNQG
FT                   QEQVNPAIPFQMGETRLGSRDDPMIVEMSGPSSRSEVAMGSNQQTNAHASESPAISIHN
FT                   SLSGFEEGSVSTRNAMYKSISPATGGFPAFDNTYDTIPHKRPDYQRVISESSSHRSERD
FT                   EFQDIFSELMTGTEHEIAFLTRHYSEVIGPWLDLSDTQKFFTVHAPIRAINNLSVKYAI
FT                   AALAAKHLARLKGVKASIGGMFTSPATTETYPNATQVDWFLKAANYYYLAASDLNNITS
FT                   DGYTTVSSSAILESPFEILCRWVNSGQTQANMKPASEDPNDVTVIRKTEDLLATATLLT
FT                   MYRLLDMPGDEWHMQLSRIRPLFDSLLSLHVAESALFSHGIRAAFWNFARQDYLGSYFT
FT                   RSPTHFDPENLPLWRAAGISINGQKDFHLIRNGSTLSQDDQAANGLIWLVAKVINFLSR
FT                   SKQLQLAQWTGSPAASPEIQGTTNAAQLPYPDTDTWLKLCFEFQTWFENLPETFRSSVR
FT                   IERPKDLSQAAEGSYLPFPEIFHSLTTCAAAMQHYHFGRIALLLNRPADVISAPSTAFD
FT                   RLQGYREVTKEVEFRSRELSGIALGRPQGAVRIYMVPLLVAVGQCLENPEEHQIIVDLL
FT                   RGVEADLGWTTEYAIRKLQDSWNQ"
FT   CDS_pept        join(143040..143202,143254..143981)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940284"
FT                   /orf_name="Pc22g00640"
FT                   /product="Pc22g00640 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP97352.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000183218D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPH7"
FT                   /transl_table=1
FT                   /translation="MLRTPSILVDSQHGTSTPLVRSIEDYDQIRWGSISSTQPVLTGPE
FT                   QIGVYHEWIDAGKPHNIVCWECRLPDSLIGCQTCCRSYHTACLLDVVRSANNFHCPSCR
FT                   ARGWDHAPPQFPVPSPAPSTGGTTPHSHSEPSSGNIPILGDRSPTASGRKSSVAPRMMN
FT                   APTMNCIGEANSRGTPAEVFPVAETYPRLLEYLALPDAEIGRHAQSSQFKHQLGMAMKE
FT                   IESNRASMRDKSNIREDYSRLQRENAQIKEYLDSTHSPRNSAIPSPSTVSHNIISRPAS
FT                   EQRGKAWDSLALDMF"
FT   CDS_pept        join(complement(144558..144752),complement(144423..144469),
FT                   complement(144294..144369),complement(144132..144233))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975756"
FT                   /orf_name="Pc22g00650"
FT                   /product="Putative uncharacterized protein Pc22g00650 "
FT                   /protein_id="CAP97353.1"
FT                   /db_xref="UniParc:UPI000183225B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPH8"
FT                   /transl_table=1
FT                   /translation="MGKPPVASLVSSDFRPNDNMQEQFTSGRNLNARPKWCHIYHIWAR
FT                   NTPLPRSFAPHIGKDQGVKSGSQLLRAAGNIVVKLGGIMPYFIPTIVPPGVDPSVPRAT
FT                   SQGDGDGDMINITIDRSGPLRRNAGFPTCIWNVEK"
FT   CDS_pept        join(144946..145096,145244..145353,145407..146224,
FT                   146278..146961,147017..147596)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000122165" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940285"
FT                   /orf_name="Pc22g00660"
FT                   /product="Pc22g00660 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP97354.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="UniParc:UPI000183225C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPH9"
FT                   /transl_table=1
FT                   /translation="MPPQHPSLRMGLLCSILTALYASNAIATKDYSDDFDVLKYVDPLI
FT                   GTANGGMAKAVADTTGENQAGFAYDTEVVTGFSHMHDSGTGGSPSMGNFPIFAQGNCPH
FT                   DDINQCKWQQSDRAAVWDRESPEARPGYFSISLANGVHAKMTTTNRSALYRFTFNEPSS
FT                   QPLSPVVLLDLMDLPRSRRSGSADVDRSTGRLTGSGTFSPSFGIGSYKSYVCVDFKGAE
FT                   LRDTGIWERNQPDISRRTLNLGSDASSFLSAGAFARFHAPKDNNILVRVGVSFISVHQA
FT                   CSNAEREQPDFDFEGTVSAAESAWRKKLDVISVDADGVSSDLQTVFWSGAYRTFISPQD
FT                   YTGENPLWKSDEPYYDSYYCIWDSFRSIHPLLTLVDPFSQSLMMRSLVDTYRHEGYLPD
FT                   CRMSLCKGFTQGGSNADVVMADAYLKKVPGIDWDTAYEAVVKDAEVEPKNWDVEGRGGL
FT                   RSWKNLGYIPLDDYDPDGQGTHTRSISRTVEYAYNDFCIAEMAQDMGHQADYEKYTKRS
FT                   GNWVHMFNPDQRSSIKGVDTNFTGFLQPRYTNGTWGYQDPVLCSPLLDFTGCYLNPDGH
FT                   ETYEGSAWMYTFYAPHDMGALIKTLGGAESFTSRLSYLHDSGLLYMGDEQAFLPVYQFH
FT                   YSGRPGLSAKQSHFYIPSQFNTTVNGIAGNDDSGAMGSFVVLNMMGLWPVPGQDVYLIT
FT                   PPYFKEVSIRNALTGKVATIRNVNFDPSYESIYIQSAKWNDKPWTKNWITHEFFADGGV
FT                   LELVLGPKESEWGTHIQDLPPSLSDYH"
FT   sig_peptide     144946..145026
FT                   /db_xref="UniProtKB/TrEMBL:B6HPH9 "
FT   mat_peptide     join(145027..145096,145244..145353,145407..146224,
FT                   146278..146961,147017..147593)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPH9 "
FT   CDS_pept        join(complement(148715..148790),complement(148606..148664),
FT                   complement(148179..148553),complement(147930..148127),
FT                   complement(147793..147876))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18975757"
FT                   /orf_name="Pc22g00670"
FT                   /product="Pc22g00670 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97355.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000183225D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPI0"
FT                   /transl_table=1
FT                   /translation="MVLAQPPNQHVMKAFDLTGKVAVVTGGARGIGLEISRALAEAGAN
FT                   VAMVYHTSNTADTIAADIASTNNVRVAAYKANVAIQSEIEAVVQQIAKDFGKLDVMVVN
FT                   SGIASNIAAEDYTSDQWSSIMKVNLDGAFYSAQAAGRIFKAQGRGNVIFTASVSATLVN
FT                   QPQKQAAYNASKAGVVQLAKCLSVEWVDYCRVNCISPGYIATEILDSFPQDWRDKWLDL
FT                   IPAKRMAESYELKGAYVFCASDASSYMTGANLVIDGGYTLP"
FT   CDS_pept        join(complement(152097..152294),complement(151760..152021),
FT                   complement(151094..151706),complement(150210..151044),
FT                   complement(150094..150162))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048447" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126804"
FT                   /orf_name="Pc22g00680"
FT                   /product="Pc22g00680 protein"
FT                   /protein_id="CAP97356.1"
FT                   /db_xref="InterPro:IPR021822"
FT                   /db_xref="UniParc:UPI000183225E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPI1"
FT                   /transl_table=1
FT                   /translation="MHSLFSTIGQTHKRNPSQATSTGAVLESYKTCKAPKLMFWISQVL
FT                   MDFFRRFFSSPRRLAIALFLVIPLIPLYWSILICISPAEQSVDQFPSDYAGQSRISAQV
FT                   INDPYPHYDSVEWKSKSKGSYHPCIGPQGRLLSREDEDMMMSGFRWNASVFPTPIFGSY
FT                   ESWNLNKSLCADRYSRYGAYGYLGGNETTLHNWDGTFGSNEASEIDWEQVDWAHLQYEC
FT                   LQRNSVRYRTQPSEGKIFALYKSLDSDVQPREPLNGTDKMQPRTAVILRSWIGMKYTEN
FT                   DLYHIRSMLMELSLYSGAEYELILLIDSQGKKLPKKDDHAAWKAFNAKHLPQELRSLAV
FT                   WFNAEILKDWYPGIEVHVAILQYFQPTQIFSRLHPQYDYVWQFEMDSRYTGHMYDLLHK
FT                   AAEFAKQQPRKYLWERNSHFYIPAVHGTWEEFMEKVDQEMPGHDNSSVWGPRPAEGIDI
FT                   EGQAIIPPVPRLADEPGSWGVGEEADLITWLPHFNPVGTDWPFRDRVFNFPQDQETPRW
FT                   AAVVAMSRISARLLGLLHKDKVKSGVGLASEMSPISWALYYGLKAVQIPQPVYHDAKWD
FT                   PEELNRRANPGEPGQVNAGFNSIWSWGQHDDIMYNTTFMFNSEFAEKLYRAWLGYDGAK
FT                   EWEKENPRLCLPPIFLHPVKNLE"
FT   CDS_pept        join(complement(155185..155532),complement(154514..155124),
FT                   complement(154094..154450),complement(152684..154025))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216694" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940286"
FT                   /orf_name="Pc22g00690"
FT                   /product="Pc22g00690 protein"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP97357.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI000183225F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPI2"
FT                   /transl_table=1
FT                   /translation="MEVSEPASPSVRHAPNHDSMVTVALSDNQSSSEHTQPDWRTLDIP
FT                   PTPVEMSHLEKESEESFGQVPLQDAARTTPTPETPDADRERPTGEMFDNELDWENLDKT
FT                   EEQEPRGEGSDESTALLLARLEQENNALATNPKSRIPEAPNGKIHQRQSRSESLHHIKR
FT                   LIRDPARAELRYSQLPPPPMTELEFWAALVDDYHQTAQRLPTLTSNKIQGGVPPPLRGV
FT                   VWPSLAGARDPTLLNEFQRLSGETSPYDGLIGKDIGRSFPNVEMFRDPNGEGQQMLGRV
FT                   LRCFSLYDTKIGYCQGLGFVVGPLLMHMTDAEAFCVLVRLMDHYNLRTCYLPDLSGLHL
FT                   HVYQFQNLLARHRPVLFQHLEALHVEPVYVSQWFLSFFAVACPLPMLLRIYDVIFLEGA
FT                   CETLMRVALSLMQRNEKRILACTEFEDVMQLLLSRSLWDTYAFNADDLVNDFVSLTSLV
FT                   TNESLQTLEASYNQSKGSPSGPSFPQMQATASGFLGRLWAGSSNSHNSVKSLNPNTSPS
FT                   RQNSTIRRSTSKQSLTSTLNSVETTSDASTAATELSTAAASVDSQRSRVKSNMSSHHKD
FT                   RDLHTQIEELLMALSDLQRQQANLTRELQQEREEREEDHVLAKELLNQIREQPTETQPV
FT                   ELIAKAQTRFESVNPKRISITQTKLQLNDDVTRWKEMHEVEVGRCLNLTRRIDDFEQEN
FT                   SSLKEQLREARGRIQDGYRERQRLERMNRELRTLKTPISETPLDTSSTADSSESQSPTS
FT                   GLREFKLARTNSTKSPTYNRRTSSLGLQSVLSTEGNKPAEEALLMELVTAKTAEAVARQ
FT                   ELEEVKGKLDSFRKMIKSSQANPENRHSFVGLSQSRISLANKSPIEAPKTGGTPPSNGG
FT                   GGFFSGWGRRTATD"
FT   CDS_pept        join(157681..157758,157827..158156,158227..162609,
FT                   162709..163095)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940287"
FT                   /gene_name="top2"
FT                   /orf_name="Pc22g00700"
FT                   /product="DNA topoisomerase II top2-Penicillium chrysogenum"
FT                   /function="ATP binding"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="DNA topological change"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="chromosome"
FT                   /protein_id="CAP97358.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="UniParc:UPI0001832260"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPI3"
FT                   /transl_table=1
FT                   /translation="MDDSMMEDSVFEDDGGSSDFAPEPAPKPKAKAAPKKAAAKPAAKK
FT                   TTQTTLKTKPAAKAAATKKKAKADSEDEMSDIQMSDDDSLLSRTPPKAKKTAAPKRAGS
FT                   KPLADVENESHGGDAAADSASKSGDASEKYQKLTQLEHIIKRPDTYIGSTERTTQQMWV
FT                   YNSGTELMEFRDVSFVPGLYKIFDEIVVNAADNKHNDSSMNEIRITIDREAGEISVWNN
FT                   GRGIPIEIHSKEKIYVPELIFGHLLTSSNYDDSQQKVTGGRNGFGAKLCNVFSTEFTLE
FT                   TQDSRQKKKYKQTWTENMTKMGKAKITDAKGDDYTKVTFKPDFAKFGMEGIDDDFESLV
FT                   KRRVYDLAGTAGVAVKLNNTRVPIRSFRKYMEMYTKAIRKERGDDGPPTKDEIITCSPD
FT                   PRWEIGFAVSDGSFQQVSFVNSIATTSGGTHVNYIADQICTRLADQVKKKNKSGATLKS
FT                   AQIRNHIFIFVKALIVNPAFTSQTKEQLTTKASQFGSKCPLDEDFYKKVLKTEVMSNIL
FT                   HFAEQKADQILKKGDTGRRTRMNNPKLVDANKAGTREGHHCTLILTEGESAKGLAMAGR
FT                   AVVGPDLFGVFPLRGKLLNVRDASFDQISKNVEIQSIKNFIGLQHKKEYTDTKGLRYGH
FT                   LMIMTDQDHDGSHIKGLLINFLQAQFPSLLKIPEFLIEFITPIIKVWKGDPKNPTKQKS
FT                   FFTMPEHDEWREAHQHERGWEHKYYKGLGTSTTEDAQVYFRDLDRHLKEFHTMQDGEAG
FT                   LIELAFSKKKADERKEWLRQFKPGTFLDHSVAKITYTDFINKELILFSMADNQRSIPSV
FT                   VDGLKPGQRKVLHTCFRRNLKKDMKVVELAGHVSGMTAYHHGDVSLQQTIVGLAQTFVG
FT                   SNNINCLEPSGNFGSRLQGGGDCASARYIYTRLSPFARKVFHSADEPLLTYNEDDGKKI
FT                   EPEVFMPVVPMILINGADGIGTGWSSSIPNYNPEDVVNNLKRLMAGEPTEPMQPWFRGF
FT                   TGEVVAVGGDRFKFSGIIRECGEKEVEITELPIRTWTQDFKDKLEEIIKAEKVPSFIKD
FT                   YRDYNTHTKVHFIIQLDEKHMKVALTEGLEEKFKLTKTIATTNLVAFDPEGRITKYATV
FT                   DDILKEFFVVRLKYYERRKQFQLADLQRDLEKLSNQARFVQMIIDGKLVISKKKKPVLI
FT                   AELKDKGFKPISKVAEAPKMGEDEPVVEEEGEEESDDNDTQKLSSSFDYLLSMPMWSLT
FT                   QERVEKLRRQIGDKETEVDVLIKLSKEDIWTRDLDEFIQEWRFQLEDEDRRARKVAGLG
FT                   RRVSAKLATGGGRAAASRKRKAANGDDPDDEDFGAPKTKKAAAAKKKEQPKNSLMNFLS
FT                   KPPSKPSPSAAADGSDDEFDMDMEVLPKKSRAASKPKTMPKEEDDFIDIDDVPQTSRAS
FT                   AQPADDPMGVDVDEAPKPKPATKAATKPAAKRGAKAKAKVEEDSDDDFLEIANEAPKPA
FT                   VQSSRARKPVKYSAPSDSDSDNGDDLLGDVSMMVKGIGGDSGADSRQLFSERPRSESSA
FT                   SVKTAAKSSKVNDDFDPDETDYSKLIPQNSPRRSIQVKAKDVKLDDKDEDEEDQPVKPT
FT                   ARAKAGSKAKAAPKAAAKAAAATSAAKGRGRPKKEPAPKPAPKSAPPSLSPAAKGYASK
FT                   HGKTSKKIADDYSEDDIDAMANDILDSPAGKVNADISEDDEPAPAPRRAAASRPARGAA
FT                   QQKKSYVIEDVSEEESADDFDEDEDESD"
FT   CDS_pept        join(complement(165172..165472),complement(164991..165119),
FT                   complement(164866..164940),complement(164510..164793),
FT                   complement(163739..164464))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216692" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975758"
FT                   /orf_name="Pc22g00710"
FT                   /product="Pc22g00710 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAP97359.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="UniParc:UPI0001832261"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPI4"
FT                   /transl_table=1
FT                   /translation="MLSIKSLLNPQPERRNPHPSFPASREKRQKMAKDAPVFRRGKIQG
FT                   ECRYPPCEERDAELEKAHRELSLRPFGNIADYPRQIPYASDKKTFQEKTGRDSFHVFQY
FT                   TFQIPGEEKEWHVMWDYNIGIVRITHLFKCNGYSKASLQGKMLNQNPGLRDICHSITGG
FT                   ALSAQGYWMPYEAAKAMAATFCWRIRYALTPLFGTEFPAMCIPPTDRKTHGRMVIPPDI
FT                   VQRATNLSNYYRSLEMKSSAGANPPAINAPSSTHTLLRGMGIPRTKYADSNPSARDSSM
FT                   EPYCMSPRSQSSMSTFTPINPPRSSNVIPRSRVESPRAILRAISDAMRPENVPGGISDS
FT                   ETESDGSSNMYSTPNSPPVDDKLAGLDEPTNPALEVVATQSDYDDLTDSDDDWQMDDDD
FT                   DEDYRGPPLKKTLVGAPVGKDGSTSPASLTKKYPSRKSRAARPQPSPHFTREVKAAEAL
FT                   LRLHMNELESTGTETEMDDDELTSPPDCRSLDGDESRSRKRRRASL"
FT   CDS_pept        join(166358..166484,166572..166612,167041..167130,
FT                   167212..167316,167398..167457,167548..167783,1
FT                   67936..168215)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940288"
FT                   /orf_name="Pc22g00720"
FT                   /product="Putative uncharacterized protein Pc22g00720 "
FT                   /protein_id="CAP97360.1"
FT                   /db_xref="UniParc:UPI0001832262"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPI5"
FT                   /transl_table=1
FT                   /translation="MVARQDEHQRGLRLTASCRATYSLYNGKLHYLASPRSASEKILCT
FT                   RLYKTIHLIDGVQGVHPPIGAGPGQHYRAPQKTVHIDAGRTGDGLNCIGVGLQRVPTAE
FT                   TGRVQKRGLVSNVLDTLIPGFWKRGKKPCLNWDAAVGVALGGTLFSHGYQEVDRLIVQV
FT                   RAEQLLKMLYHDSKIATVDKEYTERHVHMSLQDSILNPSSNQIKDSLLSQRGPDLDPGN
FT                   TVPSTTEQGKSSRERGSTMKGKTESSQAGPNRDAANREPGQWTGMKLNGCLALLGDQGR
FT                   LHGIASNYPSGLGRGILCIKMGVMTHGYGRM"
FT   CDS_pept        join(complement(170203..170239),complement(169876..169992),
FT                   complement(169794..169825),complement(169616..169733),
FT                   complement(169362..169558),complement(168779..169300))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940289"
FT                   /orf_name="Pc22g00730"
FT                   /product="Pc22g00730 protein"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="CAP97361.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="UniParc:UPI0001832263"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPI6"
FT                   /transl_table=1
FT                   /translation="MASGDVTYPNTGSPVVDNVKSEASRTGDELRDLKNSRVTPSTTTA
FT                   DGQPLTHYHSLMYSLLSWEQPRATAVSYASVICFIFAARYLPLLRWAFKFLYMSLGVTA
FT                   TVEVAGQVILKRGVASGFRPRRYYTIPKETVEAVLEDLEQLVDFFLIEFQRILFAENVL
FT                   HTILAFTAAFTGYWLIRFVPFWGLAVIAVTTTYFTPLVYISNRELIDEQIVNAQEIINS
FT                   QTNQLRDMAGERTSHATGLMKQYVGEYSSKAQGIIGSRRSASPEATKVVSPVKRETVAE
FT                   SAKTPIPEFTAPVAEPAVKHEDFPEAPKAAPVAQSSESDIVASVEPAEQAGDREPLLAI
FT                   "
FT   CDS_pept        join(complement(172955..173087),complement(172817..172893),
FT                   complement(172629..172761),complement(172067..172567),
FT                   complement(171564..171991))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940290"
FT                   /orf_name="Pc22g00740"
FT                   /product="Pc22g00740 protein"
FT                   /protein_id="CAP97362.1"
FT                   /db_xref="UniParc:UPI0001832264"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPI8"
FT                   /transl_table=1
FT                   /translation="MDSESPYPTVPLSKTSPCPYLLCFSCLSLFMPDSDYPWMASYRAV
FT                   YLTPDGAKLSDVAVTDFDWLEEYLEDNEAFLFHESCWSALVKHFANGEVDLNRLFEVCK
FT                   NIPGSARPVGDPRGKEFPWHPLERPIIRGIGDATRKLPKMKRKNTDSSHNPTSGTDCFG
FT                   LLAMEIRLEIAAYLSTVDFFSLRYASRAMALLFQLQSFWKTRFRVNGDRGFLAYLAEAP
FT                   QNRKRKNWRSIYHCTARIDQPHLQLWTIRRIWRNNQWLADRCSMVKALDDQPRSHNNLL
FT                   KCRTCYAYHYAVVQTVSLQNIIGLAVSILPEGSKTYITGFDLISADAGTPNIIFGYRLP
FT                   GKQVTINLYGQKLRGFDVSLGEGGIQAIRPIFNTNINTNWIGETESKRDYSLTQIISTQ
FT                   LILEDEIKAISGKFDISQFCHYEP"
FT   CDS_pept        join(complement(174609..174773),complement(173901..174404),
FT                   complement(173402..173737))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975759"
FT                   /orf_name="Pc22g00750"
FT                   /product="Pc22g00750 protein"
FT                   /protein_id="CAP97363.1"
FT                   /db_xref="UniParc:UPI0001832265"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPI9"
FT                   /transl_table=1
FT                   /translation="MAHETGVGNGPTIQDLEKGDYNQIWEWNKTVPAAISNLVHKLIHD
FT                   NVEVNPGAPATQVKVRGQRVELSEVEHHIQQQLYSRTGKRVNPIVELVTTGASKGSGGR
FT                   PTLVGFLAMSQIESAEPEDAQQLRQAMWDLTKDLNKSLLKTLPQYMVPSVYIPLWQFPL
FT                   HSSGKTDRRQLQVTGLVLPRQDLAALRAPPTTAKATTTALQSRTPPDTFVEQRMQRMWS
FT                   KLALPLCNRPENVLSGSVEWNISLEKWGLRHKPTKDYPNRVVAAPVQKMWIEKPRSSSQ
FT                   DPIIGGRFEIPFRSLFLRDPGDREGDFLMTHEDITRLARDIWRVDVILAAENE"
FT   CDS_pept        join(175891..176066,176126..176216,176274..178686,
FT                   178741..178892,179001..179291,179346..179918)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126805"
FT                   /orf_name="Pc22g00760"
FT                   /product="Pc22g00760 protein"
FT                   /protein_id="CAP97364.1"
FT                   /db_xref="InterPro:IPR005635"
FT                   /db_xref="UniParc:UPI0001832327"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPJ0"
FT                   /transl_table=1
FT                   /translation="MAASARAQKPVGSAPWIAAEKENMAELVEQEMEEVEYPVRHELDW
FT                   LNEHMTEILSKGQTNFADVFKTPGKMRGKTPRTARKRMPEESRVPLSEIFSSAQKQLEN
FT                   HASPSPFIHRVVSKPAPVTASPVPRTKIVTEQASQPEYPDLTQNLNSFPTHNTDSGYHG
FT                   MPDDDEMVLPDVQQESQASTQPSTQPFEQDEPMNLDTQEVDISASQQTNEESFHSAREE
FT                   IRSRGQTVEPIKDPTPTQESTSRPAVSVSEESEREIMSTPTKKTKSKPDGKIPEKQQNE
FT                   ESEPEESDTPVSKPEPSPEKAPVAPVAPPIETQDSHPEDEDMEEATKDDAVLDSLDDIG
FT                   SPSDGSTPERPFGRKSSLSFATLPAREPLKTRISHIDLAKTSTAGRPSYFGRQTGGHRI
FT                   PHPAAEDTTGSRALEIDNEKEPSEEMDPDQATRMHSKKSTQSLHERISMLGKLQPSRPR
FT                   KSIPSASALPAGQVPYPDLPASKAETKSEALDERAREAPAPERMSVDDDWIKPLSSPQK
FT                   PELSKSKTTDVMEKLAEFEKSHAVNKKDALQTEPERPKSSTSMFSSPRPHGHQQSASFS
FT                   HTPVDASTTPTGSPRRFDGHISASKLKLHSIMKSAKGLFSSTGNTPRMEHSSPEQTRIQ
FT                   PSADAFTKNTKHLSQPVPITSPQRPEGRRTRSSTEKEEKRRQHEREEQEREDREEEARV
FT                   ERAREQEKQRALQLKAAQENSSVEPEERAGSAVYKTSQSQRQQSREPESAQESSSRFAV
FT                   PQPKQNDRRPLKPTREPVKRPTPQPMSIRVGSTMSRQQIPVPSSSGSQESVVAAAASVA
FT                   ASKPTLKKKGSNTSLHTASSASSFKSSVSSQTQAQRKAQVANDRKKEQEREARRKEEQK
FT                   RDVERKRAAAQQEEARRQEMRSQRQAERERQAERERRERSAQEDPNKAARMEAIKKRQA
FT                   ENARKHGRQGSQQIAYSQSSQRSDLGSSRPPSRLGSSIQPFGGRSINPPPPNPAKPPKR
FT                   GNDETSHRAAPSKPSNVQSTGEFKRRKTEDEHNPMPPVRTMAQPIRQSSIRKESMKPST
FT                   LGRGQSSLAPQSGSSSYRNAQPQRPAHPIVTYTNGKIPFAEPNHAPPPSTHKAAPSSAP
FT                   RPPTKPSPKYPSGENIHLPEINTDSEDDDDSDSEMFPVPKWAQAKELEGLLRQQDGMEV
FT                   DSIFGPIAPFSLEDTFKADKKIKKYRDRTSSANWSGPDGLTQEEIRRDVAERQRLRLNG
FT                   GWSFNS"
FT   CDS_pept        join(complement(183828..184541),complement(181457..183760),
FT                   complement(181236..181403),complement(180980..181177))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000029666" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975760"
FT                   /orf_name="Pc22g00770"
FT                   /product="Pc22g00770 protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP97365.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniParc:UPI0001832328"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPJ1"
FT                   /transl_table=1
FT                   /translation="MYCSLSVVCRRSLRIVPVLPFPSYQGANQTSTPLRSPAAADRSPA
FT                   SHSLTPHRPHLHVSHSSDTPFSAALLASRGSRSISSLASHLKPRRHYLQSSDIFAMDGK
FT                   GDMSAKRKRSTTACTSEHPNKQLRPEPSILTPDDATPANGTVYEIEEDVDEAPSPVAIP
FT                   ATTDSPEWQATIEKVVKCAVSIHFCQTCSFDTELSMSSQATGFVVDAERGYILTNRHVV
FT                   GAGPFWGYCIFDNHEECDVQPVYRDPVHDFGILKFDPAKIRYMQVTELKLQPDGARVGA
FT                   EIRVVGNDAGEKLSILSGVISRLDRNAPEYGEGYCDFNTNYIQAAAAASGGSSGSPVVN
FT                   LAGHAVALQAGGRADGAATDYFLPLDRPLRALECIRQGQPVTRGTIQTQWVLRPFDECR
FT                   RLGLTPEWEAAVRAAAPTETNMLAAEIILPEGPADGKLLEGDVLIKVNGELLTQFVRLD
FT                   DILDTSVGESVKLLVQRGGQDVEVVCQVGNLHDITPDRFVTVAGASFHDLSYQQSRLYA
FT                   IATRGVYVCESAGSFKLENTVAGWIIDSIDKRPVRNLNEFVEVMKNIPDRTRVVISYRH
FT                   IRDLHTKGTSIIYVDRHWHPKMRLAVRNDESGVWDFSDIAEPIPAEPPVPREANFIQLD
FT                   GISQPAAAEIVRSFVRVSCIMPLKLDGYPQAKKTGFGLVIDADKGLVVVSRAIVPYDLC
FT                   DINITVADSIIVSAKVVFLHPLQNYTVIQYDPSLVKAPVKSAQLSTNYIKQIQDTIFVG
FT                   FNQNYRIVVAKTTVTDITTVSIPANAAAPRYRAINLDAVTVDTGLSAQCSNGVLIGEDG
FT                   VVQALWLNYLGERSASSHKDIEYHLGLATPYLLPITSKIQQGEVPTLRILSMESYVVQM
FT                   SQARIMGVSQEWINKVTEANPSRHQLFMVRKVDSPPAGVTPDPSTSFQEADIILTLDGQ
FT                   VITRVSELDVMYEREFLDALVIRNGEEMRIRVPTVPTQDIETDRALAFCGAVLQKPHHA
FT                   VRQQISKVHSEIYVSARSRGSPAYHYGLAPTNFLTAVNSVSTPDLDSFIREVRKIPDNE
FT                   YFRIRAVTFDNVPWNFEPRSNIQQFPMSEYVKDPTSASGWRTISYETEIGVAPDAANLN
FT                   PDAMDEAAEGGASEIEPDMQ"
FT   CDS_pept        join(complement(186271..186472),complement(185253..185962))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940291"
FT                   /orf_name="Pc22g00780"
FT                   /product="Pc22g00780 protein"
FT                   /protein_id="CAP97366.1"
FT                   /db_xref="UniParc:UPI0001832329"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPJ2"
FT                   /transl_table=1
FT                   /translation="MDPNTGYPAGYPVPTQSPQNQQMPFYPNAVPQYPQSKTPSAQQFG
FT                   AMPMQPGPGGAMMPSGFPQQSSAAPMDNFSASYAQTPIPTSMGQFVPPQGTSGANMPSQ
FT                   VAQTFSQNMASISANNLLGTQPKPPSQMNSPQTAALPAAPNQAQAQAQAQFAAREKARV
FT                   AALLDINSALLQEVVNLQAAGKAGPASNPDTNSPASEQPDASKANQKPSPEYIECMRRL
FT                   QANLAYLATIADRAKKAGGVVPQTPAIMTPPPNLPAVNELYARLNELFSRSAKASTPQR
FT                   PSPPSMQGNGGPSPGAMSESII"
FT   CDS_pept        join(187500..187540,187707..187800,187847..187956,
FT                   188067..188232)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975761"
FT                   /orf_name="Pc22g00790"
FT                   /product="Putative uncharacterized protein Pc22g00790 "
FT                   /protein_id="CAP97367.1"
FT                   /db_xref="UniParc:UPI000183232A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPJ3"
FT                   /transl_table=1
FT                   /translation="MRTREIDALSLLPRHVWICQRPLGNYRLTISIHKSHSGTLTHGSD
FT                   ERPSDTSGNLPKKGNYLDDPMNFVSINHSDDLYRKGICAYAVTNMQRAKRGTVETTVKP
FT                   APQAPVSHFQEMQVGYAGLCKWELWGGAILAV"
FT   CDS_pept        join(complement(189406..189549),complement(189102..189151),
FT                   complement(188789..188946),complement(188547..188683))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822798"
FT                   /orf_name="Pc22g00800"
FT                   /product="Putative uncharacterized protein Pc22g00800 "
FT                   /protein_id="CAP97368.1"
FT                   /db_xref="UniParc:UPI000183232B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPJ4"
FT                   /transl_table=1
FT                   /translation="MTLTFQRLAIIILYTYITAYQYWLWEWLGFPQTLTQLEHPCPLEP
FT                   DIIIQNSQFAKTPMHKNLPRYNTIGRACFEQASGSDTFHGRLASAERGWKNANRIWNQR
FT                   WYLGTICHRAISHVVNFARSNLDSQVEHKFYDRTHDKLLDSWTFRCGEECVAFDEVLV"
FT   CDS_pept        join(190031..190226,190285..190797,190850..191035,
FT                   191116..191594)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195460" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941334"
FT                   /orf_name="Pc22g00810"
FT                   /product="Pc22g00810 protein"
FT                   /protein_id="CAP97369.1"
FT                   /db_xref="InterPro:IPR021264"
FT                   /db_xref="UniParc:UPI000183232C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPJ5"
FT                   /transl_table=1
FT                   /translation="MSRQSPEEPGYTHFAMIYIDNDGNLCQRASDSISESREAILSPRV
FT                   TGEFLRAVAMSREAHATRSQVSPEIQVPSSGGQPFNNSSAPSQGESVGYNGMGLGSQQR
FT                   MQVPSQPESPFQPAMWPSCESWSLQASSQPKKNFGGRNLNLASHQRASISVKDRGLLRL
FT                   YYEKIFQNLQQTNCRIIAKAYIKLVEPRKQVNYPYNGRKIVEGRTQQLDPEATKPPWWP
FT                   LGVSHREPDHLPKVERIRLLVYMLCEMRETHGITTARLKQSDQPIRRQILPVERLQILD
FT                   EAYQVREEEEKYLDGISARTNLPQMAGDTSSGQSSPIEPPSSQNIVESECSDGISDIDI
FT                   TQVTSEDLPNAPPYNPSHPYNPMHMGPNTQYHSVGPSNMSTSPLELRPKHEPESAGTHL
FT                   IDRTHPTGMAHYPYPGVSGIQPTPMGFYGTSVPITQTSTENLSTEAMMPYGHPYYFSY"
FT   CDS_pept        join(complement(193160..193212),complement(192942..193098),
FT                   complement(192760..192892),complement(192588..192701),
FT                   complement(191786..192519))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000019847" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941335"
FT                   /orf_name="Pc22g00820"
FT                   /product="Pc22g00820 protein"
FT                   /function="cation binding"
FT                   /function="cellulose binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAP97370.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030248"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000183232D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPJ6"
FT                   /transl_table=1
FT                   /translation="MVHFSTIALALASALPQLTQGAGLHTSAVAKGKLYFGSATDNPEL
FT                   TDVPYLTQLSNTDDFGQITPGNSQKWDALEPSQNTFSYTNGDVIANLAAKNGQKLRCHT
FT                   LVWHSQLPSWVSSGSWTNATLIAAMKNHITNVVTHYKGKCYAWDVVNEALNEDGTYRDS
FT                   VFYKYIGEAFLPIAFATAAAADPDAKLYYNDYNIESPGSKSSGAQRIVKLVQQYGAKID
FT                   GVGLQAHFIVGSTPSQSAQTTNLAAFTALGVDVAYTELDIRMTLPSTTALLTQQSTDYK
FT                   NTVAACMANTKCVGITIWDYTDKYSWVPSTFPGQGDACPWDKNLVKKPAYAGILAALGG
FT                   TSSTTTTLVTSTTTAGSGGATRVPLYGQCGGSGWTGGTTCASGTCKHINDWYSQCL"
FT   mat_peptide     join(complement(192942..193088),complement(192760..192892),
FT                   complement(192588..192701),complement(191789..192519))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPJ6 "
FT   sig_peptide     join(complement(193160..193212),complement(193089..193098))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPJ6 "
FT   CDS_pept        join(complement(195224..195518),complement(194890..195162),
FT                   complement(194119..194834))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216688" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941336"
FT                   /orf_name="Pc22g00830"
FT                   /product="Pc22g00830 protein"
FT                   /function="binding"
FT                   /protein_id="CAP97371.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023114"
FT                   /db_xref="UniParc:UPI000183232E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPJ7"
FT                   /transl_table=1
FT                   /translation="MSRVEELPDDFDESLDLNKAPPEVAQGLPQPGFDAFAPTNEIPFP
FT                   INEEALKARKTDPNAPELPPAIAAVQSHTSEELMAMMNKTPLFMTDIENAGDEKGENVL
FT                   LDALQALQNEGTRAEVANTFKGQGNEAVQELKWIDAKEFYTKAIAVINAKVDKWEKPED
FT                   PEEEAALLRKLDEASHINRALCNLELGNYRSCTLDCAVALKFNPKNVKAFYRSSLALFK
FT                   LDKVAEAEDAAARGLAIDPESKALQESARKIAERKALLERAAARKKAEEEKVRKQNMVL
FT                   STALRARQIRTRKTTQPPDMEDAKIRLVPDPLSPESTIEFPTVFLYPMDAQSDFIKAFS
FT                   EMNAIEDHLSYIFPLPWDTKKEYTVEGVECFMETVSGGLIKAGKKLPLLQILSGGKVEV
FT                   VDELVTIHVVPLSKTGKYIAEMKARKTG"
FT   CDS_pept        join(196283..196754,196816..197239,197289..197493)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000021112" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670039"
FT                   /orf_name="Pc22g00840"
FT                   /product="Pc22g00840 protein"
FT                   /function="3-isopropylmalate dehydrogenase activity "
FT                   /function="NAD+ or NADH binding"
FT                   /function="magnesium ion binding"
FT                   /biological_process="leucine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP97372.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003862"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009098"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI000183232F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPJ8"
FT                   /transl_table=1
FT                   /translation="MAKNFNILVLPGDGIGPEVMAEAVKVLKVFETPERKFELRQELIG
FT                   GCSIDAYGKSVTEEVKQAALDSDAVLFAAVGGPKWDNQRRGLDGPEGGLLQLRKAMDIY
FT                   ANLRPCSSTSPSASIAKEFSPFKHDVIEGVDFVVVRENCGGAYFGRKVEEETYAMDEWG
FT                   YSEAEIQRVTRLSAEVALRHNPPWPLISLDKANVLASSRLWRRVVDKTMAAEYPQVKLV
FT                   HQLADSASLILATNPRSLNGVILADNTFGDMISDQAGSIVGTLGVLPSASLNGLPGDKT
FT                   LKTRPYGLYEPTHGSAPTIAGQNIANPVAMILCVALMFRYSLGMEDEARRVEDAVRKVL
FT                   DSGLRTPDLGGKAGTKEVGDAIVSAL"
FT   CDS_pept        197745..198425
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127064"
FT                   /orf_name="Pc22g00850"
FT                   /product="Pc22g00850 protein"
FT                   /protein_id="CAP97373.1"
FT                   /db_xref="UniParc:UPI0001832330"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPJ9"
FT                   /transl_table=1
FT                   /translation="MSKILHPLKPKGSTPQSPLQDGSPTKTRALTMSLQKPTISSKPVI
FT                   APGHPNQQPNTPGFCALRLENLEHQTSTTKRELMASIAADICATFISIAKYSEEGILQA
FT                   QHTDVIDKVIQTIRDTDVKQRHLLDRQVRRLRKERKWIRKKYSRLAGQADGLSRAYQTK
FT                   MRKLSISLHEAREEVARLQRERDMLLTCLKKDVIEEAASNDNADGEFEVVADAEDVDGE
FT                   FEIE"
FT   CDS_pept        join(199327..199433,199540..200347)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822799"
FT                   /orf_name="Pc22g00860"
FT                   /product="Pc22g00860 protein"
FT                   /function="heme binding"
FT                   /function="peroxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="CAP97374.1"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR002207"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniParc:UPI0001832331"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPK0"
FT                   /transl_table=1
FT                   /translation="MSTHDYDAVRKDIAAILQKPGYDDGSAGPVFVRLAWHSSGTYDAE
FT                   TDTGGSNGAGMRYEAEGGDPANAGLQHGRAFLEPIKEKHPWITYSDLWTLAGVVAIKEM
FT                   GGPDIPWQGGRTDLIGDTKVPPRGRLPDGAQGADHLRFIFYRMGFNDQEIVALTGGHNL
FT                   GRCHGDRSGFEGPWVTNPTRFSNSFFKLLLQLDWKPRKMASGMTQFVYEDPDAEEDEEP
FT                   LMMLPTDMSLLTDPAFSPWVKRYAEDKELFFDHFSKVFAKLIELGIRRDAQGAVTNTDG
FT                   TLGGYVSAPKKSNTATGPPRARL"
FT   CDS_pept        complement(201022..204444)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941337"
FT                   /orf_name="Pc22g00870"
FT                   /product="Pc22g00870 protein"
FT                   /protein_id="CAP97375.1"
FT                   /db_xref="InterPro:IPR006954"
FT                   /db_xref="UniParc:UPI0001832332"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPK1"
FT                   /transl_table=1
FT                   /translation="MSTFSPLEVPPLSDFPSRPEELEHPPQPSTIYDLTRLPNPPNDWS
FT                   HFDVKFESIALGHSRSLKLPQVQVLMKHYFWGIKYEETTKTAKTTRKKQNLKVQQMFLF
FT                   KLIYYMQERHRPKTWLEMLNINRDTGPRLLRYDLDPRPRPLSRWYTSLPDVTTPILNAY
FT                   IRPLDAPPDMPDHLLQQYMYSVDSLYTPPPPPPPPAPTLARQEEEILRMELLQHMNPGV
FT                   QFTPAYSLTDPPGTRIPDPEPGQKRAPDENREPRRKRSRQLSPGAPAYRGRPRSPTPPF
FT                   QEPVFAADEITTFTWTPGLAPSHTVAPIGKHQLGPLDPKAPGPVDTRVLTDAIERAVMQ
FT                   IVYADLDRDPSIPSTEKPIRDGSAQSYQDILKLKLGSFPTTANVKLSPLTFDWDPNGTL
FT                   FPVRGRGPVWNAMSCATDAVIVAGMLLDAGCTKIDRANNRASEFKDIEKAFIEVTMASW
FT                   ETFDDKTSIFVRDEWLRMFMEGSPGLKMGQPIPPWAVWSVATRSFAQFRYFHVERVTPC
FT                   KCQREIPFYNSHQGSCILPGYQPGDENGVELQVLIERCFYPRKSFKCDKCGDAAGVTGE
FT                   RKIGQLPLRLVVTSDVKTRIRNHTQNLRFNYIDYEDKQQVAHYRWLGGIYNNESHARLF
FT                   WTDTQRGEKDDGNLMVYDSQVNSGILIGGVPGFQHEERVPTEWVNHHAIPLLFYERIMN
FT                   PSTDILLKANNAMFEINTCVEENKNVLEAHIPWKRSTPPLQQESWPRILSYNGERFSSF
FT                   NPGWATAQPSPKIAAVQTATPTLTPAATIDPALTGPTLLDPSLLDPAPLDPALLDPALL
FT                   DPALLDPALLDPALLDPALFDPALFDPAVLDPSLIDQSIYSTTTPPEFDFSSLLDVTMM
FT                   DEEPAIDQDVTEGSTQNPMFDSMMQSPRWVAPTPDMWPSGIPDEEGALDFPELPLTPYL
FT                   GNRKGTGWSDIPMRDANGTIPGLRNRVFRSTHGIGLQRSAMANYAIAKQALTASEKKAL
FT                   RAGNMRLFRAKRRFSDIEDGEEEEKADQEKVVRERIETQRRQKKQEHERKRREEQKKQE
FT                   ELDKKTREEREKQKELEKEREQEKQESEVLEKGPEKDQEWTREESHKQQRKEEPKKEEE
FT                   TRKVSRRPGLRNSRKKNTDPTWKPGDSGDEADL"
FT   CDS_pept        join(205687..205690,205840..206005,206180..206477)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000039877" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822800"
FT                   /orf_name="Pc22g00880"
FT                   /product="Pc22g00880 protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP97376.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="UniParc:UPI0001832333"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPK2"
FT                   /transl_table=1
FT                   /translation="MSLVTGEKTNFQFILRLLNTNVDGKQKIMYALTQIKGVGRRYSNL
FT                   VCKKADVDLTKRAGELTTEELERIVTILQTPTQYKIPSWFLNRQRDITDGKDTQVVSNG
FT                   LDSKLREDLERLKKIRSHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKG"
FT   CDS_pept        join(complement(208466..208952),complement(207249..208414))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000198296" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822801"
FT                   /orf_name="Pc22g00890"
FT                   /product="Pc22g00890 protein"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="vacuole"
FT                   /protein_id="CAP97377.1"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR008442"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="UniParc:UPI00018323F7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPP6"
FT                   /transl_table=1
FT                   /translation="MRVLSATLLAGAASAAAPPFQQVLGAHKEYAENVIQQGADAFKPL
FT                   QHLQDQFKSLSGEARQLWEEVSNYFPESMESAPLLSLPKKHTRRPDSHWDYHVSGAEVQ
FT                   DIWVSGAEGTKEREVDGRLEAYNLRAKKVDPSALGIDPGVKQYSGYLDDDENDKHLFYW
FT                   FFESRNDPKNDPVVLWLNGGPGCSSLTGLFMELGPSSIDSKIKPVYNDFSWNNNASVIF
FT                   LDQPINVGYSYSGGSVSDTVAAGKDVYALLTLFFKQFPEYATQDFHIAGESYAGHYIPV
FT                   MASEILSHKKRNINLKSVLIGNGLTDGLTQYGYYRPMACGEGGYPAVLDESTCQSMDNS
FT                   LSRCQSMIQACYNSESPWVCVPASIYCNNAMLGPYQRTGQNVYDIRGKCEDESNLCYKG
FT                   MGYVSEYLGQESVREAVGAEVDGYDSCNFDINRNFLFNGDWFKPYHRLVPGLLEQIPVL
FT                   IYAGDADFICNWLGNKAWSEALEWPGQKEFASAELEDLKIVQNEHVGKKIGQIKSHGNF
FT                   TFMRIYGGGHMVPMDQPESGLEFFNRWIGGEWF"
FT   mat_peptide     join(complement(208466..208907),complement(207252..208414))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPP6 "
FT   sig_peptide     complement(208908..208952)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPP6 "
FT   CDS_pept        join(209557..209623,209683..210632)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670040"
FT                   /orf_name="Pc22g00900"
FT                   /product="Pc22g00900 protein"
FT                   /protein_id="CAP97378.1"
FT                   /db_xref="InterPro:IPR002140"
FT                   /db_xref="InterPro:IPR018978"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="UniParc:UPI00018323F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPP7"
FT                   /transl_table=1
FT                   /translation="MPINQPSNQIKFTNVSVVRLKKGKKRFELACYKNKLLEYRSGAEK
FT                   DLDNVLQVPTVFLSVSKAQTAPSAELAKAFGTGTPREEILQEILRKGEVQVGERERKDI
FT                   LERVEKEVLDIVSGRLVDPSTKRVYTSGMIHKALDQLSSASGQQQTQASGEANGDGEEK
FT                   PSQPKKPLWTGVSANRSAKSQALDAMKALIAWQPIPVMRARMRLRVTCPVSLLKQSVKA
FT                   APGAGSNKEKEAPSGGSKNNKKGNKGSKKSAKRDDSDIEGGQSDVEATPKAPSTVKDKI
FT                   MAFIESVESQEVVGGDEWEVVGFAEPGAFKGLNELVSNETRGRGRVEVLDMSITHED"
FT   CDS_pept        complement(211167..212723)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127065"
FT                   /orf_name="Pc22g00910"
FT                   /product="Pc22g00910 protein"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAP97379.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI00018323F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPP8"
FT                   /transl_table=1
FT                   /translation="MLRSLHRLRSLRRFLCFSSSKSCEPTDSATHGTENVEDPIRLRPA
FT                   GRTVAQARVASPCLEGLGSVQSRTPSVSPSSCDSSTQTELTNASDGETRATTVSTGTGN
FT                   TSTPPETPAKSASTSRLTTITPYTPILQADGSLRAPQVTFDGYGSYGGRFAPESIMGFL
FT                   YELTSFFEATVSDPSFWEEYATFQRDRVTPLHMAGKLTSLAGGATIWLKREDKNEYGSH
FT                   KTRNITGQLLLARRMGRSEIVTDCASAKHGKVTAAMCARLGLRCVVVIGADDASAQEKD
FT                   VLEMKSLGAKVLTARAPSGMGGLRAAITEALRYAVCNHESAYYLMGSPVGPSPLPTLAR
FT                   TFQSLLGEEVAAQMHEAAGRQPDALVTAVGSGSGAIGLFRPFLHDSSIRLVGVEAANAA
FT                   ALTDGGLGVLQGARTLLLQNHDGQILDSHSISPDMNLSTVGPEVAHWKDSGRIEISTAT
FT                   DAVALDGFRTLQQHEGILPGLDSSHAVSKALDLARELGPGKNVVLMVTGCDNISVRGLD
FT                   V"
FT   CDS_pept        join(complement(217334..217634),complement(216940..217256))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216683" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941338"
FT                   /orf_name="Pc22g00920"
FT                   /product="Pc22g00920 protein"
FT                   /protein_id="CAP97380.1"
FT                   /db_xref="UniParc:UPI00018323FA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPP9"
FT                   /transl_table=1
FT                   /translation="MTFREKVKRVFRSKSKNDGKPKIEYYRRHECPPSKFRGPFDREHQ
FT                   KSLAAWSFQGAMVERTRSLEISLSPCDTYKGSDDYSGPSDTDNSVSPDDGADVDPASSS
FT                   PEAPAESSPRAADSGSQSSTIVNPSSYNGSMMTLINEGSFYEIPEDSKDPKFFLKESIR
FT                   YSSPLVHAISPAMTPCVMSARKDLPFAPEDLTRALIAVQVCA"
FT   CDS_pept        join(217702..217794,217907..217993,218322..218351,
FT                   218421..218621)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127066"
FT                   /orf_name="Pc22g00930"
FT                   /product="Putative uncharacterized protein Pc22g00930 "
FT                   /protein_id="CAP97381.1"
FT                   /db_xref="UniParc:UPI00018323FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPQ0"
FT                   /transl_table=1
FT                   /translation="MRAVPGENASVVHTTPGLGTDAVGVQARIAGYYGTLDATAIDKQV
FT                   GWMSGFPRSVSGPYPDPPDSPYVQVYCSEGFQKTRPDESLTVTSYYLVRGCVMKWQKYA
FT                   LDGNKPESEWNLACPIAPLAPTRHVFAAFACL"
FT   tRNA            218671..218742
FT                   /gene_name="tRNA-Arg (TCG)"
FT   tRNA            218886..218957
FT                   /gene_name="tRNA-Arg (ACG)"
FT   CDS_pept        join(219747..219826,219875..221177)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976010"
FT                   /orf_name="Pc22g00940"
FT                   /product="Pc22g00940 protein"
FT                   /protein_id="CAP97382.1"
FT                   /db_xref="UniParc:UPI00018323FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPQ1"
FT                   /transl_table=1
FT                   /translation="MGKKGGKKNKKGSKPVAAAVETVKDVVEPGQTEEQIKQTEGQTET
FT                   AEQTVTPETATQPTETVAEPITEPVKAPEATPETEAPATVIPAVAETKDVETKEAMKAE
FT                   KALATEGTVDEAVEKARASKAGQLGELEDGAAAGTGMTRVSKNATKMELTWKPAAILPE
FT                   STPKEPASLATTAGVPATLAERPKTSESTAPAVDAPAPIAAPVESDAAHPKRPYEKPIF
FT                   NTEENLKPHKMPKTDEEALPASLPEEKKTVDTLAGAGPASTAALTTPEPVPVQDEASKV
FT                   AETPKVEERVAEAPKITEEKVEAPKEVAETPKVAEEKKITEAPKVAEEKIPAESVPKTT
FT                   AAQSGAGKPTSSPEAVAAANAAILSSKGDKAAAPAAAPAAAPAAAPVVSKEAEPKKPEA
FT                   ALKRGEEPMPKTETPKPETKAEPVKEEAGKAQQETQKTSEVAEQVEKKKGGFLSWLKRK
FT                   FK"
FT   CDS_pept        join(221632..221726,221765..221888,222062..222169)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976011"
FT                   /orf_name="Pc22g00950"
FT                   /product="Putative uncharacterized protein Pc22g00950 "
FT                   /protein_id="CAP97383.1"
FT                   /db_xref="UniParc:UPI00018323FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPQ2"
FT                   /transl_table=1
FT                   /translation="MAPRRAQHGYQADAEKVLILLYTVVNVGTLPRTIDHSGFADLEQF
FT                   EDSQSFSLGTEILVNSIDTTFQRTDIDLSPNMNPGSPCVSMETEFYEEEEEEKEERGKN
FT                   VGKE"
FT   CDS_pept        join(223132..223236,223287..224299,224373..224830,
FT                   224882..225222,225289..225430,225623..225660)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229992" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941339"
FT                   /orf_name="Pc22g00960"
FT                   /product="Pc22g00960 protein"
FT                   /function="acetoacetate-CoA ligase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP97384.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0030729"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI00018323FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPQ3"
FT                   /transl_table=1
FT                   /translation="MTSLPRKLWQHPAPESTQMGRFQRDLEKSTGHKFDSFHDMYLYSV
FT                   KNRSAFWEFCWKYFQLIHEGSYTKVVDETARMDSVPEWFPGVRLNFAENLLFSRIAGDK
FT                   TDKEDDKIAVSEVREGAAHEVIHLTWGELRRRTGALVQAMKAHGVVQGDRIALCAANSI
FT                   DTLFVFLASTALGAIFSSSSTDMGTKGVLDRLLQIKPRWLFMDDLAVYNGKTIDLRSKI
FT                   GEIVKGMESVPEFEGVVSLPRFHSRPADINSISRTKTLAEFLEKAGGNEKLEFERVGFR
FT                   DPFLVVYSSGTTGQPKCIVHSVGGVLLNSSKEGRLHSDLGPDCVTLQYTTTGWIMYMSA
FT                   VQTLLFGARVVLYDGSPFIPGITALVDLAAQEKVTHLGISPRWLHELQQAKIKPREKVD
FT                   LSSLRVVTSTGMVLRDALFEWFYDEGFPPHTRLNNISGGTDIAGSFGTGNPLVPLYVGG
FT                   CAGCSLGIPVEVYDSTIEGGDGIKGVPVEDGVPGELVATSAFPNMPTLFWGDESGKKYH
FT                   DAYFERFDNVWTHGDFVSIRPITKQIVFHGRADGVLNPSGVRFGSAEIYRVLEGQFSKE
FT                   ISDSICVGQRRPTDTDERVILFLLMRPGMAFTPDLVARVKSAIRSELSPRHVPMFTFET
FT                   HEIPTTVNLKKVELPVKQIVSGKIIKPSGTLLNPKSLDFYYQFAKVETLREKILNNAYE
FT                   RNSK"
FT   CDS_pept        join(225876..227299,227352..227466)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000070228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941340"
FT                   /orf_name="Pc22g00970"
FT                   /product="Pc22g00970 protein"
FT                   /function="glutamate decarboxylase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="glutamate metabolic process "
FT                   /protein_id="CAP97385.1"
FT                   /db_xref="GO:0004351"
FT                   /db_xref="GO:0006536"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00018323FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPQ4"
FT                   /transl_table=1
FT                   /translation="MVHLAKVKKDNEVPPSTHDIVSVAPPDIDDFETNVYGSHFAADHM
FT                   PLHEMPEREMPRQIAARMIKDELSLDGNPKLNLASFVTTYMEDEIEQIMTESFSKNFID
FT                   YEEYPHSAEIQNRCVNMIARLFHIPTDASGENAMGTSTIGSSEAIMLGTLAMKKRWQNK
FT                   RKAEGKDYSRPNIIMNSAVQVCWEKAARYFEIEEKYVYCTDTRFVIDPKQAVDLVDENT
FT                   IGICAILGTTYTGEYEDIKAINDLLVERNIDCPIHVDAASGGFVAPFIQPDLKWDFRLE
FT                   KVVSINVSGHKYGLVYPGVGWVIWRSPEYLPQELVFNINYLGADQASFTLNFSKGASHV
FT                   IGQYYQLIRLGKHGYRAIMSNITRISDYMSSEFEKMGMVILSQTQGRGLPLVAWRLPTD
FT                   DSRIYDEFAVAHQLRERGWIVPAYTMAPNSEKLQMMRIVIREDFSMHRCDSLLQDFKLA
FT                   IESLDAMDKSMLDKYKTHMKNHRNHPRHQSRVHAHYMNEKHSLQGQTGKTHGVC"
FT   CDS_pept        join(227884..228056,228104..228134,228182..228312,
FT                   228361..228622,228700..229134)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000079046" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127067"
FT                   /orf_name="Pc22g00980"
FT                   /product="Pc22g00980 protein"
FT                   /protein_id="CAP97386.1"
FT                   /db_xref="UniParc:UPI0001832400"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPN3"
FT                   /transl_table=1
FT                   /translation="MERISIDLRGNNPPTRDLPPSTSTPAHLPPAKAMKLHPSKPGDEN
FT                   AAVFFVGTATTIIEWAGIRIMTDPNFLHAGDHVHLGPGVSSKRLTDPAIDLHDLPQIDL
FT                   VLLSHYHEDHFDKKVEASLRRDLPIITTPHAAQHLTSQKKDPFTSVSALDPFEQIEVNI
FT                   EGTEEPEQPRLRVTGMPGKHVPPNTVVEKLNELASAVPPTNGWMLELGHGRPNTADFSC
FT                   GYRIYISGDTLLVDELQEIPRRYAGQRIDLMLAHLGGTTIPSPLVGRLMEPLALMVTMD
FT                   AEQGLKLIQLIRPDVTIPIHYDDYDVFASPLEDFKRMVEAAGLLDKVVFLDRKEQYRFR
FT                   VMK"
FT   CDS_pept        join(229865..230849,230900..231984)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670041"
FT                   /orf_name="Pc22g00990"
FT                   /product="Pc22g00990 protein"
FT                   /protein_id="CAP97387.1"
FT                   /db_xref="UniParc:UPI0001832401"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPN4"
FT                   /transl_table=1
FT                   /translation="MRNLFKSRSPSNRTSHHSMRSDEQLARPAFAPPDPNIAADSDRRL
FT                   SQFEYSVGSVQNQPQTLNRSQSQRHKPLRDRPTVNIVTPDDSHRKKGRIERSASVKGKT
FT                   ISLPISQPTSPGTLHPETLDESDEFHPHRHSNAENPSPLTTPSLAHQQQYPAQRGPRPS
FT                   HPAHAQDNSGWSQQRLQPLYTKLQRSTTDSTLLEQYVRPSPTDIAPESPRYASEHLHRG
FT                   QAFPPPQDPVLNTRPPSQQTHEPLSPLQSIYPDAMQSSAQESQNQSQFHQLDRQRSTGS
FT                   PQQNRSRQGSVSNNMPDPGRSTPTNTHRREDSGEVDVRALIQKHDELQAKYSKVKRYYF
FT                   EKDAQVQHLQNTVAHQRMAVSRTVLDDNEYTSRFQRLDGAIKDLAFSVRKDWRSIPSWL
FT                   NGMVTDDALSVGTKEMTAVGRAVISQWLVEEVFQRYFHPSLEPAFSVQLKNIEMNLRRQ
FT                   RPSSDEDRENASARLSYWRRTTFDGLSDSLAGPEAQKHRAELVEHLIVELAAFMGSQLH
FT                   ETALPGLEASVRMIIENSINITEKIPLEARDVCVDYFPPGISLAEQYMKVEGQLPALSH
FT                   PPPPPSDQEQLEEPAAVEGDASSGSTAGVIENASPAQQKPTKKSIFGALISRKHASGET
FT                   SRPAPAPGPAEDKSEPTDVAPSNPRIRFAAFLAVEVRGKGPATVLIKSPVWLVE"
FT   CDS_pept        join(complement(233296..233769),complement(232926..233232),
FT                   complement(232600..232739),complement(232399..232563))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000256365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941341"
FT                   /orf_name="Pc22g01000"
FT                   /product="Pc22g01000 protein"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="CAP97388.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniParc:UPI0001832402"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPN5"
FT                   /transl_table=1
FT                   /translation="MPSLTVAVAQSRTHDSLTETLRALERTTALAARRGVHLLLFPEAY
FT                   LGGYPRTCSFGSAVGGRHPRGRDQFLAYFKASVDLGDTPAGAGDDWIGRRLEIAEGKRF
FT                   RGDGTREFLERVARETGVFIVTGLVERAGGSLYCAVVYVDPARGVLGKRRKVMPTGAER
FT                   MIWAQGSPSTLRAVTTTLNGIPLTIASAICWENYMPLLRQSLYSQNVNIYLAPTADARS
FT                   TWLPLMRTVGIEGRCFVLSANQCVRGSELPEWITGENTDSLAPSSSVRDYVCRGGSCIV
FT                   SPLGEVLAGPLWEVCTDDVPDSSDAASSPTVAAGDGLAIACIDLDDCERGRLDLDVAGS
FT                   YSRSDTFKFEVEGLDLAPPPL"
FT   CDS_pept        join(complement(234697..234781),complement(233987..234600))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127068"
FT                   /orf_name="Pc22g01010"
FT                   /product="Pc22g01010 protein"
FT                   /function="binding"
FT                   /function="pyrroline-5-carboxylate reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline biosynthetic process "
FT                   /protein_id="CAP97389.1"
FT                   /db_xref="GO:0004735"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001832403"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPN6"
FT                   /transl_table=1
FT                   /translation="MSRPHRFCTTESSTTIYSSNRKSNLRNYPTANADAILFAFPVDQI
FT                   QRILGAVEMREALKHKIIISILAQTPSTEISRLLGDHQTSGNENTQIIRAMPTIGTEIH
FT                   ESATPIAEPSSKATEAMELASWIFNLVGKVFHVSDSYFDTVTGMSAFCNALTTVAIQAV
FT                   AQKAVAEGVPVHHAIAISSQCIRGTASMSLEGTPPEQLKQSLSARGLLELVDSELTRAI
FT                   SIAKKAKNRT"
FT   CDS_pept        join(complement(237446..237856),complement(236034..237392))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217625" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941342"
FT                   /orf_name="Pc22g01020"
FT                   /product="Pc22g01020 protein"
FT                   /function="sulfuric ester hydrolase activity"
FT                   /protein_id="CAP97390.1"
FT                   /db_xref="GO:0008484"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI0001832404"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPN7"
FT                   /transl_table=1
FT                   /translation="MATKKPNILYIMADQMAAPLLSLHDKNSPIKTPNLDRLAEGGVVF
FT                   DSAYCNSPLCAPSRFVMVSGQLPSKIGAYDNAADLPADTPTYAHYLRREGYHTALAGKM
FT                   HFCGPDQLHGYEQRLTSDIYPGDYGWSVNWDEPDIRADWYHNMSSVMEAGPVVRTNQLD
FT                   FDEEVIYKSTQYLYDHVRQRNEQPFCLTVSMTHPHDPYAMTKEFWDLYNDVEIPLPKNG
FT                   AIPHDQQDAHSQRVLKCIDLFNKEMPDERIRAARRAYYAACTYVDTNVGKLLRVLENTG
FT                   MADDTIIVFTGDHGDMLGERGLWYKMTWFENSARVPFLVHAPKHFAPKRVSENVSTMDL
FT                   LPTFAELAGAKLISELPLDGVSLVPYLTGGEGLRTDTVYGEYMGEGTQAPLMMIRRGRW
FT                   KFIYSTIDPPMLYDLVNDPEERTNLAAGLPIPSSSTRAAVAKPTNLASSINLPTPDETP
FT                   HASPIPQRANIADYPFPSNTPPRTPSPAKVPLAVPNTTEPAKILAFFLEETHARWDLEK
FT                   IHQDVLSSQRRRRLVYSALIQGTQTVWDYEPRIDPSTQYVRNQGKGALDDVELISRWPR
FT                   VLQQAAAAHGMSV"
FT   CDS_pept        join(238784..238905,239046..239171,239250..239483,
FT                   239709..239797,239874..239933,240063..240178)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941343"
FT                   /orf_name="Pc22g01030"
FT                   /product="Putative uncharacterized protein Pc22g01030 "
FT                   /protein_id="CAP97391.1"
FT                   /db_xref="UniParc:UPI0001832405"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPN8"
FT                   /transl_table=1
FT                   /translation="MSGDLIQSLASVQFTRALDPGVGNGIESPRPWQRFRCDRILRGLG
FT                   AEVPLAYLNSQSDCIIGHYRGGKRDDVRIQDSDGGARRNKDETRRGNLMYHSSTMSNPP
FT                   FRARHEERSKIIPGFTIGIYFGGKTQSPLFLSIGTCVSMHRDCYMSDVLHMATSTSTGS
FT                   TYRVCAAQIFTSVAAEVATVDGIPNQDVFMSAMPDARCLRDLAEARPPSCDLPDVGSLY
FT                   SWQPEEKMCPAAYGALGMPGQPYLID"
FT   CDS_pept        join(complement(243029..243113),complement(241612..242963),
FT                   complement(241108..241560),complement(240837..241057),
FT                   complement(240218..240368))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216679" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941344"
FT                   /orf_name="Pc22g01040"
FT                   /product="Pc22g01040 protein"
FT                   /function="sodium:amino acid symporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97392.1"
FT                   /db_xref="GO:0005283"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="InterPro:IPR004240"
FT                   /db_xref="UniParc:UPI00018324C9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPN9"
FT                   /transl_table=1
FT                   /translation="MAFAQFCSRQWALWLLLLVSCAGAFYIPGYSVTRYNDGDPIPLLV
FT                   NKIFSDHTQLQYAYFDLPFVCPPSGKKHGGSPFGSGQSISLNIGEVLRGDRIMTSDFEV
FT                   TMGKDVECQSLCTREVSRSDVKWARQLVKEGYVIEWIADNLPGATSFVTVDRSRKYYAS
FT                   GFKLGYRDISPITGQHRYFINNHFTIVIRWRSVPEGGKVVVGFEVYPKSITAEDRQENG
FT                   CPKAVHNNNEGLGLYIAPNLSRMQEKYSGLSYIPDDDDDDDGATLKVPYTYSVYFREEP
FT                   NVEWANRWDLYFTNQGESSITHWLAIINSLTICTVLGVTVFVIWSRTVQGDLKGRGDGA
FT                   MDDRKMKGQSRRRNRKSGEKKGEGLLDDSADVERDADYSSDDEALEDTSGWKLLHGDVF
FT                   RVPAYSGLLAPLVGSGMQLLFMASGLLLLSCLGVLNPSFRGGFVSVGMGLFVFAGLFSG
FT                   YFSGRLYQTFGGTAWRKNTLITALLFPGLAFCLVLILNLFVWAQASSTAIPFSTLIGLL
FT                   ALWLLIQVPLVYIGSWVGYVRATPWEHPLKTNAIARQVPPQPWYLRSPLGPVVTGVIPF
FT                   AVLFIELLFLFKNLWQDKSGYYYVFGFLSVVSTVLIITVVEVTVIATYSQLCSENYHWW
FT                   WQSFLTGGSSAFWIFAYCIWYYLFKLHISGFVSSLLFFSYSFLACAVYGLLTGTVGFLA
FT                   AYAFVRRVYSKIKGQSSTYIASTSIVKPTYPRKAGGQGTCKWPLPFLFSNFYQMPHLCI
FT                   "
FT   mat_peptide     join(complement(243029..243041),complement(241612..242963),
FT                   complement(241108..241560),complement(240837..241057),
FT                   complement(240221..240368))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPN9 "
FT   sig_peptide     complement(243042..243113)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPN9 "
FT   CDS_pept        join(243181..243424,243502..243628,243902..243989)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127069"
FT                   /orf_name="Pc22g01050"
FT                   /product="Putative uncharacterized protein Pc22g01050 "
FT                   /protein_id="CAP97393.1"
FT                   /db_xref="UniParc:UPI00018324CA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPP0"
FT                   /transl_table=1
FT                   /translation="MYTKYGGLYVGGLRCVDPQRLIEQSEPRMTTVVGSISFRRFFVER
FT                   IDGQFDGGLDVGCTCWMIDCEGSPDCFSSPGTCRRTACNSEAVPGLQRGPGLPNQNAMR
FT                   RTALEGTRSIDGQKALKKGCHIYYLGKDLTPPLVNVGLGGSGRRIHLS"
FT   CDS_pept        join(complement(245515..245982),complement(244514..245437))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216678" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822802"
FT                   /orf_name="Pc22g01060"
FT                   /product="Pc22g01060 protein"
FT                   /protein_id="CAP97394.1"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI00018324CB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPP1"
FT                   /transl_table=1
FT                   /translation="MADETATTEQAPVTFTVKSSTDAKYTLTLPLTTLVSDLKQKLSSP
FT                   EYADTPAERQRLIYSGRVLKDTETLEAYKIKDGHTIHLVKSAASNQQRQNTAAQPSSAA
FT                   AGAGATPSPAAAGVPTNLAAGTGNNPLAGLTGARYAGFAQLPGAGLFGPDGGMGPPPDT
FT                   ESMLNMLENPQFQSSINEALQNPAMIDMMIQQNPMLRDMGPGVRQMMESPEFRRMLTDP
FT                   SSIRQMMQMQRAMGMGGGPGGGDNAFPAPGVTNTTPGSEQQNAQTNPFGQQNPLGNTNP
FT                   FGALFGANPFGAPAQPSATPGATQPGGAAGADSTDRSTSAEGQTPQAAQNPFASLLNPA
FT                   MFGNAGQAGQGGMNPFNPQQNPFLRDPALLSQMMQGMGGQGAEGGAAGANPLAALLGGG
FT                   GLGGFGGGFGAPQPTDTRPPEDRYADQLRQLNDMGFFEFERNIEALRRAGGSVQGAVEY
FT                   LLSHP"
FT   CDS_pept        join(246483..246726,246923..248996,249181..250465,
FT                   250521..250547)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216677" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127070"
FT                   /orf_name="Pc22g01070"
FT                   /product="Pc22g01070 protein"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97395.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00018324CC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPP2"
FT                   /transl_table=1
FT                   /translation="MATTSHMFMYSLTIQPPTAITQAILGQFAGTRDQQIVTASGSKLT
FT                   IHRPDPAQGKITPLFSQDVFGIIRSLAAFRVAGSSKDYIIIGSDSGRITIVEYVPSQNR
FT                   FNRIHMETFGKSGVRRVVPGQYLAVDPKGRACLIASVEKNKLVYVLNRNSQAELTISSP
FT                   LEAHKPQNLVFAMICLDVGYDNPVFAALEVDYSEADQDPTGQAYEEIEKVLVYYELDLG
FT                   LNHVVRKWSDPVDRTASMLFQVPGGDDGPSGVLVCAEDNVTYRHSNQGAFRVPIPRRSG
FT                   ATENPERKRSIVSGVMHKMRGAFFFLLQTEDGDLFKLNLEMVEDKQGKPTGEVKRLTIK
FT                   YFDTIPVSTNLLILKSGFLYAASESGNHNFYQFEKLGDDPSEAFFSSDSFSADPSVPLT
FT                   PIYFHPRGAENVNLMESMNSLSPLIDSKILNLSEDDAPQIYTICGSGARSTFRTLKHGL
FT                   EVSEIVESDLQQVPSAVWTTKLTRGDEFHTYIILSFANGTLVLSIGEIVEEVSDTGFLS
FT                   SAPTLAVQQLGEDSLVQVHPRGIRHILADQRVNEWPAPQHRSIVAAAANERQVAVALSS
FT                   GEIVYFEMDADGTLAEYDERRQMSGTVTSLSMGEVPEGRMRSSFLAVGCDDSTVRILSL
FT                   NPDSTLENKSVQALTSAPSALQIMAMADSSSGGTTLYLHIGLYSGVYLRTVLDEVTGEL
FT                   SDTRTRFIGAKPVKLSQVSVKGQTAVLALSTRPWLGYSDVQTKSFMLTPLDYVGLEWGW
FT                   NFSSEQCVEGMIGIQGRSLRIFTVEKLDNNMLQESIPLSYTPRRFVKHPEQPLFYVIES
FT                   DNNVLSPATRQRLIDDSQAQNGEATDLPPADFGYPRATGHWASCIQVVEPITTKSVIFN
FT                   LDLEDNEAAVSLAAVSFSSQDDETFLVVGTAKDMTVSPPSSSCGFIHIYRFQEDGRELE
FT                   FIHKTQVDEPPLALLGFQGRLLAGIGPILRVYDLGMKQLLRKCQAPVVPKTIVGLQTQG
FT                   SRIIVSDVRESVTYVVYKYQDNVLIPFADDSIARWTSSTTMVDYETTAGGDKFGNLWLV
FT                   RCPSKVSEQADEDGSGAHLIHEKGYLHGTPHRLELMVHFYAQDIPTSLHKTQLVAGGRD
FT                   IVVWTGFQGTIGMFVPFASREDVDFFQLLETQLASQQPPLAGRDHLMYRGYYAPVKGVI
FT                   DGDLCEMYLLLPNDTKLMIAGELDRSVREIERKISDMRTRVAY"
FT   ncRNA           250736..250922
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR36"
FT                   /db_xref="Rfam:RF01242"
FT   CDS_pept        join(252420..252627,252681..253978)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941345"
FT                   /orf_name="Pc22g01080"
FT                   /product="Pc22g01080 protein"
FT                   /protein_id="CAP97396.1"
FT                   /db_xref="UniParc:UPI00018324CD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPP3"
FT                   /transl_table=1
FT                   /translation="MSTATSIISSGSDKLDAWTRRSQPKIEIHLAGQKPGHVNSYTTGE
FT                   SIDGSITVTVDHETRFDEIEIAFEGVSRTTVERASCPGRTGSQQMFLKLRQPIDEMEYP
FT                   TPRVLESGRSYEYPFTFVVPDCLLPQVCTHAKKNAHIQRSHTMLPPTLGDPILASNGKT
FT                   LLDDMAPSMSQIAYTVRASVLQKQLTGHGFVAIAAIAKKVRIIPTVEEEPPVEISGSPS
FT                   LCTRKEKSVKRGTLRGKLGRIVASSSQPKPIQLLPLAGEPTDTVSTVATVNLRFDPVGD
FT                   EQPPPLGTMTSKLRANTFFSAAPWEDFPSTTGMPFAHIGCGLYTESVPLMTMCVASAQW
FT                   TKQSSAADSMRRDSTDSSSSSNSSTGPSSAFSGDTYYTASVVVPVTLPKSKAFVPTFHS
FT                   CLMSRVYALDLCLTYHTPAANLMTPTISLRLPVQFTSQAKCAEPIKTTLGVTVTQQELE
FT                   EFFHPRNVTSPTDFSTHTRSDVVDVGLAPPEYSERLSAVRASR"
FT   CDS_pept        254952..255365
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234838" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127071"
FT                   /orf_name="Pc22g01090"
FT                   /product="Pc22g01090 protein"
FT                   /protein_id="CAP97397.1"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI00018324CE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPP4"
FT                   /transl_table=1
FT                   /translation="MPVKMLVFLYRNPRLSPEEFKKYYEAHVKLVKKLAGGDFPLSHHR
FT                   NYIARTTVEIPPDDSTARNAFTPATILRGRQPDFDFDAYAELTFADQAAYQAFAAKIYA
FT                   PDAAAQITADEDKFLDRLKQGVVLVGEVRVTVR"
FT   CDS_pept        join(256360..256800,256925..257299,257362..257421,
FT                   257471..257540,257591..258126,258181..258282)
FT                   /pseudo
FT                   /gene_family="HOG000169884" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(261464..261705),complement(261221..261318),
FT                   complement(261107..261170),complement(260999..261056),
FT                   complement(260757..260943),complement(260601..260700),
FT                   complement(260471..260554),complement(260229..260415),
FT                   complement(260122..260172),complement(259896..260066),
FT                   complement(259524..259842),complement(258944..259461),
FT                   complement(258637..258882))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000106394" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941346"
FT                   /orf_name="Pc22g01110"
FT                   /product="Pc22g01110 protein"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP97399.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniParc:UPI00018324CF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPP5"
FT                   /transl_table=1
FT                   /translation="MYACDIPSIISSSISLLQPKQSFGRANLVKKHLIADTNQAIVDPI
FT                   SVIPQTCALNLIPVQGLGTLVSQMKHHLSVHGPRSILHARDGISSVQPPLSQAVGYVVV
FT                   VVIGVIIALVMMLITKVLKRTTGEDNEKTEMFMTANRTVRTGLTASAVISSWLWSTALL
FT                   GSSFVGYDYGVAGPFWFAAGCSPMIVFFALLGISCKRKIPEAHTSLEVVRIRYGHVAHI
FT                   VFMILCLVNNIFACANMLLGAAAVITAVTGMHIIAATFLLPVGVTLYTFVGGIKATFLT
FT                   DYFHTAIIMIIACYFSVKAFSTNQIGSVGELFDLVQAAAQRHPVSGNQDGTYLTMTSKS
FT                   AILFGILHTLGNFGLVVMDTSYFIKAFSASAAAVVPGYTIGGIAYFAIPWGLGTVMSSV
FT                   ALGLENTPTFPTFPRRMTTTEVSNGLVLPYAAITIAGKGGAAAVLLITFMACTSTLSAQ
FT                   VIAVSSILSFDVYREYFKKKATDRDLIRASHFGVIFFAVFSAAFSTMLHYVGINLGWTL
FT                   YMLGVVTCPGIFPMIFTILWRRQSKAAAILSPVLGLATGMAVWLGTASHFGGEVSVAST
FT                   GEVLPCVYGTVASCLSPIVYSVLITLVRPQDYDWDDFKKVKLSLEKLDSDLTTAHRHQA
FT                   SSRGDDGSVEDGGRGSGDQKELKRWGRIAAFWAVATFLGHWVIWPLPMYGSGYIFGKKF
FT                   YIAWVVVAIVWLWLSTLVAIFYPIFDGGVAQIRDVYRGLRQHKIVEGTGSSKDGKGGSS
FT                   SPSVGSVSDVSHAGEPQENKS"
FT   CDS_pept        join(262286..262358,262413..262553,262615..262825,
FT                   262883..262895,262958..263017,263072..263628,
FT                   263691..263868,263932..264159)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941347"
FT                   /orf_name="Pc22g01120"
FT                   /product="Pc22g01120 protein"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAP97400.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016048"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="UniParc:UPI00018324D0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HNZ7"
FT                   /transl_table=1
FT                   /translation="MSNTQASDATKPRKSLILNAFVEMCSGHQSPGLWRHPEDESHRFN
FT                   DVDHWVELAQLLESAKFHGIFIADVLGGYDVYKGPRNLDPAVVSGAQWPVNEPLAVVPA
FT                   MAAATKNIGFGVTVTTSYEQPYHLARRLSTVDHLTKGRLGWNVVTGYLDSAARNMGQAE
FT                   QLHHDDRYLLAEEYIKVTYKLWESSWRQDAVTLDRERGIYTDPAGVRQINHVGKYFNVP
FT                   GPHLCQPSPQRTPVILQAGTSKAGKTFAAQHAEAIFVAGHSPAVVAKNVKEIRELAQSE
FT                   YGRDPQSIKFLALLCPILGKTEEEAVEKFKYFRSLGSIDGALALFGGWTGIDLDKYGDD
FT                   EELRHVESNAIRSAVEGWSKATPEVAKWTKATVGQHITVGGLGATPVGTAAQVADNMER
FT                   WVQEADVDGFNLAYAIKPGSFKDIIDLLIPELRKRGLFWDDYAVPKGTYRENLYTQPGQ
FT                   SGPRADHPASKYRWNAGVDAAEAVIPDN"
FT   CDS_pept        join(complement(269555..269931),complement(265035..269484),
FT                   complement(264837..264978),complement(264332..264774))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048282" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941348"
FT                   /orf_name="Pc22g01130"
FT                   /product="Pc22g01130 protein"
FT                   /function="binding"
FT                   /protein_id="CAP97401.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012954"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR022125"
FT                   /db_xref="UniParc:UPI00018324D1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HNZ8"
FT                   /transl_table=1
FT                   /translation="MASSLAAQLSQIAAKSTHELDLKAQRVSHSQSLIFDPKVAGTQDF
FT                   DAIYDICYDGFRELCSLDPRFAEFDRTIFSEQSKAEDRSQMNVLQNKELDTAVEAFLAL
FT                   VSGRLQLSPAVKAVDWLVRRFRIHEFNTTAVLLTFLPYHTTPLFLNLLSILPATLTPAF
FT                   KVLAPYKNGLINPPRHPLVHSAATNKAFFSEFNEYVLKVCRQQAQSHALLAFWAGVVTE
FT                   AIATMLDGARSGRREAEKQKHEDILLRILPVLSNAFTMKKVSELIVGCYMICVVLAQKA
FT                   FLSNEVIDGLMESVVGSWTEDTKISGLICLSVLAQQKPAVAVPKKVFKGIVRLENPIAQ
FT                   LSEIAPQYQTSNLLLGIIAGCLTDLDKQDNARLAILASIFERKMLGENEIAKAMSLVLE
FT                   AASNADETRGMSLDAQTQLAELVQGFNRSETLQPIFQRTLTGSSFNISALEHNLQTVVE
FT                   APVVAQAIEDVDMIDADDQPQVDAFTPALETLVKESLFPRSFLSRQSIIEFDNLVRVFA
FT                   LAVDSEDNLERFTTLPILGKSQATKAPQYLSFFIRVLVGHYPIGTKIAALNVVSSVLSS
FT                   APADFDPQALLPFLFVALSDPSERIRRETAGVLAIIGFLYKKNNGGDSSKPWAHDTIYG
FT                   KGKQSTGVAWLTTKDAQKVLERALLPGLEESILDSNHVRRTVEATLRGNVLSETSGATE
FT                   LKKSLRLSLFAFICSHVVNMPVFAPKTSLLRLINSVEKVSTATLTSELLPVLEDWRRLN
FT                   EREVEEICGKERIVASETENLIAAIVTSKDKDAVDVLLSNASSGDNLRPSFVAACFGQI
FT                   KHIWAKIPEDRKLAASEKLLDISLSGSANTASLANNCRDVLRTVELPGVVLQQFVQKIP
FT                   VSITDVESVGPAPKRRRTSQNNMVAMTVKDEAELSKLMDKMTFILEIVDSSSPETHPEL
FT                   VDGLFQTLAALHHFKSQIQSGMSYLLSLTLGSLLAIVNTSKGSAKPKFDTSVIRADLVV
FT                   DCVRTTDSPQVQNGALLLVGSLSVIAPELVLHSVMPIFTFMGSSVLRKDDDYSVSVIDQ
FT                   TIDQVVPALIQSLRNQKRDVVSGTSELLLSFTAAFEHIPSHRRLRLFHALISKLGTQEF
FT                   LFAVLAMLANRYSADKDVLTLMTGLVSDTTPVVELTTYSKYLNLVSDSLKPKPGISQVL
FT                   LGIGSDDGRDAQSICVDLLRDLAHLFKHSSLKSKLETAFESDDQVADQSRACFSRVLTQ
FT                   VLSIGEAVQSMKPVNQACGEVLGSLFSTLSLVDFLDTIEVLLQGPNDELRRKVLRLLET
FT                   RLRQNPERDNLSQIRVLDFLPTLVGIVESSPDILLKHAAVSCIDRITDKYGRKDPSKVI
FT                   AAARVVASESCLGQSDDRIRYMGVLCLASMAEVLGQAMIPALPDTLKRSLGLLELSLVS
FT                   GKENSRLHDAVFALFSALFVHLPFMISAGHLDKMLLLSFESANADIEESSDESRQECLR
FT                   LMARKADVGATLGAVDRNWQHAIQAGPIAVNEILEVVTIAVDKNPKSTIAKNIGVLTKI
FT                   LFKAFDLRREQIALGDKAIFESTAIDEAEAALNDVTIKMIYKLNDSTFRPIFLKFVEWA
FT                   TTGSSQDEQARISRLTTFYKFLEVFFGTLQSIVTGYSSYVLENVVSVLNTSGPSKTQKS
FT                   LWLAALRMLRKSFEHDQDEFWQSPSHLASISGPLIAQLGHATSTTTSNMVIADVVPTIT
FT                   ELAIAADSTDNHKELNSALMKYLRPSSAPNARSAGGDSPHTRLAALKTEQALTEQLGEE
FT                   WLALLPEMLPYISELMEDEDESVEREVRKWVKQIEKVLGERLDDMLT"
FT   CDS_pept        join(270237..270257,270312..272690,272750..273691)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216671" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976012"
FT                   /orf_name="Pc22g01140"
FT                   /product="Pc22g01140 protein"
FT                   /function="binding"
FT                   /protein_id="CAP97402.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013633"
FT                   /db_xref="UniParc:UPI00018325A8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HNZ9"
FT                   /transl_table=1
FT                   /translation="MDSPGSQGVPQFSSFRPPPTSPPAGVAGSQHERHRRRRLGHRQRA
FT                   DSKGSPLPRHHGRRSEGGRQKATGEESEKRPSGEKIKDVNAANGEANKTFVVDKRGDRD
FT                   NTRYGVDRYEIPTYHRNGDGFVLGLPGQRIDYKTRYDQGALLLLRPDSSSSTSSTTKPL
FT                   SAETLSALSISLPVRLRSDLKANVATETQHSQGFISTTVPSQPGVAATADLDDEAPSYR
FT                   SIHDPAKSGEQVTEHIDTSAFTRIAMEAEILKINAKLNSAVEKRPTDIQSWIRLAEHQE
FT                   LALTGARSGDRTSSHDDAQVVARAKLYVYERALKANAQNPARDHLVLCRMEEGGKIWDD
FT                   AKLALEWDEVLRYHSEFITVWIQYLDYCQTDSRDFNFNDCFTTYGYCLKTHSRVGFGPQ
FT                   KSLIRAYLLLRLTLFLRESGHVELAVGLWQAVLEFTCFRPAHLMGKKEEALVEFKKLWA
FT                   PGHIRIGEPGWQPWNSGQTSRVPAAEPVYTSEADALGLFPTWVHAERERMFKNRMPSHA
FT                   FDDSKKKDAFRVVLIEDCTQILPYFWDLEEGLGSLLDGFLYFCRLPHLTVPANMHTSRL
FT                   WTGDNFLRNEFMDDPRNTIADWITFQKHAATTTIEPFAFPHHTFVHTTDTLFADPKMWF
FT                   SALTKWAATTSHSSCVIDPDFVLSTLHSLVDAFGDSQLAEYAMAVTFACNNTLGKKYGR
FT                   RLLKERSSNLRLYNAVALMYWRSGDRDVAYNVWSTALSMSKNFDARELTDSALLWNSWL
FT                   WEMLHDGQKNRASYLLQAMPYRQVHLPSYNAAGEDDDLGLTGPNFLSYLFNAMNTALRS
FT                   KRMQAYAAYADCYAILLYLKGEQLDDVLDSYNHAVSSLRGMRRTDDDFRVLGGELLHQA
FT                   RARILYYYVERQSGQFRPAEVRALFLDSLEWWPHNTMFLSLFKWNESRLHMSDRTRDIF
FT                   DVTIGANGRAAKDLQGPAPIYRVPVTTHLFSIYAEMGRPLMLGSTPHSIRAAFERAIGD
FT                   VIPMGRTATRKSPFDLASSTSAQTSLTIWKLYILYELYAECNVGRAREVYFRALRSCPW
FT                   SKELYMFGFEHLRADLTNRLPPCRLNRKGEVEPLGFDHAALRALYSDMLRRGLRVHCHV
FT                   EGFWAE"
FT   CDS_pept        complement(274427..275773)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976013"
FT                   /orf_name="Pc22g01150"
FT                   /product="Pc22g01150 protein"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAP97403.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016048"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="UniParc:UPI00018325A9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP00"
FT                   /transl_table=1
FT                   /translation="MTDSQPNRQLHLTAFMRPVSLHTGAWRYPGSYPDANFNFKHITQF
FT                   AQKLEAAKFDAFFMADHLAVLNMPVEALKRSHTVTSFEPFTLLSALSAVTEKIGLAATA
FT                   STTYDAPYHVARRFASLDHLSGGRAAWNIVTTGNPESSHNFGFDEHLAHGDRYKRAREF
FT                   YDIVTGLWDSFADDAFIRNVETGEYFDPARMHVLNHSGDELKVRGPLNIARPPQGWPVI
FT                   VQAGQSEPGRQLAAETAEVVFCSPKDIDSAKALYADIKGRVERAGRKRGQLKILPAAMI
FT                   IVGDSKQDAREKRLKLDSLVHYDSAIASLSISLGVDVSGLDPNSLLADDLPETNASKTS
FT                   RESVEKLAKQEGLTIRQLAQRYGGYSGLTFLGSPSDIAEEMGTWLRGEASDGFTCTFPF
FT                   LPQGLEEVTDRLIPELQRRGLFRNEYTGSTLREHFGLSRPENRFFTEES"
FT   CDS_pept        join(276094..276242,276310..276408,276559..276724)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127072"
FT                   /orf_name="Pc22g01160"
FT                   /product="Pc22g01160 protein"
FT                   /protein_id="CAP97404.1"
FT                   /db_xref="UniParc:UPI00018325AA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP01"
FT                   /transl_table=1
FT                   /translation="MRKPPDSIAQFCSPRGLCFIASYPLTTSRNAKRNRPDTSRLALFS
FT                   ESESHDDAVAGTELMSEIKEKMGDLWPDKGFIEYEAIRLRGGYLGGKLDASVEVYAFSA
FT                   VIVRNTAQQKHHCPHRSNIWCQLVSTKYIYTLS"
FT   CDS_pept        join(complement(278218..278385),complement(278035..278161),
FT                   complement(277867..277990),complement(277334..277800),
FT                   complement(276941..277263))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166235" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941349"
FT                   /orf_name="Pc22g01170"
FT                   /product="Pc22g01170 protein"
FT                   /function="O-methyltransferase activity"
FT                   /protein_id="CAP97405.1"
FT                   /db_xref="GO:0008171"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="UniParc:UPI00018325AB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP02"
FT                   /transl_table=1
FT                   /translation="METKHLQRLLAEAKASLDSYESTQTDTCRVEAQEKAAQLARALER
FT                   PKDAILKLSFSPIILMAVKTAHDMNVFPVLSQATGPVPLAELAAAKPADPLLVERIMRV
FT                   LVANGFVEESAPSEYLSTALCREMTERTSIGVVGSLFHEFLPSVQKVPEYLQSTNYRNP
FT                   DDPMWAPLQYTHDLKIDGFTWLCQDPEALTRFNSFMEGQRADRPHWGDWFPVREKLLDH
FT                   AEITPDTPLLVDLGAGRGHDLIGFRQRFPDAPGKLVLEDLSSVIDEVRGAQDLEAASID
FT                   TVAHDFFAEVQPVQGARAYYFKNVLHDWSDEKATIIFNHLKPAMKRGFSKVIMEEYILP
FT                   DQNARSLPCMTDIAVMVFCSGLERTRQRWSDLLTSVGLRVLKFWVREGDGLGIIEAELA
FT                   ETC"
FT   CDS_pept        join(279426..279563,279613..279655,279706..279830,
FT                   279931..280067,280234..280777)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941350"
FT                   /orf_name="Pc22g01180"
FT                   /product="Pc22g01180 protein"
FT                   /protein_id="CAP97406.1"
FT                   /db_xref="UniParc:UPI00018325AC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP03"
FT                   /transl_table=1
FT                   /translation="MAYNVSAELFAEWAIGLVIIAVRLYARWKVGKGKFYWDDLCLVLA
FT                   TIFWTMHTVFLYLCTDVYGSNIGLNEKTAMEVPDSQVATLRTGSIDAFVAWVSYVFMNG
FT                   SLAAPLDYDRRSLVYLHIPRVVVFPRLYLPPSTQELANQAICWRTDIAVLTIPIPLIIA
FT                   ARIPISQKLLLCILFSSGIFVMIAGFLRAYYSVKDISELSTALGWASREALVSVITICA
FT                   PGIKLLISNSRWFSTNGSSNHISQTPKGSNLFTSKSRGGDNKHPYELSSMAWGKSRRDS
FT                   TGESQQHIVVDTNRSGRGSFDDYKEGIAVTTDVTVSEETRSRNEGHA"
FT   CDS_pept        join(complement(283059..283168),complement(282750..283004),
FT                   complement(282287..282696),complement(281339..282228))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216669" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941351"
FT                   /orf_name="Pc22g01190"
FT                   /product="Pc22g01190 protein"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97407.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI00018325AD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP04"
FT                   /transl_table=1
FT                   /translation="MAPAQASWWNKSELTVSKVLFHLFFWGSHIGIFAVGWYLQASNPK
FT                   LELLNRLSYSVWISRGAGLVLSVDCTLILFPMCRNILRWLRPQIRWLPLDESAWFHRQI
FT                   AYAMLVFTAIHTASHYVNFYNIEQEQIRPELAVEIHFARASGITGHVMLLCMMLMYTTA
FT                   HHRIRQQAYETFWYAHHLFIPFMLALYTHATGCFVRDTDHRISPFAGQEFWDHCLGYEG
FT                   WRWELVIGALYLFERLYREIRSRRMTVITKVIRHPYAAMEIQFHKPSMKYKAGQWVFLQ
FT                   VPDVSSTQWHPFTITSCPFDPYLSIHVRQVGDFTRALGDALGCGPAQAKDLEGLDPNGM
FT                   YEVALQNGQTMPAIRVDGPYGAPAEDVFDNEIAVLIGTGIGVTPWASILKNIWHLRSSP
FT                   NPPRRLRRVEFIWVCKDTSSFEWFQALLSSLEAQSASAAVSEGSTEFLRIHTYLTQRLD
FT                   PDTAANIYLNSVGQALDPLTELKSRTNFGRPDFRRLFTAMRHGLLDQSYMTGLQSAGTT
FT                   DIGVYFCGPNTAAMQISDAAKSSSTKDVRFKFWKEHF"
FT   mat_peptide     join(complement(283059..283066),complement(282750..283004),
FT                   complement(282287..282696),complement(281342..282228))
FT                   /db_xref="UniProtKB/TrEMBL:B6HP04 "
FT   sig_peptide     complement(283067..283168)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP04 "
FT   CDS_pept        join(283546..283627,283775..283986,284040..284074,
FT                   284128..284280,284345..284487,284881..285200)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976014"
FT                   /orf_name="Pc22g01200"
FT                   /product="Putative uncharacterized protein Pc22g01200 "
FT                   /protein_id="CAP97408.1"
FT                   /db_xref="UniParc:UPI00018325AE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP05"
FT                   /transl_table=1
FT                   /translation="MWVARLVASAAGVPPGDFLALILSNMRGVGGGRSIITSLLAGTTP
FT                   SNRLTDCGRFLSNKLRSIQAYGVCAFQILLRMGSGKRPRDEVPGLESWSLKSLAFKGLA
FT                   YHAGLQHTNHDTEFIRLKSDHRATFPAMKRVSQRKQTQFDQSYPIWVLAPIMAGLGGLV
FT                   SGREDCEWTALNEAKERELMRYWPIIIHLQALSFRHTGRRGSPSIVHHAKRKLRPLICG
FT                   HPLCDPLRHIPHSPITRPKPVLQEAQEEGVVKDSRTFEPMIGLHYLYPCGSRFSPTLLA
FT                   CVPTPAQRFTFLALDNHILAKCAKFWLSYQRGR"
FT   sig_peptide     join(283546..283627,283775..283794)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP05 "
FT   mat_peptide     join(283795..283986,284040..284074,284128..284280,
FT                   284345..284487,284881..285197)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP05 "
FT   mat_peptide     join(283795..283986,284040..284074,284128..284280,
FT                   284345..284486)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP05 "
FT   CDS_pept        join(285563..285620,285678..285994,286054..286110)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941352"
FT                   /orf_name="Pc22g01210"
FT                   /product="Pc22g01210 protein"
FT                   /protein_id="CAP97409.1"
FT                   /db_xref="UniParc:UPI00018325AF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP06"
FT                   /transl_table=1
FT                   /translation="MGRLIKNHWGRLIILTAAAYQVASAVEGFIWPKVFWDFISRNLDA
FT                   AVAPVPVLQILNLIMGLVGIAWEWPLKPLAGSIPHRSIEIRLIIYPLSALLAALLYQGT
FT                   DPAIYYLIGIGVYFWAYSEGEVVCPEPWTLPKRQGIFKA"
FT   sig_peptide     join(285563..285620,285678..285694)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP06 "
FT   mat_peptide     join(285695..285994,286054..286107)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP06 "
FT   CDS_pept        join(287177..288178,288225..288254)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127073"
FT                   /orf_name="Pc22g01220"
FT                   /product="Pc22g01220 protein"
FT                   /function="hydrolase activity, hydrolyzing N-glycosyl
FT                   compounds"
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAP97410.1"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0016799"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR015637"
FT                   /db_xref="UniParc:UPI00018325B0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP18"
FT                   /transl_table=1
FT                   /translation="MPASTEVQPKLEEDETALETVEDVPVNKMTSFNGRLQQFLHNGTA
FT                   TREALSTSRTTISQRRINTTNERQADPITPSPRRKRTVPPTAPITTATHQRTTRSKSTL
FT                   MATSPSPSKRKRTATPQIPPTPPIAGPPATESLLRDTIPPNLILLLVGVNPGIMTGVTG
FT                   YAYAHPSNLFWKLLYSSGITSVRHIPADTYKLPALYSVGNTNIVERPTRDASMLSRAEM
FT                   DAGVPVLEAKVAAQRPEVVCLVGKSIWEAVWRVRHGRGIRKEEFRYGWQAETENMGRGD
FT                   GWAGAPVFVATTTSGLAAGMKPAEKEAVWAELGSWVVKRRQERGLDSVVVKEEIMSLYH
FT                   KLS"
FT   CDS_pept        join(complement(288949..289112),complement(288772..288895),
FT                   complement(288665..288712))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822803"
FT                   /orf_name="Pc22g01230"
FT                   /product="Pc22g01230 protein"
FT                   /protein_id="CAP97411.1"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="UniParc:UPI00018325B1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP19"
FT                   /transl_table=1
FT                   /translation="MARGNETASKIFYKGSSDDFIVFVDDLDILKKWKNDRSIPLTDVL
FT                   NGWKIFLTRSHGAQGLLDTASQSALQNEFGTTKDDECMIKILEAGEYQPSQAREREGYK
FT                   NESNGTR"
FT   CDS_pept        join(complement(291890..292393),complement(291510..291827),
FT                   complement(291256..291456),complement(290990..291208),
FT                   complement(290709..290934),complement(289706..290655))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216666" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941353"
FT                   /orf_name="Pc22g01240"
FT                   /product="Pc22g01240 protein"
FT                   /function="Rho guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of Rho protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP97412.1"
FT                   /db_xref="GO:0005089"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0035023"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR001331"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI00018325B2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP20"
FT                   /transl_table=1
FT                   /translation="MADQEEAMIEKQALLDHESEEKFESSGGVTPSDKTTPRPFKKWMD
FT                   SFRGRKSESSTSRRHVEGWSDSSSHGSQGHRSSASDSSHLGTVKTTTASIGSQSLIRSR
FT                   TTIQSATNQSTLSDVRHSGDSSRPTSSHQADEAAETRATRRRHILQELVETEADYVLGL
FT                   KALIGILTIFDTRPEIYDNIQEILGIHERFLTQLQTASPLSAPQAQQAGASELMSRGIT
FT                   KRIGSLDLGSLKGLQQRSLRTRSLKASVNQRLMALTAEPAEGLEVARELGKLSLSFPIY
FT                   NKFCSNYELLTQDVALLRRSIANWTIYDQGIEALSKSVASTERRRQEDNKSMTLNDLLI
FT                   KPIQRLCKYPLVLQDLLRSTPVSDCPSSHYGIEEVLDTIRGLVTQINSVTGNPVNKDRI
FT                   QKTIILQGKVDISKSYALQSIYKDLGPLVLCGVLHVTYQTADTTSGEFMVCVLFQRYLL
FT                   FAKGIDDQRRLEAVACVCLTSLKIDTLQNGRGLCPYGCIFSWKLLFENQDENYEFVLSA
FT                   SSAAEEKQWNTDILKVSAALAETAQPRTWEPRKHSFLALPLLPLDQVQYTVSSMARRSS
FT                   MDSVTISRKFRVQHVVIKKTHYPRHTEEPVMQTEGEIERPKTPVDRSALTLTARRIDRI
FT                   RLERLISDVYTADLLPFPGMVLGRGDLFRRGPIMRRLTLRPGITRRSTSVSTFHSKAGS
FT                   TEIRPEEQNEGMDKEAAGSSDIGEDKEIECESPRTPTTPRRSKTFLFKGSPKNPASSVS
FT                   SPLSDKRRSQDGSPEISPSSKKWSSPQKWSSPKNLFSALASKKSKKPRSHAE"
FT   CDS_pept        join(292922..293074,293133..293205,293261..293601,
FT                   293667..293795)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216665" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941354"
FT                   /orf_name="Pc22g01250"
FT                   /product="Pc22g01250 protein"
FT                   /protein_id="CAP97413.1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="UniParc:UPI00018325B3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP21"
FT                   /transl_table=1
FT                   /translation="MDDNIHAPTVASGPASGPTPRDLSKLSMPDLMQEKERIEAELSAL
FT                   SSVLESHGVRMTSSLTTFDGFPRDDIDIAQVRTTRVRIIHLRNDHKEVMKLLEKGIHAH
FT                   FANLQNAQGAGPTMNGTSVPAVAQSPTNNTALGTPFAKVNSVVSGSPAEQAGLKAGDAI
FT                   RSFGHVNWLNHERLSKVAQVVQENEGRAVSVKVCRKDGTDTATELDLQLTPRQNWGGRG
FT                   LLGCHLVPL"
FT   CDS_pept        join(294317..294376,294593..294685,294766..294919,
FT                   294980..295185,295250..295381)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216664" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941355"
FT                   /orf_name="Pc22g01260"
FT                   /product="Pc22g01260 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="nucleocytoplasmic transport "
FT                   /biological_process="signal transduction"
FT                   /protein_id="CAP97414.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006913"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="InterPro:IPR002041"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI00018325B4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP22"
FT                   /transl_table=1
FT                   /translation="MAAETPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVH
FT                   PLNFNTNYGAIQFDVWDTAGQEKFGGLRDGYYINGQCGIIMFDVTSRITYKNVPNWHRD
FT                   LVRVCENIPIVLTGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR
FT                   KLVGNPQLDFVAGIALAPPEVTVDEKQLEAYRKEMEEAANQPLPDEDDADL"
FT   CDS_pept        join(complement(298522..299852),complement(297706..298462),
FT                   complement(296132..297640))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216663" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127074"
FT                   /orf_name="Pc22g01270"
FT                   /product="Pc22g01270 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP97415.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00018325B5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP23"
FT                   /transl_table=1
FT                   /translation="MASAVDQSQEDKIKDLLEDLDTYRYIYDDLLSTRGACAEADELRD
FT                   TIRKMEVQVATLLGDPVPTPQAAPTPQVSSPTPPVRTPAAAPRMASNGFTGIPGDSFAS
FT                   PHWPSAAPSPFASGSRQSTMVPASPILQSSPDNSRKRQRPLSQVSPTIQGSSKRIAPSQ
FT                   PESRRSKLDAIDAEQETRLAENNRLYKQWIDAAGDDADQLQELRDECDEQAKLIETEFQ
FT                   MKRDAELARALQADEDHSQLPIEGFNEQNAWDLPDRTHPVKLEPLSSKAIRTPQTYAPI
FT                   APFNKLTPFSSDDEIQEITADSFNSRSGKQPVRQSSSFNHQNLASPYSTSSYSSQAFNR
FT                   SQLPYPSQLIGSSQMPYPSQLPYPSQLVGSSRMPYPSQMPYPQMPYPSQLSSPSKMSSA
FT                   ATSRVLPWAREPSYAPMPGAYDKFDKSFDLVRNQSEIFDDEADIVAYNEKEFPEDIKNL
FT                   LSGIKDIREATRADNEETPSALRVTLMKHQKIGLRWMKAKEESSHKGGILADDMGLGKT
FT                   IQAIALMVARPFEDEDRRPTLIVAPKALMDQWRLEIQRHVKPGRHQLSVLIYHQRRRPW
FT                   KELKKYDVVITTFGTITAHYKTLLEGERLAQEGRDASLIQDMKNMAGPLNPAAKWHRVI
FT                   VDEAQNIKNPSAKSSQACCRLNSTYRWCLTGTPMMNRLEDFQSLLGFLRIRPYSNPAKF
FT                   KADFVKRIKSGWGGEDVMKQLRVLVKSVCLRRTKTSKIDGEPILQLPPKVTEKVHVVFD
FT                   QRESQVYEELNTSTQRQITRYLDSGTLGRNYSHVLVLLLRLRQACCHPLLMQEFRNEPS
FT                   PSIPGVDKIANAKLLSAAVVQRIKENDDEEDGTCPVCMDSVINATIYIPCGHHVCSECW
FT                   IRISDSAAANGAINLEDDGPTVIKCQNCRGPVDPAKLTDTNSFKQVHDPSSMPESSAGA
FT                   GDINGANEDEDPEATASSDEYDSDSPTEEDDAESKKKSKSKSLAELRKDALKNKAEKKK
FT                   YIRRLEKGWFPSTKITKTLEILQANEDRGLEEKTIIFSQFTSLLDLLEVPLARRGWNHT
FT                   RFDGSMNLKERNAAVTAFTNDPSCKIMLVSLKAGNSGLNLVAASHVIMFDPFWNPYIED
FT                   QAVDRAHRIGQVRNVFVHRLLIENTVEDRIVTLQDQKRELISGALDEGGTMNVSRLDAR
FT                   ELAYLFVCFHIRLFSRCLLLPDPLLTHLLHRV"
FT   CDS_pept        complement(299856..300161)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822804"
FT                   /orf_name="Pc22g01280"
FT                   /product="Putative uncharacterized protein Pc22g01280 "
FT                   /protein_id="CAP97416.1"
FT                   /db_xref="UniParc:UPI00018325B6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP24"
FT                   /transl_table=1
FT                   /translation="MHHDELLLCLLSPRHCAICHHPLSALPFADGNPSFADALSEHFIL
FT                   HPRRPLDLLALLILDFAFCPSRRTHRRHHSATLSTVGIIWSDTLVLEGYMVNARCS"
FT   mat_peptide     complement(299859..300104)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP24 "
FT   sig_peptide     complement(300105..300161)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP24 "
FT   CDS_pept        join(301669..302877,302913..303011)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941356"
FT                   /orf_name="Pc22g01290"
FT                   /product="Pc22g01290 protein"
FT                   /protein_id="CAP97417.1"
FT                   /db_xref="UniParc:UPI000183268A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP25"
FT                   /transl_table=1
FT                   /translation="MVSEQRLVRLWKTKRIQEVLTSHLASKDLISCRLVCRRLAAYLAP
FT                   VLFADIEVRFRSSTFDKPSRMAALERVGVHIQAMTFKISHDRETFLPPILDPITGTEQT
FT                   FIYTPQRCQLGGSSPRYGSRQMTELLVKQYPPLFHASTNIPSFVQALTMMSGLQHLRIS
FT                   CEGQVPSHRYRRSVVDYALISLRMAIEQAPLKDFHTLSLLSVHPGAVLYLGPAPGFGAS
FT                   PASRKRWSQVRKLTVQMSSFGHEPGQPTDHLKLLHAYLGSFPSLQRLVFHWEGERGLSP
FT                   LSLATESSLSSTAKGKPTQAYPQRCALPLRPLKFQHLQQMELVNATMDASQVASFIQEH
FT                   RSSLREFNFENVMLRSGNWDDALAPLTRLSGSERWKQGRRDADTMDVPIVLSPAGVSQK
FT                   QLQKNTAKLGQSGIADTRVAVGEPGSYEAIAAVFGV"
FT   CDS_pept        join(303473..303746,303833..303996)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141680" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941357"
FT                   /orf_name="Pc22g01300"
FT                   /product="Pc22g01300 protein"
FT                   /function="sterol binding"
FT                   /protein_id="CAP97418.1"
FT                   /db_xref="GO:0032934"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="UniParc:UPI000183268B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP26"
FT                   /transl_table=1
FT                   /translation="MSLKKGMRLSPDSTSQKLMKIDSHPSSAAFDVINQTLQANEADRK
FT                   DALGKAKAIFAFNLKNSSGEEAAWYLDLKNKGEVGQGSAPAGDKADVTLSLSDSDFAQL
FT                   VSGKANAQRLFMGGKLKIKGNIMKATKMEPILKKAQGGAKL"
FT   CDS_pept        join(complement(308776..308832),complement(308393..308724),
FT                   complement(307839..308314),complement(305538..307787),
FT                   complement(304161..305485))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185287" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941358"
FT                   /orf_name="Pc22g01310"
FT                   /product="Pc22g01310 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97419.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000183268C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP27"
FT                   /transl_table=1
FT                   /translation="MNQIPLGQGISRPQCDQFWDSHNAWLSPCALPYLASIPAIVVLLI
FT                   ALSHILGYFFHRWRPKWTIPFVSEQHETGELPLDQPKQSLRWTVSLLIFSVTGLLVDTV
FT                   QFVPPRIDPSAFVLVLSWVSSPRLWGSCSISMLAYYILAFAIELSLATHPDECPKFKIV
FT                   ARYIAASAAAAACATIILMPFRESSLSSIDISAVGQQPSNDFRTPEDNVRLWQFLTVSW
FT                   MAPLISLGRKRQLHEQDVWLLGFDFQHSRLHEKFRRLRGSVLSRLLRANGIDVFIISTV
FT                   SLVQMICDFSTPVLLQQLLQAMKDPSRPKRVPLTYAFMSFALRLVAAQSQVLLLWYGRR
FT                   CYERSRGEMIMMVYEKALSRKNISGLMIEGNPGPSDAEANGVNHETPVEESHQPPAKPA
FT                   EGFWQRIVTYNRKAPQKHAKEAASLGKIFNLLRGDVYEVAQRFWEVDSLIDKPLGLVIA
FT                   TFLVWTLFGPSCFLGILAVLVAQIVNALVTRALLRWERVRRVATDTRLQITSQFVEAIR
FT                   HLRWYGWQNHWLQQVMEARQHELNIRIVTSLWSILIRFINAFASGVFPVVALYAYTSLA
FT                   GHELRVDIIFPALQLFTMLETRLRDIPGLITSLINAFIALGRIEDFMSEPDKENVPSEP
FT                   LANDAPLSMHSCSFAWPGKVSPVLVDINITIPKGLTVVTGKVGAGKTAFLQALLGELDR
FT                   LNGSVHIPNEMVGYCAQTPWLQSMSIRDNILFSAPYHDQRYKRTLEACALLPDLAQFKH
FT                   GDLSFVGENGIGLSGGQKARVALARAVYSASRVLLLDDPLSALDHNTAELIVRRCFSGP
FT                   LMKDRTIVLVTHRTTLVRQRADQIIDICGKHATVYDKDSIKLDATESSLQVIAHEDGTE
FT                   AETTLEETAAVPDKFIEEEHRADGGVKARVYWNYVKAGKYRWWLTLVLVLAIYRLLAVG
FT                   QSWFLKGWGEAYEQTTLPKWSERPSQDVWSVSNLSMDMYFGPPSSVGQLPSPREDVRPW
FT                   LWTFFAIISFQAATLLVAQLLMLVIVYYAGQSLFRRVLVRVSHATFRYLDTIPLGRLMN
FT                   RLTSDIGVVDGNISEQFQVIAFQAITWISSVLVIATATPVFLLFSLALTVVFVLVFLRF
FT                   LPTSQSLRRLEMVSLSPLLSNFGELLHGLTTVRAFHAESQFQNRVISVVDKFQGMDHFY
FT                   WSLQSWLMYRFEGLSACSTFCLTALALYTNTTPGLVAFVLIAANNFVDSTHTLCKQYGQ
FT                   LQMDFVSVERVDELLHIEEETPGTIAPPAAWPTYGSDVVFEDATLRYAPHLDPSLVNVS
FT                   IRIPGGSTTAVIGRTGSGKSTLAMSLLSVIRPEFGRILIDGINIADVSTQALRTRVTFV
FT                   AQDPVLFPGSIRLNLDPTEDYSDELCTEVLGRLCSRHGWHLGTHIEAGGRNLSQGQRQL
FT                   IALTRAVLRRSAIVILDEATASVDHETSLEIQQIIREELQQSTVITIAHRVEAVKDADY
FT                   FVVLDQGRVSRQGHVRDM"
FT   CDS_pept        join(complement(310373..311475),complement(310290..310308),
FT                   complement(309992..310217),complement(309336..309955))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941359"
FT                   /orf_name="Pc22g01320"
FT                   /product="Pc22g01320 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97420.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000183268D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP28"
FT                   /transl_table=1
FT                   /translation="MENSRKRASLACNYCRRRYVPLIPMTEFPHADERAGNAAAMVRYP
FT                   PAASARIQVLNVSTTKLILWGKRPILFNTSATLLNSDSPRETSSSEFFRRLDAIENFLW
FT                   SHPRLPQTPQTGETRSGGFAFPSSSEHERADFSHPSTMLISSPSRPNPADISQIISTNS
FT                   SSFIPPEHEIPPMSIPIGHTTTTEYMLHMNKVKTLFGEFPPDLFIRAESKRHMPHQLSF
FT                   VPGTITASQLPLLDEASTYPLVEAYFRHVHVEMPILDKDQFLGLYDHHARAGLSVDCDS
FT                   ALCLAVLALGSAALEQVDPTKSSSPYWVPGADFISPALQILMNEYLLSFCPTITLPQSL
FT                   ILISKYFGFLLRPLQSWKLIHMASTSIQCLLGIESGLFPNSNMDYHFYADIDGSDLIAE
FT                   HHLPRSGIEHVIDLTPFPTFPNHDAQETHVFLAELSVRRLLNRVHHTMYGTSSDSPSYD
FT                   FQSLSTILNVSQELDRQLDNWFGLLPRTIKPDINDPSRCTGPKLNMLHRFHSAKDIITR
FT                   PFLLCAIDSSPENDVPPMVLKQCEASIVNCRAYLDASERRLMGPSSCAEIIIHTYVHNT
FT                   LHTRIGLIFQSLRMFSSVLLLTLGSVCPALAHLVPDIDGLQKNAIQSIERFAVDGSLMQ
FT                   EIHGIIILLHSKTRVLRRAM"
FT   CDS_pept        join(311964..311971,312110..312316,312385..312398,
FT                   312458..312530,312585..312905,312965..313131,
FT                   313209..313441,313500..313697,313756..313783,
FT                   313845..313960,314007..314090)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822805"
FT                   /orf_name="Pc22g01330"
FT                   /product="Pc22g01330 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97421.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000183268E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP29"
FT                   /transl_table=1
FT                   /translation="MKFFANSGSSLDLSRVKFTMFDEKHAADGKVDGPLEKDLENKLDS
FT                   KQLDAKQLEPFGNEETAEIKYRTMKWWHCGMLMIAENVSVGILSLPSAVATLGMVPAAI
FT                   MILFVSALSWYTGYVIGQFKLRHPEVHSMGDAGEILMGPFGRELLGLGQLLLLIFLMAS
FT                   NILMFNILMNVLTDHGTCTLVFGVVGLIICFLGALPRTMDKVYWMNSTDLYEAFLSVFV
FT                   ATVLTMITVGVESKGHVKNEATTDVSFREGFLAVTNIIFAYLAHVAYFGFMSETEDPRT
FT                   FNKSLAMLQIVDTVLYLVSALLIYHYVGPETATSPGVQSPAILSLSPLMGKIAWGISIP
FT                   TTILSGVVLGHVACKYIYVRMFRGSDKMHRRSFLSIGSWVAICLGVWVIAWIVAESIPV
FT                   FNDLLSLISAVFGSWFSFGLPAIFWFYMNKGRYFQNWKKAVLTITNILVLAIAFAICGL
FT                   GLWVSGVAIHEDSVTKSWSCANNA"
FT   CDS_pept        314703..315632
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15941360"
FT                   /orf_name="Pc22g01340"
FT                   /product="Pc22g01340 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97422.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000183268F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP30"
FT                   /transl_table=1
FT                   /translation="MSADTSAGANEDQRASLTSRILPTMTLSERSSPLTRPLAPVPFTS
FT                   ARERAEARFQVQGKAIVTGGAGALGLISARALLEHGLSSLCIMDLPRTLETSEEQIQSL
FT                   ASNFPSVNITKIPLDVTSMESIEPAFEQAHKVMEGIDILCCFAGIPGCQPSLTVTPDQF
FT                   NRVIDVNLNGSFFCAQAAAKRMESSGKGGCILFTASMSAHYTNFPQPQAAYNASKAGVA
FT                   HMTRNLAAEWAVHGIRVNSISPGYMDTILNAGDSLADVRKIWDSRCPMGRMGDPEEITG
FT                   AVVLLCSQRAGRYITGADIVIDGGTLTL"
FT   CDS_pept        complement(315802..316602)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15941361"
FT                   /orf_name="Pc22g01350"
FT                   /product="Pc22g01350 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97423.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001832690"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP31"
FT                   /transl_table=1
FT                   /translation="MPIEVPQASSLKDLFSLKDKVVVVTGASGSRGIGLEAARGCAEMG
FT                   GNIAITYFSRQEGAEANAKALQEEYGIQAKAYKCDTSKWNEVQELVTNVITDFGRIDSF
FT                   IANAGRTADAGVLDGSVEDWENIIQADLNSVFYCAKAVGPHFKERGKGSFVITASMSGH
FT                   IVNYPQEQTSYNVAKAGCIHMARSLANEWRDFARVNSISPGYINTGLGDFVDEETQKSW
FT                   NNMIPMGRQSDPKELKAAYVYFASDASSYTTGADLRIDGGYICR"
FT   CDS_pept        join(complement(317731..318067),complement(317020..317534),
FT                   complement(316914..316961))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000219459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941362"
FT                   /orf_name="Pc22g01360"
FT                   /product="Pc22g01360 protein"
FT                   /protein_id="CAP97424.1"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="UniParc:UPI0001832691"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP32"
FT                   /transl_table=1
FT                   /translation="MAKPDDDAVISFDSLPLDPAGPRGNAWGRFGKDDQLGTLNLLTPE
FT                   RVVEAAKEIWTGVRISLDWPLSMPSHPSFNRHPFKQEIVLRNPNCVYDDILTFNSQGST
FT                   QWDGFRHYAICEHGGITGRGVLLDYAEWATTNSITISALESEAITLDNLKRVVKDHNLN
FT                   FQKGDILFIRSGFTAAYNKLDNQQRKDLALRSSPDFSGVEATEGMVRWLWEHQFSAVAG
FT                   DAPSFERAPIRGAHADPNFNLHEWVLAGWGTPIGEMFDLEKLSEHCKANERYSFFLSSM
FT                   PLKVIGGVASPPNAFAIF"
FT   gap             318994..319093
FT                   /estimated_length="unknown"
FT   CDS_pept        join(<319136..319246,319323..319637)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822806"
FT                   /orf_name="Pc22g01370"
FT                   /product="Putative uncharacterized protein Pc22g01370 "
FT                   /protein_id="CAP97425.1"
FT                   /db_xref="UniParc:UPI0001832692"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP33"
FT                   /transl_table=1
FT                   /translation="ENHAGILERLGTHDLRQGAARDVAHLPLAKPAINSEKEDFWTLRA
FT                   INKPVRDLRAQSRAEVPFIPERLQPQEVSSFMIQNGMDIGCLYQRSVTRYRIHQLRRGQ
FT                   WADQQKNSEILGVAYPTNSAGKGRNIDPTLQSIDPIL"
FT   CDS_pept        join(complement(322736..323066),complement(322226..322684),
FT                   complement(320983..322168),complement(320841..320933),
FT                   complement(320395..320776))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000204991" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941363"
FT                   /orf_name="Pc22g01380"
FT                   /product="Pc22g01380 protein"
FT                   /protein_id="CAP97426.1"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI0001832693"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP34"
FT                   /transl_table=1
FT                   /translation="MYYSSVLKYLFLLACANAQLLEIPAVDAIVSSAMLPFEQYMSFGA
FT                   PTKIASAAVSFETKVAANAKSSVAVAAAADTPYWLADIAHQGVAAFNPNPSSYKVFRNV
FT                   KDYGAKGDGVTDDTAAINAAISAGGRFGPASRQSSTTTPAIVYFPSGTYLISTSIIDYY
FT                   FTQLIGNPNAMPVIKATAGFVGLGMIDGDQYQSDGNQGWTSTNVFFRQIRNLKLDLTAI
FT                   PAATAATGIHWPTGQASSIENVVIVMSSASGTQHQGIFIENGSGGWMTDVVITGGLYGA
FT                   NIGNQQFTMRNLVISNTVTAISQIWNWGWTYQGLSLFNCTTAISISNGGAGNQLVGSVN
FT                   ILDSTIQNCPTFVDTAWQSSTLSTGSLIMENINLKNVPVAVKGVSGTVLAGSTGSTTIG
FT                   AWGQGHKYTPNGPTNFQGSFTAPTRPSALLAGGSNRYFTKSKPQYAQSPVASFVSIRSA
FT                   GAKGDGSTDDTTVIQSTLASAASAGEIVFFDQGTYKVTNTIYIPPGSRIVGEAYSVIMA
FT                   TGSVWSSITKPVPVVQIGRSGESGSIEWSDMIVSTSGSAPGAVLIEWNLAATSGSGMWD
FT                   VHTRIGGFQGSQQQVAQCPTTAAVSAACQVAYMSMHITKAASGVYLENVWLWTADHDLE
FT                   SPTNTQISVYSGRGLLVEGKNIWLYGTGSEHHSLYQYQFSGASSICAGFVQTETPYYQP
FT                   NPNAANGPYPRNLALSDPDYSSCLGGNCNSLGLRILNTKDVIIYGAGLYSFFNNYSTSC
FT                   STFPLPENCQSMIFSTEGSTSGLVVYGLNTVGTSYMIVKDGTALATVGDNLATYAATIA
FT                   YFTF"
FT   mat_peptide     join(complement(322736..322982),complement(322226..322684),
FT                   complement(320983..322168),complement(320841..320933),
FT                   complement(320398..320776))
FT                   /db_xref="UniProtKB/TrEMBL:B6HP34 "
FT   sig_peptide     complement(322983..323066)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP34 "
FT   CDS_pept        join(324951..325072,325139..329120)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976015"
FT                   /orf_name="Pc22g01390"
FT                   /product="Pc22g01390 protein"
FT                   /biological_process="intracellular transport"
FT                   /protein_id="CAP97427.1"
FT                   /db_xref="GO:0046907"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI0001832694"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP37"
FT                   /transl_table=1
FT                   /translation="MLKRGAQGPQGSKEDEGVFGMASTPDDKPHRATAAQLANRKIKDV
FT                   RRRRAATPTTGGAASDATSFNPFASVAPAAAPAPTQSTGFTFGQTQSQSFPGASSGPSQ
FT                   GGMFSSGTNGQAGGQVSFSFGAGPTSFGSAPPSNPFSVETSFGGNTQSSTNGFSFGGFN
FT                   TGNQSTPSFGGFGAQQNTSTPAKPALFGQSAAHMTSPADDSMQTSPDTKPKGASIFSTK
FT                   PAAGPPALGNPFSNLSGQGAASNPFAPKITAPEKAVEKPAETQPFTPLFGSTPAASKPS
FT                   DGDKPQPTVSNPFAPKVTAPEKAVEKPAETQPFKPLFGSTPAVSKPSDGDKPQPTASNP
FT                   FANPPGQAPTSSTNLFAPKTTPAEQTPAKPAEPAKPFGALFGSTPSSQPSVPVSNIFAP
FT                   KPTEEEPKASNPFANLSAPSSFGTLSSPKVTGTESAGKVADAQPFKPMFGTPAASKVSE
FT                   AGKDQTPAPTFGNMFSPKPAAENAAAKPVADQPFKSMFGTPAVSKVSEAEKEQTPSSAF
FT                   GNMFSPKPVAESTGAKPVEDKPFKPMFGTPVAGKEQSAANNVFAPKVTSEEQTPAPAKT
FT                   PQFGSMFGASPAPSKIGEGKTAQPTLSNPFANLSGQNAFSSPFAPKPTEQAAKPQAPST
FT                   SLFGAGTAVDNNKLNMDNEVNRDNNIALNNSLSHPFTPGPKVSNEPQTEGATKTATPHV
FT                   SFASTRDDKSSSYLPVPSSSSSLPSSSTTSTVSNTFTASDPDSLFPRTGHPVSIDYPEP
FT                   PLDFDSMPLKRLFNEPNRDQLRARANLLMKIGVLTESFKREVAKCNPMTDDIDEVLILY
FT                   AELRRELGVPIGTINPEEEAKRAALRKRDAAKEAAGGISPPRDAAKEAPAGASPRGAAK
FT                   EVPNGVATPRIPTPPSFAPPGADDTRPGPSNKPSGGSTTSSKFAQSFSAPAPAPVTTSG
FT                   GSPSTSTAGPAAAPVSVAPVEPSPPAAAPAFEIPKFGSGATGADFAAQFKSASDKAIAE
FT                   AKAKRKAEEFDSDEEDEAEWERKDEERQREKRAQIEAAANKRPIFVPGVGFKFADDNPA
FT                   PQNVEEPATSTAPAASATPSQLDSADTVNPTPDLFPAFSTPSAPEGANGASSVFSSASS
FT                   KPVPASQNIFGGLKPSSPKRKAGDESDSDEDSPAKKTKSSHSIFGGPVPTSQNIFGGKP
FT                   PSPKRKAGDESDNDEDSPAKKTKSSHSLFGGPVPTSQNIFGGKPSAPLPAASTDSSAQP
FT                   LMATPSAPSTQPASTTTEEEDIEAGEIFDLTKGNGGEEEETVLFEDKSKVFKLESAWLP
FT                   KGTGPVRVLKHPVTGRARVVARAEPSGNVTLNTLLKKEFDYKLTSNSVQFLVPNETGGL
FT                   THWAVRVKKERLQEFYQLVNHIKN"
FT   CDS_pept        329785..330393
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941364"
FT                   /orf_name="Pc22g01400"
FT                   /product="Pc22g01400 protein"
FT                   /protein_id="CAP97428.1"
FT                   /db_xref="UniParc:UPI0001832695"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP38"
FT                   /transl_table=1
FT                   /translation="MKHVALSFLGLASLTSLAAARTDLEGCVSSKVIFDHYYASYLWYV
FT                   PENGEICSILNCGGGRAPPSTTQPGCPEYSGTEPLTSDYLEGWGPNGKQAASTSTVAST
FT                   ASSTADTVLASATQTSEALDSSSASSSSPSGTQPADSMITDGPSRISTVTSSTSVTGSD
FT                   ASTSAAASSSSAPNAATTPASNVGGVVAVMAAVVGAMVL"
FT   sig_peptide     329785..329844
FT                   /db_xref="UniProtKB/TrEMBL:B6HP38 "
FT   mat_peptide     329845..330390
FT                   /db_xref="UniProtKB/TrEMBL:B6HP38 "
FT   CDS_pept        join(331764..331979,332041..332733,332784..332972)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822807"
FT                   /orf_name="Pc22g01410"
FT                   /product="Pc22g01410 protein"
FT                   /protein_id="CAP97429.1"
FT                   /db_xref="UniParc:UPI0001832765"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP39"
FT                   /transl_table=1
FT                   /translation="MVVVTIVFYYLLSYQPCLDPFRDGHIDPLLALQPRPNPIDELMLR
FT                   GPRRLLTKIFGTNSSGLRIHARFEDSLCVLAMSDIQIFTGISIMISGAAQLKCGISCYQ
FT                   WLVVVYLAWFSSLTHLSCLTLLRNYLHNRPAERTWRLVCMFVLVALLFFAFLPTVNYRW
FT                   QLGRSAEGAGPPTPEDYAICYLKPMSRLDYDAHSMYWEGLNYHSHSEHTIVATSISIVL
FT                   LFVGFVCRVFKLHQSFSKFLDHSIRRRISRSLRIPLRVVCDWCDVQGSPRSLKRYLLYR
FT                   PLLALFLTARVSADTWNSMFFEVWWLMISFIWGVERLFNTTAIVPSKEDTKWTFGQVMS
FT                   VALLAIPLVTAIELLYPGKFPTSLQ"
FT   CDS_pept        join(334046..334136,334189..334225,334288..334384,
FT                   334439..335153,335203..335365,335415..335460)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209056" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670042"
FT                   /orf_name="Pc22g01420"
FT                   /product="Pc22g01420 protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP97430.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR005045"
FT                   /db_xref="UniParc:UPI0001832766"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP40"
FT                   /transl_table=1
FT                   /translation="MAQAKSTGYPTDDQVRPRKADSSTESKRPASTAFRQQRLKAWQPI
FT                   LTPKNVLPIFLVIGVLLIPMGGVLIWANSLVREIVIDYSDCWKAAPLDSSIAIPDNVQT
FT                   TFKSKTRQDPHWQRTHDPATNTTTCSLFFDIPETLGPPVYLYYRLTNFYQNHRRYVQSF
FT                   NQDQLKGKAVRNATLANGTCEPCAVDDATKKAYYPCGLIANSKFNDTIGQPQNLQGEGT
FT                   FVYNMTKKGISWESDKELIKKTQYKPWEVVPPPNWASYGLNYTYENMPDLHEDEDFMVW
FT                   MRPAGLPSFSKLSRRNDRDAMPKGFYRLDIQDRFRVTEYEGTKAILISTRTVLGGKNPF
FT                   FGIAYVVVGGICVLVGVAFAIAHSIRPRKLGDWTYLSWTSST"
FT   CDS_pept        join(complement(336335..336595),complement(335947..336279))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201761" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941365"
FT                   /orf_name="Pc22g01430"
FT                   /product="Pc22g01430 protein"
FT                   /protein_id="CAP97431.1"
FT                   /db_xref="UniParc:UPI0001832767"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP35"
FT                   /transl_table=1
FT                   /translation="MKQSTILALIPFLAGVNSLTTHQKPARFDVMAVSDGPVQYRALAT
FT                   SATFFWLGKGDGWTDSHCPPNVEKAGRCPPGKDTILKDAHTLDTVVPGQIIYVDSNYAV
FT                   RASGPNSTHIDSGSKTGGFKYVPGDRYGQWEYQGDGFDGLLACPYNNGIYQVFVNSPDV
FT                   KPRQGVKSDTCVPFTAGAFEYRLPANATAAAWEY"
FT   mat_peptide     join(complement(336335..336541),complement(335950..336279))
FT                   /db_xref="UniProtKB/TrEMBL:B6HP35 "
FT   sig_peptide     complement(336542..336595)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP35 "
FT   CDS_pept        join(337763..337910,337975..338288)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976016"
FT                   /orf_name="Pc22g01440"
FT                   /product="Putative uncharacterized protein Pc22g01440 "
FT                   /protein_id="CAP97432.1"
FT                   /db_xref="UniParc:UPI0001832768"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP36"
FT                   /transl_table=1
FT                   /translation="MLLNNFMLLVALGSTSVLSLITKRDAPPDNTDGAYKVAFKCTNSM
FT                   YPGAARGGPSDYTHNDELKLAVADGSLRSPDECHEQDGHPAIAECTFNDDAFEGGSLIV
FT                   HVYNDPGNCHLDFGYKGESFTAKSDKCGHDDGGFEPFTSEKTAICYFDA"
FT   sig_peptide     337763..337819
FT                   /db_xref="UniProtKB/TrEMBL:B6HP36 "
FT   mat_peptide     join(337820..337910,337975..338285)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP36 "
FT   CDS_pept        join(338841..339336,339397..339916,340238..340616)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941366"
FT                   /orf_name="Pc22g01450"
FT                   /product="Pc22g01450 protein"
FT                   /protein_id="CAP97433.1"
FT                   /db_xref="UniParc:UPI0001832769"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP41"
FT                   /transl_table=1
FT                   /translation="MVTTRDPAALTDLPLELLWMISEHLSLVDLACLALGNHRLLSSLA
FT                   GTAFRDFTNTNGRNGNPTDDARIKLLSRLSRDLPQYYLCFICLRLHLWKNTRLPGYFHI
FT                   GCSDGLEMKDQCLQTRLPLCFYPSYTFYHFRFVHLQLAMRRFYHGPRFGIPVESMLYTE
FT                   VAQKDPQKDVLMTLFSAEARICSTPPGLCLRTQEIAVVARQNVPRMWPCPENGLVEICR
FT                   HIHTHKPGFIDIFTSQIERYCSKTNPIKPADQGSCDKCNTSWKLEMRTLDENNASLTLT
FT                   RWIDLGPGLSPNDAQWRCRFGIELLLNSPNHEIVDSRQRFEKDSVQANSSNALSEDEIS
FT                   MSDQNCSSTAQVELATSLGTWFGPLIAAIAGILVDRALDAYSKKSPTPTAADTERSLSD
FT                   EVFPTLRGLEADINSMRSEARVTQESMDALRDNLQRQIDAISSTGGKVPDIACQASYPA
FT                   RQDPET"
FT   CDS_pept        complement(341956..342942)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941367"
FT                   /orf_name="Pc22g01460"
FT                   /product="Pc22g01460 protein"
FT                   /protein_id="CAP97434.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000183276A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP42"
FT                   /transl_table=1
FT                   /translation="MPDTLPFSISRLKECVATVLQCSPASISLTRQPTIEGDDHMIFLI
FT                   DSKPDYIIRVTKPREDGSRSYNGHEMQARDIALRGLVQDEYRARGLDERIIPRSIGSWQ
FT                   LSDDGDYAASLETKLQGLGLHRAPASELTVQGLGGFLSMLKCVNIEGLEERLGVKIPLI
FT                   SFPNLKLLRESAIEAWTRLVERGQVIAKDIGNQSPINGLLERKTTLLEKIQHLSPEYRP
FT                   ALVHNDIKGEHILICPQSGRITGILDWADAGIGNAAVDIAGLVLTVGSNIAKETAREVG
FT                   YGENQILQGVLQARCECVLRLDDRLNGDDRMTPVDLLRDQLFLSLKD"
FT   CDS_pept        join(345058..345121,345173..345999)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000222700" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976017"
FT                   /orf_name="Pc22g01470"
FT                   /product="Pc22g01470 protein"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="CAP97435.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniParc:UPI000183276B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP43"
FT                   /transl_table=1
FT                   /translation="MATMATFLKKPLKLALVQLATGADKSVNLSHARSKVLEAAKAGAG
FT                   LIVLPECFNSPYGTNFFPKYAETLLPSPPTIEQSPSFHALSAIAVEANAYLVGGSIPEL
FT                   EPSTKKYYNTSLVFSPTGALIGTHRKTHLFDIDIPGKIQFKESDVLSPGNQLTVLDLPE
FT                   YGKIGLAICYDIRFPEAAMIATRQGAFLLVYPGAFNTTTGPLHWSLLARARAVDNQSYV
FT                   ALCSPARDLGAAYHAYGHSLVADPSANILSEAEEKETIIYADLNNDAITNIRNGIPIST
FT                   QRRFDLYPDVSASQK"
FT   sig_peptide     join(345058..345121,345173..345204)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP43 "
FT   mat_peptide     345205..345996
FT                   /db_xref="UniProtKB/TrEMBL:B6HP43 "
FT   CDS_pept        join(346366..346449,346918..346992,347065..347268)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216660" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822808"
FT                   /orf_name="Pc22g01480"
FT                   /product="Pc22g01480 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP97436.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="UniParc:UPI000183276C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP44"
FT                   /transl_table=1
FT                   /translation="MSNVKTGNKRSAIADVVSREYTINLHKRCHGVSFKKRAPKAIKEI
FT                   RAFAEQAMGTKDVRVDPQLNKKVWEAGIKGVPFRLRVRISRKRNDEENAKERLYSHVQA
FT                   VNVKNPKGLHTTTVDE"
FT   CDS_pept        join(350301..350565,350657..350892,350967..351608)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216633" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941368"
FT                   /orf_name="Pc22g01490"
FT                   /product="Pc22g01490 protein"
FT                   /protein_id="CAP97437.1"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI000183276D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPK3"
FT                   /transl_table=1
FT                   /translation="MESKIPDFLLEQQAQGSPETQPYFLTFEDYWERKLWHQLTDSLVE
FT                   FFRMPESAPHRLALFKTFVLSFADRVNQLKFVSLGLMAATECTDDQERLAFLTSLASKT
FT                   DTPDTQDAYVYALADVANVKLSLKDLDGAQTDLATCQRVLDTFDSVETVVHASFYKVNA
FT                   DYYHAKQEFASFYKNALLYLACIDLQELTETERASRAYNLSVAALVSDTIYNFGELLLH
FT                   PILDSLTQTPHNWLRELLFAFNRGDLTAYDVLAGNISKNKLLETHRVFLYQKISLSALT
FT                   EMVFHRPPHDRSLSFQAIASETKVQPDEIEHLVMKALSLGLLRGSIDQVAQVAQIHWVQ
FT                   PKVLDMKQIDGMRNRLKDWDAGVNQLGHWIEGAGKDVWAA"
FT   CDS_pept        join(complement(352581..352952),complement(351826..352533))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076516" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127075"
FT                   /orf_name="Pc22g01500"
FT                   /product="Pc22g01500 protein"
FT                   /function="chitin binding"
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="CAP97438.1"
FT                   /db_xref="GO:0008061"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="InterPro:IPR001002"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="UniParc:UPI000183276E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPK4"
FT                   /transl_table=1
FT                   /translation="MRSFRIDLLALWLLLLRMAIAVPPVPTKDGYCFKYIIQGYDTCAQ
FT                   IAKAHDITEADIESFNKNTWAWLGCRQLYQGDFICLSAGKPPMPMALPQATCGPQVPGT
FT                   TRPANWADLASMNPCADSKCCAFWGQCGVSDLYCQNYRAPPAGPTATVKGATEAPKSKP
FT                   TGNAKGTADKESPNKDTNSKPTNPDSKSSKDNTTKAPKATKITTTTKPTTTKAKPAPEP
FT                   NVPVPQYEWKAPWEITMYSKAGCEGDYYHLEGYNKEFLDDEGCLALHGGINSKFTETGV
FT                   TCKWWTEDGFTWSGCDTSKLKKPESWVLKNGYCAIFTIADCDCFDSLEMYYKSEGCHNR
FT                   TDIDPPNFAALQCSINGHQ"
FT   mat_peptide     join(complement(352581..352889),complement(351829..352533))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPK4 "
FT   sig_peptide     complement(352890..352952)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPK4 "
FT   CDS_pept        join(complement(355467..355765),complement(355177..355415),
FT                   complement(354295..355124),complement(353753..354238))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216632" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941369"
FT                   /orf_name="Pc22g01510"
FT                   /product="Pc22g01510 protein"
FT                   /cellular_component="GPI-anchor transamidase complex "
FT                   /protein_id="CAP97439.1"
FT                   /db_xref="GO:0042765"
FT                   /db_xref="InterPro:IPR007246"
FT                   /db_xref="InterPro:IPR017063"
FT                   /db_xref="UniParc:UPI000183276F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPK5"
FT                   /transl_table=1
FT                   /translation="MPAAIRNLRNNPHFLFARLPNLLSFICVVVGVVWLLLLPLNEYSR
FT                   QTYISENALLPGQVHAYFTGSEQNIFRGYKRELEGLLNDGQARGGQKDEAEVTAAVSDK
FT                   LQSILQAAGLKVATQKYEYTSAGITHQGENTYAIIHAPRGDATEAIVLVAPWITADDKL
FT                   NLNGVTLALTLARYFKRWSLWSKDIIFLITPDSKSGTQAWIDAYHDMHPASVQPLPLKS
FT                   GALQGALVIEYPLDHRFQSLHIVYDGVNGQLPNLDLFNTAVAIAGGQMGIGANLQEMWG
FT                   HDDSYEHRLQTMFRGMTKQGLGYATGAHSSFMPYHIDAITLQTKGEGWEDEMALGRTIE
FT                   SLCRSLNNLLEHLHQSFFFYLLMQSNRFVSIGTYLPSAMLIAGNFTIMAIALWMRTGYY
FT                   PESKPSAKPMNEKGSAEEKAKTDGIAERHLALPLSLVVGLHLLGLVPLWVFNNIFHQYF
FT                   TTTTYIFVVVDIILPLFLAAILSNGLGLSNPIIPQQYHLIKSFSLLLLGLSLSTLATLN
FT                   FSLSFMIGLLCAPLSFVARLQGSAPFRLATSSLGLVLLNLVSPPTVLLGVCWYMGISVE
FT                   TVLTQAAFGWDIWGMWTQVVVWCVWWPAWLIGCVLLWSSMF"
FT   CDS_pept        join(complement(357028..357220),complement(356816..356965),
FT                   complement(356686..356767),complement(356568..356633),
FT                   complement(356472..356518),complement(356393..356437),
FT                   complement(356132..356349))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216631" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941370"
FT                   /orf_name="Pc22g01520"
FT                   /product="Pc22g01520 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97440.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniParc:UPI0001832770"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPK6"
FT                   /transl_table=1
FT                   /translation="MATPAALPPLPFNPGRIRTYLLRLPLFTRLVLLIILAFWLLEFQT
FT                   IWSVVQWGALIPEEINLGTMYRLNTYPVIHMGFFHAFFNAMAVTPLLERFEAEHGTLTA
FT                   IALFVGRECSALSTFPAGLYILFERFILHRNTSVVGASIWVFLLLGSEAIKTYRSHPNF
FT                   SLGPYKIPTWTSPLFASSSVISARFLSAISVIGLGYLKVFVPPEKVLRWIEGKLNLLGR
FT                   LPHYVSVDQKTYGRYGVLPSTNPAGASGNQTPMSYLGSTQRLGA"
FT   CDS_pept        join(complement(358695..358782),complement(358306..358631),
FT                   complement(358106..358223),complement(357839..358041))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941371"
FT                   /orf_name="Pc22g01530"
FT                   /product="Pc22g01530 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP97441.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniParc:UPI0001832771"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPK7"
FT                   /transl_table=1
FT                   /translation="MASNPPAACCASGFKHEGTPAGEIKNIDGVNTYISYPKDKSPEKA
FT                   IIFLTDIFGIYINAQILADEFANNGYLTIIPDILQGDQISVSDMSSGKVVLPTWIKSHQ
FT                   PEHVEPAIESTIKYARETLGVKKIGAVGYCFGGKYVCRDMKPGLIDVGYTAHPSFVTHE
FT                   ELGAIDGPLSIAAAEVDSIFTTQLRHESEETLIKTGKPWQINLFSGVSHGFAVRADLSD
FT                   PKQKWAKEQAFCQAIAWFNQHL"
FT   CDS_pept        join(complement(361288..361555),complement(360270..361216),
FT                   complement(359837..360208),complement(359588..359761))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216629" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941372"
FT                   /orf_name="Pc22g01540"
FT                   /product="Pc22g01540 protein"
FT                   /protein_id="CAP97442.1"
FT                   /db_xref="InterPro:IPR018825"
FT                   /db_xref="InterPro:IPR018827"
FT                   /db_xref="UniParc:UPI0001832772"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPK8"
FT                   /transl_table=1
FT                   /translation="MPLATRVALVATFTLFLASLATAIPHGDDESMDMGMDMNAGTNAP
FT                   QPTTTATQATTDGPMSYFAYSKHSSTIIAHIALMVLGWCFVLPVAVMLSIARSWLALPS
FT                   QFLFLGFNAFGVLLGVIYNNQTPDLYENNAHHKIGWIATCVVSAQVVLALLFAYAGRGK
FT                   SNSPSYEHATFLPVATDDDTEHACLNGAMRERRWSRDSGQGTDSNSSSIRSPGSSCGSP
FT                   TEYDGFEKPEELPAKVTVQSSWIRHTAVGRFLSKTLPGLMPSRVLRVLNVVYNVVDRVI
FT                   LPFGFTAIATGAVTYGGIMRDREIFNGLAHFIKGGIFFWYGILTLGRYIGCWADLGWAW
FT                   NKKPSASIVGWKSKVPSGEATESFVIFLYGATNVFLEHLSNAGKAWSATDLEHVSISVL
FT                   FFGGGLAGMLFESTRVRDWVNKTILEIPAHDASNEAWTPPRSQGVSLNPMPALVIMLLG
FT                   MMMGSHHQTSMTSTMVHKQWGNMLVGFALARGMTYVLLYLKPPTSYLPARPPTEIIAAF
FT                   CLISGGLIFMMSTRNVIEAMEYYELDAMFTFTVGLGFSAFIMAYEILTIAIKAWAVKRA
FT                   QRSRPNFRFQ"
FT   mat_peptide     join(complement(361288..361486),complement(360270..361216),
FT                   complement(359837..360208),complement(359591..359761))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPK8 "
FT   sig_peptide     complement(361487..361555)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPK8 "
FT   CDS_pept        join(362070..362089,362373..362523,362590..362722,
FT                   363149..363291)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127076"
FT                   /orf_name="Pc22g01550"
FT                   /product="Putative uncharacterized protein Pc22g01550 "
FT                   /protein_id="CAP97443.1"
FT                   /db_xref="UniParc:UPI0001832773"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPL4"
FT                   /transl_table=1
FT                   /translation="MSTYITRYVNLHLMPHVLYDRQKYSVLANDVVDRYSIWTATGLIF
FT                   SFSYYIHSMYTQANYIRFGFQGPKVSSLTAVQADDHQESTPPITEAYNIRKYLCIPLLY
FT                   NFDTTNSLAKRPSYTPYSVLHTPCFDSTDAVNNHPPVVKKQTST"
FT   CDS_pept        join(complement(366078..366115),complement(365973..365996),
FT                   complement(365799..365841),complement(365656..365712),
FT                   complement(365462..365470))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231300" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941373"
FT                   /orf_name="Pc22g01560"
FT                   /product="Pc22g01560 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP97444.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="UniParc:UPI0001832774"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPL5"
FT                   /transl_table=1
FT                   /translation="MTHESVWYSRPRKYGKGSRECRVCSHRAGLIRKYGMNICRQCFRE
FT                   KSTDIGFSKYR"
FT   CDS_pept        join(complement(368993..369044),complement(368703..368939),
FT                   complement(368541..368648),complement(368157..368482),
FT                   complement(367676..368107),complement(367412..367621),
FT                   complement(367227..367346))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216626" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976018"
FT                   /orf_name="Pc22g01570"
FT                   /product="Pc22g01570 protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAP97445.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001832775"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPK9"
FT                   /transl_table=1
FT                   /translation="MATLDSVQLLSEAAFGCVHLAAILSKDEKTADQFREEFCRQYKLL
FT                   APFSKTETVAVPTTGLRTVASLKPKYHCLSCAEVCLGSKRAEHTAATGHVFYMESRNRF
FT                   VFCEKCVDFIYDHTLDRLRGPSGRFEAIDGRSIWAEDSASEVYVKNNAYKNPCAIRGAR
FT                   GVWNMGQTCYQASILQALLHDPSLTAYFLGGGHDVHTCIIKDCLACATAEVFMEFNSAE
FT                   KSEAVSAAVLLHHGWQKSKEMRGYRQQDAHEYFQFLVNELHSSTPGHVESYDKPCECFF
FT                   HQMFYGELRSSVMCHKCGQTTNTHDPMADLSLDVQLQQKKRKLGRSTSSSTSGTLLGCL
FT                   DSFTAAEDLHADAAYHCEKCGNTPQRASKRLQIRKLPVMLCMQLKRYEHSSNSSEKMNG
FT                   HIDFPLSVNMLPYTVRKDSLPVDMSNYIYDLSTVIVHQGTMDSGHYYAYTRIENDKWVL
FT                   MDDNKVTIAGVAEVLRQDAYLLFYSARYLRAEKTKK"
FT   CDS_pept        join(complement(370425..370736),complement(370173..370258),
FT                   complement(369884..370136))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941374"
FT                   /orf_name="Pc22g01580"
FT                   /product="Pc22g01580 protein"
FT                   /protein_id="CAP97446.1"
FT                   /db_xref="InterPro:IPR013962"
FT                   /db_xref="UniParc:UPI0001832776"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPL0"
FT                   /transl_table=1
FT                   /translation="MDAPQSSTRPRPSSRPTTPLRPSSRSSLREAHGYGNGIGNSGYSQ
FT                   PAINALEPQFAELADSMADLEANFMHLQLMHESLTRFSESFASFLYGLNMNAFCVDFPE
FT                   VRRTGFVNSHPEAESEPTRPIDDGEMTFMKLELMGSNATGLRTQHLWRTPQAPPPPPLD
FT                   RRPSTLRAHEYRRVALPVVQQPAGTLHEALRAALVPAHFLGVEGLGLGKEPDA"
FT   CDS_pept        join(371388..372158,372207..372248,372298..372397,
FT                   372448..372923)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181587" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941375"
FT                   /orf_name="Pc22g01590"
FT                   /product="Pc22g01590 protein"
FT                   /protein_id="CAP97447.1"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI0001832777"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPL1"
FT                   /transl_table=1
FT                   /translation="MPGEPAPGTVGNLTPEQEVKLKEFWVLTLKVFGLTLDELEAPPST
FT                   ATSDAATPAPAQDKKKPKSRWGIWGRADDDDSKSGSSSATASVASISVGDGDDKYGQSK
FT                   EFKQALEDMKPEEIRTAFWSMVKGDNPDALLLRFLRARKWDTKKALVMLISTMRWRLLE
FT                   MHVDDDIMFNGEASAVKMSQSSDPKEKKKGDDFLTQMRLGKSFLHGVDRAGRPICVVRV
FT                   RLHKAGDQDNEGLERFTVYTIETARLLLASPVETATIVFDMTDFGMANMDYAPVKFMIK
FT                   CFEANYPESLGAVLIHKAPWLFSSIWSVIKGWLDPVVAAKIHFTKNRQDLEKFIHSNQI
FT                   MKELEGDEDWEYKYVEVPENENPKMADKETRDTLLAERQKLAKEIQDTTVEWIRASFKN
FT                   ESDAASAAEQKRNGLIDQLRKHYWVLDPYVRARSLYDRLNIVQGGGKINFYPDSQKESG
FT                   STAA"
FT   CDS_pept        join(complement(374217..374256),complement(374020..374102),
FT                   complement(373791..373859),complement(373519..373611),
FT                   complement(373443..373457),complement(373258..373365))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000061063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941376"
FT                   /orf_name="Pc22g01600"
FT                   /product="Pc22g01600 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP97448.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="UniParc:UPI0001832778"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPL2"
FT                   /transl_table=1
FT                   /translation="MSSAACIFCKIIKGDIPSLKLFESDKVFAFLDIQPLSLGHALVIP
FT                   KFHGAKLTDIPDEHLTEVLPVAKKIAKAIGAEDFNVLQNNGRIAHQVVDHVHFHMIPKP
FT                   NEKEGLTIGWPAEQADMAKLKALHEEIKSKM"
FT   ncRNA           374464..374579
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="U5"
FT                   /db_xref="Rfam:RF00020"
FT   CDS_pept        join(375563..375708,375770..375783,375845..375907,
FT                   375959..376053,376116..376207,376259..376400,
FT                   376453..376611,376663..377100)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168008" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822809"
FT                   /orf_name="Pc22g01610"
FT                   /product="Pc22g01610 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP97449.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001832849"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPL3"
FT                   /transl_table=1
FT                   /translation="MQKSRTINTALGARPFVPVPRVQLQFQRNLQDVRITRTGKPLLKV
FT                   QGGRSSIGGHTATVFGATGFLGRYIVNKLARQGCTVVVPYREEMAKRHLKVTGDLGRVV
FT                   FMEYDLRNTQSIEESVRHSDVVYNLVGRQYPTKNFSYEDVHVDGVERIADAVAKYDVDR
FT                   FIHVSSYNARRDSPSEYFATKAWGEEIVRKIYPETTIVRPAPMFGFEDNLLHKLAKVGN
FT                   VFTANHMQERYWPVHAIDVGSALERMLHDDSTAGETFELYGPKNYSTAEIAELVDREII
FT                   KKRRHINVPKAVLKPFAHYMNKFLWWHTLSADEVEREFIDQVIDPTAKTFKDLGMEETA
FT                   DLANLTFHYLQGYRSASYYDLPPSTERERQEDKRYLHVLDDQ"
FT   CDS_pept        complement(377709..379322)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000064644" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670043"
FT                   /orf_name="Pc22g01620"
FT                   /product="Pc22g01620 protein"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /protein_id="CAP97450.1"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="UniParc:UPI000183284A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPL6"
FT                   /transl_table=1
FT                   /translation="MDKGTIFFNGRILTKAGSGLFGEPTFADSMLVRNGTVTAVGQFQE
FT                   LSSECPSDVEKRDLKQQTVLPSFIDGHMHLLLLGQSLRKLDLRHCKSLEEIRSTIKQYV
FT                   VANPDAPTIFCKNWMHSMTPGGVTAAMLDDIDPRPIFIDASSQHSCWMNTAALQVLGAE
FT                   TMSDPPGGSIHRDAEGKPSGVMDEGAMMSVIWPFQAVSSSKEERMRSILQAIQEYNAAG
FT                   YTGVVVMAMDEEAWSSLVTLRSTQPDLPMRVAAYWLIRPTADPESNSKQVQRAIELSGR
FT                   YNSSTSPDLRIVGIKIICDGIIDACTAFLSEPYAPLGSPPPIWEAEHLAPVVKEADSAG
FT                   LQIALHAIGDGAITMAIDAIEKNASPGRRHRIEHLELASPKDAKRLGELGLTASIQPVH
FT                   ADPSILTEWPRLIGEKRCKRAFAYREFADAGALVAIGSDSPTSPWAPMDNLYVATTRKS
FT                   ARNVKYTKVVNEHFRLGMCESIVAASEGAARSVFAEERTGSLGVGKLADFVVVDMEWDA
FT                   NALLEAKVKETWFGGRKVWG"
FT   CDS_pept        join(379983..380714,380765..381211,381262..381455,
FT                   381661..381718)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048439" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976019"
FT                   /orf_name="Pc22g01630"
FT                   /product="Pc22g01630 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97451.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000183284B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPL7"
FT                   /transl_table=1
FT                   /translation="MSAISIGCWTCRVRHKKCDITTPFCRECSDRNVHCHGYGPKPAWM
FT                   DGASEEKKERARIKLAINQHVRRVRKMQNRAKRRTSPPQGLKEMQPADSQVNASTALDT
FT                   GDSNLVQDTSLESVDRPSSQDGIFDPQAACLLMHYLDQVFPWQFPYFRSTSRLGNRGWL
FT                   LYLLMKRGPLYHAVLSLSSLHQSAILGSEEEYQQKEKALEHHSRALREFCKFMSEERGK
FT                   LLDDNARLAEFLACSLILISCEVFRGAEHNWLLHLDAVICVIHSLSPETVFDARYTSHA
FT                   GSSVLSHNRPKEGLEFLLATMVSLDLFACLPTGRVPRLLYQQWLRTSEIQVADLLSCEN
FT                   WVMVIIGDLACLGEWKEVQEKDGMLSISELARRGEEIKERLTMGIEKLVLTRDAQENHE
FT                   AQTSWVTLLFALACVVLLHTIVSGPLPALPEIQSAVSRSIIALQNRPRTYSLTGLVWAL
FT                   FSGSDISSIVIILSLHFD"
FT   CDS_pept        join(complement(382167..383498),complement(382058..382117))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941377"
FT                   /orf_name="Pc22g01640"
FT                   /product="Pc22g01640 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97452.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000183284C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPL8"
FT                   /transl_table=1
FT                   /translation="MSFANNANANTTDKKDTHDMIDYEKYGGEVVSESGRYHDHELAIQ
FT                   GNEHFHRLGWKRLTIVLIVQSIALGSLSLPAAFATLGMVAGVILCIGLGLIAIYASYMV
FT                   GLAKLKYPHVAHYVDFGRLLMGGFGDKLFSVAFIALMTLTVGSHCLTGKLAFATLSDNA
FT                   ACALIFSAISAVILFAFAIPPSFAELSILGFIDFGSIIIAIGICIIANGVQQDPAATPW
FT                   SAWPQDDLNLSKAFVAISNIAFAYAFAASQPSFMDEMHTPEDFTKSISTLGIVQVTIYT
FT                   LTGAIIYAFVGQDVGSPALVSAGPLWAKVAFGVALPVIFISGSINTTVACRYIHGRMYQ
FT                   NSVVRYVNTTKGWVTWLSSVAIITILAWIIAEAIPFFSELLAICGCLLVSGFSFYVPPV
FT                   MWFFLLKEGRWHEKRNIRHAILNLIVFLVGICILGCGLYASVVGVITAFRTGSISRPFS
FT                   CSAGQ"
FT   CDS_pept        complement(384197..384883)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076752" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941378"
FT                   /orf_name="Pc22g01650"
FT                   /product="Pc22g01650 protein"
FT                   /protein_id="CAP97453.1"
FT                   /db_xref="UniParc:UPI000183284D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPL9"
FT                   /transl_table=1
FT                   /translation="MGFFNNPPVFTLSRNESVLRYGSENVYQSRLTELFVAEHALREVM
FT                   QREERLHHKVIALEKAVTLGTNMNTMQFEDAKIALEESQLQYPIKEWALYQAECRLHSI
FT                   LKEPYDRLRRDPKWYMREEMVQDCSDRGGCCSRECGCCEQRHLSKKKKGRGHCTVECKC
FT                   CIGLRGFELPESQKQEMRQNFESMLREFYSASALRLANCFFCSSKSKSKLSWWQRTLKG
FT                   GSYGTD"
FT   CDS_pept        join(385394..385655,385725..386347)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216635" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941379"
FT                   /orf_name="Pc22g01660"
FT                   /product="Pc22g01660 protein"
FT                   /function="uroporphyrinogen-III synthase activity "
FT                   /biological_process="tetrapyrrole biosynthetic process "
FT                   /protein_id="CAP97454.1"
FT                   /db_xref="GO:0004852"
FT                   /db_xref="GO:0033014"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="UniParc:UPI000183284E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPM0"
FT                   /transl_table=1
FT                   /translation="MPPTPILLLKTKSSPHDGYEDFFSAHNYTPTFIPVLEHRFLKNNL
FT                   TQVRDLFSTGAFNNATRKYGGLIFTSQRAVEGFAQMIEEEKDVQFNTPTSPPLLLYTVG
FT                   PATARTLTTLRDKHLPNATIHGADTGTGENLAHFILSHYDSIYTTHKPSLLFLVGEVRR
FT                   DIIPKTLMDKALPVDKRVGVEELVVYETGVMESFEGDFADVVGRSDGAVWVVVFSPTGC
FT                   EAMLRVLGLGPFAGSGCGDGAAAGTRQVFVATIGPTTRDHLREKFGFEAHVCAPKPSPE
FT                   GVLEGIAKFMGGI"
FT   CDS_pept        join(complement(387844..387953),complement(387601..387796),
FT                   complement(387147..387528),complement(386736..387083),
FT                   complement(386645..386673))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127077"
FT                   /orf_name="Pc22g01670"
FT                   /product="Pc22g01670 protein"
FT                   /function="ATP binding"
FT                   /function="MAP kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP97455.1"
FT                   /db_xref="GO:0004707"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000183284F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPM1"
FT                   /transl_table=1
FT                   /translation="MGHQGPPAGGSRKISFNVSDQYEIQDVIGEGAYGVVCSAIHKPSG
FT                   QKVAIKKITPFDHSMFCLRTLREMKLLRYFNHENIISILDIQRPRNYEGFNEVYLIQEL
FT                   METDMHRVIRTQDLSDDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVC
FT                   DFGLARSAASTDDNSGFMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGK
FT                   PLFPGKDYHHQLTLILDVLGTPTMEDYYGIKSRRAREYIRSLPFKKKIPFRALFPKSND
FT                   MALDLLEKLLAFNPAKRITVEEALKHPYLEPYHDPEDEPTAPPIPDGFFDFDKNKDALS
FT                   KEQLKLLIYEEIMR"
FT   CDS_pept        join(387961..387989,388089..388186,388285..388318,
FT                   388367..388608,388697..388773)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941380"
FT                   /orf_name="Pc22g01680"
FT                   /product="Putative uncharacterized protein Pc22g01680 "
FT                   /protein_id="CAP97456.1"
FT                   /db_xref="UniParc:UPI0001832850"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP12"
FT                   /transl_table=1
FT                   /translation="MVSLVVSAFGEGRAQFADSESRESNSIAPEVNCPKSSSNLTASAQ
FT                   TLDWVGFERGTWSYEAPGGEDVTGTASRPRRPRWDAKITGQGVCQVGSRYQAQSLRTWH
FT                   VSGIDGDDARVHGEDEPRRRSGVILCGITTGEPGETAGRRGSGGAESFEAAPANW"
FT   CDS_pept        join(complement(392213..392740),complement(390513..392159),
FT                   complement(389871..390446))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941381"
FT                   /orf_name="Pc22g01690"
FT                   /product="Pc22g01690 protein"
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /protein_id="CAP97457.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI0001832851"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP13"
FT                   /transl_table=1
FT                   /translation="MAAPQGGFPPQEGYGQPAYGSPEPTQSPVQGQGAPAPAAAGKKKR
FT                   AYAGEAFDFGSGANAALGGQPTAGGAYGPYPQQPQVAGYQQPVYGADPSQMQPVAPSYG
FT                   APVAADVTQMTQQFGGMGMSEPHHMPPPQPVAQAPMRPQVQLNQLYPTDLRSQPFNVAE
FT                   LDYPPPPIILPPGTSVYPSPEANCPTKYMRSTLNAVPTTNSLLKKSKLPFALVIQPYAS
FT                   LHDAEDPIPVIPDQVISRCRRCRSYINPFVTFLDHGHRWRCNMCNLTNDVPQAFDWDST
FT                   LQKPADRALRADLNHSMVEFVAPQEYMVRPPQPLVYLFLIDVSYASVTNGLLATTARTI
FT                   QESLDRIPNADRRTRLGFIAVDSSLHYFSIPRDESGSSEPQMLVVSDLDEPFLPIPGDL
FT                   LVTLSECRENIEIFLRKLQEMFQNTQNNSCAMGAALRAGYKLISPVGGKMTVLSSSLPN
FT                   AGHGALTMREDKKVLGTSKESSLLQTANSFYKSFAVECSKSQVSVDMFLFSSQYQDVAS
FT                   LSCLPRYTGGQTYFYPGWNAARTEDAMKFAREFSDYLSSEIGLEAVLRVRATTGLRMNT
FT                   FYGNFFNRSSDLCAFPAFPRDQAYVVEVAIDETVTKPVVCMQAAVLHTTCNGERRIRVL
FT                   TLALPTTQNLADIYASADQQAIATFFSHKAVERTLSSGLEPAREALQAKIVELLQTYRK
FT                   ELAGGSVSGGGLQFPANLRALPVLFLAMIKNLGLRKSAQIPTDMRSAALCLLSTLPLPL
FT                   LIQYIYPRMYSLHDMPDNAGLPDPQTGEIVLPPSVNLSSGRLVPYGLYLIDDGQTQFLW
FT                   VGRDAVPQLIEDVFGVPDKSQLRVGKQTLPDVENEFNQRVRAVLEKSRDHRAKGVGSMI
FT                   VPHLYVVREDGEPGLRLWAQTMLVEDRADQSVSLDQWMGSLQEKV"
FT   CDS_pept        join(393689..393977,394040..394449,394507..396057)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941382"
FT                   /orf_name="Pc22g01700"
FT                   /product="Pc22g01700 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="CAP97458.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="UniParc:UPI0001832852"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP14"
FT                   /transl_table=1
FT                   /translation="MSVRVVARIRPLLKSEREVDVIVRTGSSATAESKSRQSISNRSDK
FT                   SDKSDKKLAALRDRDNVVRIPNPKNEGEEYAFQFNGVYDAEVSQQELFDAEVAPTIKHL
FT                   LNGFDVTLFAYGVTGTGKTHTMRGGKTLADRGVIPRLLSGIYRRSRKIEKDSNGETTVQ
FT                   VALSYYEIYNDKVFDLFEPPEKRTMSGLPLRDNGGKTVVCGLSEKPCTTLKEFEQLYDQ
FT                   ANTNRSTSATKLNAHSSRSHAILGVKVTVTSPDKVRVSTASAIDLAGSEDNRRTENDKE
FT                   RMVESASINKSLFVLAQCVEAINKKQHRIPYRESKMTRILSLGQNNGLTVMILNLAPVR
FT                   SYQLDTISSLNVANRTRKIEVREVENDPMFKGPPRPLNRPSMGTRQPLRALTASVNVNM
FT                   PAPAPKDSAEKEDGKPVKAFSVYSDKPQTKLVSQLRKPEAPKRTSISNTPSGLPSLKSA
FT                   RQPLGAQSTARHEDFSAARIEEMVEKKVEEILAVRAVSEKSRQTQAHELNEQLQKRLEQ
FT                   LEQRIDGTEDVRAEGLSYLLMAKQHQARGEDSSALRMYQLAAPHFPHNEKLAGKIAALK
FT                   ERVHAKAWEEKPHSPPKGRLGSMLSLKKDVTQTLGKRQAEDDYIDQTYACFSSDEDVPR
FT                   PKHKKRAAAKLGQIEEAPELLDSEDPSTSPRTMHILSIINSRDVSQIKLLKGMGAKKAE
FT                   ALVDCLCEMDQAPLDTTDSAIISDHQFQVSSLAQLSQLKGVGVKTVENMRQGVLA"
FT   CDS_pept        join(complement(397108..397560),complement(396434..397033))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076747" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976020"
FT                   /orf_name="Pc22g01710"
FT                   /product="Pc22g01710 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97459.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001832853"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP07"
FT                   /transl_table=1
FT                   /translation="MTSMFSGLYDLLQAVRGVNSTPLTDQHVPGTNLTDKWIIISGSNN
FT                   GVGFEAAKSFASWGANLILACREPPAWEQHPTAAVNECKDLAAAHGHSSTIEWWPIDMA
FT                   DLGSVDAFCQRWLQCDRALHILCNNAGIAESTVQTRITKDGFQLVHQVNFLSHVLLTLR
FT                   LLPSLARSAEPRIICTTSCYHHLGVFDLDRVNGKQSWKGNDYQNNKLYFQMWVAEMQSR
FT                   LLKHPEYIHITINGVHPGFVASGIWEGLEDAGKAPGGLGLLLRYVAITSQQGGLAIAHA
FT                   ATGLEFGPDPKTQGVGAENGHDGGKYINRIWEAPAKSYCNDPEARSRLWTKLDEELGLQ
FT                   EKGLLTVLGL"
FT   CDS_pept        join(398162..398296,398358..399605)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076531" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822810"
FT                   /orf_name="Pc22g01720"
FT                   /product="Pc22g01720 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP97460.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001832854"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP08"
FT                   /transl_table=1
FT                   /translation="MGMWSCDIEDCDKSSVRTDGECILCCRHLCAEHLKPEYHTCPLWE
FT                   DEKSYDPAANRAEQEEINKLLAKINITALTDRASYLRKGVSCSISQNLQYDLSTRNSVM
FT                   GGMNYHIEISFDDGVCWLARVRRFNVTSPPLELQNYIMRSEVATLEFLGETKIPAPKVF
FT                   DFSLDEANPVGVRYILMEKLPGRSLSWSDATREQRLKVIDQLADIYIELHAHPFPMMGS
FT                   LDKIDSKLFIGPFARETLADFGESGLKMLGPFSSSEQYYNAHLDLILDLIMRQEAYANR
FT                   PIDAFLIHRYLQENIPIILPHASLDDASFYLKHADEKGDQILVDDQFRITGIIDWEWAH
FT                   TGPKFSVFNSPIVLLPLAEFYSGNNCLGDEEMTFSHLLEEKGHPDLGDIVRKGRLLHRL
FT                   QFCCGYDLPDWDGYKDIFMGLVRALHKDGNSNNLDYETWKADAIQRYSADPRLEKLAIL
FT                   YG"
FT   CDS_pept        join(400328..401509,401598..401683,401713..401861,
FT                   401910..401968)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211999" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941383"
FT                   /orf_name="Pc22g01730"
FT                   /product="Pc22g01730 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP97461.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001832855"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP09"
FT                   /transl_table=1
FT                   /translation="MSEVTHPSFCRVEFKLFYDWNGDRPTQILIFRQNEFSWWIKVVVD
FT                   WSLPELITELGYFQRRSLFQMFLQAIDFGQMQLLQNTVTKITLSLTDQNQNLITIRDGF
FT                   QATTNYFIVVAHRLRYEIAEDPTRVIYPNLDRDLNIPTFEASCLQNAEFLAPTVFTVLF
FT                   KQHKFAYKTIDRPIYEPGDTEHIMNEIDALAQFRGQPNIAQLVGLVASENPYKTCSSTK
FT                   LPAVVTGFLLEYYTGGSLERSINEDEMRNDSLPIRWAIQIGTALESLHTSGRTHLDIKP
FT                   SNIVLDANKNAILIDISGTGGYLWEWLSPEMQILIQQNIDITPANMPFGVRVATDCWAY
FT                   GRLLSTIAEKCPPGGTGEKLRFIGEALNKAAPESRISLCDALAQLEDNRRLRIGELEQN
FT                   KSPLGSWSLICLKKNKRIFEYDRTYLREDKTPIVVSPVFPVLPSGCSVSKKRQGLSTKM
FT                   QMEGQEVAEEINYIVQNKSWTRIIKAVPPAQMR"
FT   CDS_pept        join(402425..403474,403528..403626)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000166045" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941384"
FT                   /orf_name="Pc22g01740"
FT                   /product="Pc22g01740 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP97462.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI0001832856"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP10"
FT                   /transl_table=1
FT                   /translation="MKLLTLSLLAASPAAARSYLSWMADSWILNNQEHEGPYWYGRATI
FT                   YEGYEAAYSLYGNETLLNWYQSQIDDLVAPDGSIADFNETYYSLDDYRIGNNFLYWYER
FT                   LGEEKYRLAADRIRAMLDRHPRTPTGGFWHRDPTYENQMWLDGIFMADVFYAKWTALFD
FT                   AQNVTAWEDIVLQWDKIEAATRDEPTGLLVHGFDESKTAVWADPVDGASPLVWNRAVGW
FT                   YFVSLIEVLDVYPKHLDGYQRLLGYYKRLARGLLRTQDPEVHGWKLILSKGYVNRKGNY
FT                   FESSAAAMFAYGWLAGLRRGYIDERTYGRPAARAYNHLIDDFVTKHQNGTLTWEGTVQV
FT                   GSLNSDASFEYYTAIPVVPNDTRGVGPFLLAAYEWELRQKRS"
FT   sig_peptide     402425..402472
FT                   /db_xref="UniProtKB/TrEMBL:B6HP10 "
FT   mat_peptide     join(402473..403474,403528..403623)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP10 "
FT   CDS_pept        join(complement(405731..405754),complement(405372..405493),
FT                   complement(405229..405296),complement(404914..405179),
FT                   complement(403841..404860))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976021"
FT                   /orf_name="Pc22g01750"
FT                   /product="Pc22g01750 protein"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="CAP97463.1"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="UniParc:UPI0001832929"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP11"
FT                   /transl_table=1
FT                   /translation="MAILKLKAAYVKRNEEVNSTVRAVVEINPDAWKIARDLDDERKNG
FT                   ILRGPLHGLPILIKNNIATDDKMQTNAGSYALMDAKPGSDSAIAAKLRKSGAIILGKTN
FT                   LSQWANYRSGNSSNGWSAWGGQVIAAHVPNQDPSGSSSGSGVAADLGLAYACLGTETSG
FT                   SITSPGEKSGLVGIKPTVGLTSRYLVIPISEHQDTIGPMTRTVEDAALVLQAIAGQDGH
FT                   DNYTLAAPYKHQTPDYVKHCKMNGLKGKRIGIPRNVLDLNYDSSRAPYYAAFEAAVNVL
FT                   RDAGATIVDNANYTAYEEFIQDPSETVLQADFISGLADYLSNLKTNPHHVHNLEEVQSF
FT                   THRYALEEWPTRNTAIWDEALQAGINNTSPEFWPRYLKNLYYGGEGGVFGVINRNHLDA
FT                   VVLPTDLGYPVSAVVGGPVITVPMGAYPVGTPVELSPPWNLTSVAPGVPMGLGFMGLKW
FT                   SEPALIEMAYAFEQRTQARKTFDHYIVPKTQLKMAESVSTD"
FT   CDS_pept        complement(406316..407260)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976022"
FT                   /orf_name="Pc22g01760"
FT                   /product="Pc22g01760 protein"
FT                   /protein_id="CAP97464.1"
FT                   /db_xref="UniParc:UPI000183292A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP15"
FT                   /transl_table=1
FT                   /translation="LNPIKEKVDFILNSATTISTIYKLEYYSYYXPITTLVRXGKANTI
FT                   KVTYKGDIYIKTNTSVIYLLKDIYYIPNLGINLISIYXLYNLITLFIKNKVYLYIPLKK
FT                   IVTITIKRDNLYYINTTILKKAINTTLVDTKPNYLNITTTSNNSYILKRTINNSIINTI
FT                   KLXYIRLGYINIXALRILLLNLLRIKISLEEIKAFLKEKYKVYLLSKNNRNIYRKLDNP
FT                   TKYKILDRIYSDLGRPLLPTYNKYRYYITFLDKKSRYLXITLLYNKLDTYKVFKNYKAL
FT                   IKNIKNKRIK"
FT   CDS_pept        join(complement(408989..409256),complement(408825..408931),
FT                   complement(408191..408774),complement(407700..408129))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976023"
FT                   /orf_name="Pc22g01770"
FT                   /product="Pc22g01770 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP97465.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183292B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP16"
FT                   /transl_table=1
FT                   /translation="MANNETETTPSIDSATTTPAVSVHGNNDPEKGIAPSEKHEAPPPT
FT                   EKSIAAGPAPATPVISPPPDGGAQAWLVVLGAFCGLFVSFGWINCIGVFQAYYQSHQLS
FT                   EFSTSTVTWITSLETFMMFFCGPIFGTMFDSYGPRWILLIGTILHVFGLMMASLSTEYY
FT                   QFILAQGICSPIGASAIFNASVNSVSTWFAKRRAFALGVTAAGSSLGGVIFPIMVTQLI
FT                   PKVGFPWAMRICAFLILFMLGIANLTLKSRLPHRPKPFDILSFLRPLAELKFALTLAAA
FT                   FCFFWGMFLPFTFVITQAERYGMSSNLAGYLIPILNASSIFGRTLPGYLADKVGRYNMM
FT                   VITTFFSAILVLALWLPSKGNAPAIVFSALYGFGSGAFVSLAPALVAQISDLRQVGVRN
FT                   GTFFAVISFAALTGTPIGGALVPDVLHGSYTRLQIFCGVVMIVGSTLFAFARGAVGGFK
FT                   LTKV"
FT   CDS_pept        join(complement(411689..411854),complement(411514..411632),
FT                   complement(411379..411450),complement(411153..411323),
FT                   complement(410987..411105),complement(410713..410932),
FT                   complement(410316..410660))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216637" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941385"
FT                   /gene_name="aim24"
FT                   /orf_name="Pc22g01780"
FT                   /product="Altered inheritance of mitochondria protein 24,
FT                   mitochondrial"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAP97466.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="UniParc:UPI000183292C"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HP17"
FT                   /transl_table=1
FT                   /translation="MRPLQGVRTLSWTRVVPRAHRQTRYIQIRAAPSGVPSVNGDNLPL
FT                   ASTPSSVESRDARFDVVGAPYSLLSVSLSASQNLYTRRGTLVGLSGKADNVVSTLSVLE
FT                   PFRRAIVGVPFLYQKISSPSPVTALVSVRSPNTSFAVVNVNGSVDWMVAQRRALLAWTG
FT                   RSLNIKPTINANLSLSHWGSSEVTGRGLIALVGNGQLYSVELKDGEQYIAHPSNVVAYT
FT                   MASNPPRPYRFKSTTLNFQVPGLKTLPRLLQNAKFVRDVSDSKAYKTTMQWFHKLRTWS
FT                   RMTIWGDRLFLQFDGPMTILVQSRGPRLNDVLSAQEANEIANVPSGFTSPPPRSTEGEK
FT                   TEKNPLEDKPEEEKTEAEKAVSNISGLTRSVAELEQEIQGTSRSVAKLRKDGKVEIEEV
FT                   ARSN"
FT   mat_peptide     join(complement(411689..411764),complement(411514..411632),
FT                   complement(411379..411450),complement(411153..411323),
FT                   complement(410987..411105),complement(410713..410932),
FT                   complement(410319..410660))
FT                   /gene_name="aim24"
FT                   /product="Altered inheritance of mitochondria protein 24,
FT                   mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HP17 "
FT   transit_peptide complement(411765..411854)
FT                   /gene_name="aim24"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HP17 "
FT   CDS_pept        join(412254..412619,412793..412907,412958..413226,
FT                   413288..414331,414402..414618,414671..414744)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18127078"
FT                   /orf_name="Pc22g01790"
FT                   /product="Pc22g01790 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97467.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000183292D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPA9"
FT                   /transl_table=1
FT                   /translation="MLLRAARSPCWRTAQFAHPSFAGKLRSTRLNGTHLRAFTSNNNPL
FT                   WSQSADNKGRAVKATPTSTPAPSQLANANVIQKPEDSGNAKTPPKKDLLSEPMTGKQEQ
FT                   RKADWAIMKEMAKYLWPKILNVEIPFYFKNIVDSMNVDFAAIGGTAYTVAGSMIIAYGV
FT                   TRIGATLFQELRNAVFASVAQKAIRKVASNVFEHLLRLDLNFHLSRQTGGLTRAIDRGT
FT                   KGISFLLTSMVFHVVPTALEISLVCGILTYQYGLQFAAITTTTMIAYTAFTITTTAWRT
FT                   KFRRQANAADNRGATVAVDSLINYEAVKYFNNEKFEVARYDKALKRYEDASIKVTTSLA
FT                   FLNSGQNMIFSSALAAMMYLACNGVANGSMSVGDLVMVNQLVFQLSVPLNFLGSVYREL
FT                   RQSLLDMETLFNLQKVNVTIQERPNAKPLQLQGGQIRFENVTFGYHPDRPILKNATFTI
FT                   PAGQKFAIVGPSGCGKSTILRLLFRFYDVQSGRILIDGQDIRDVTLDSLRKTIGVVPQD
FT                   TPLFNDTISHNIRYGRIDASDEEVRRAAERAHIHELIERLPDGYQTAVGERGMMISGGE
FT                   KQRLAISRLILKDPQLFFFDEATSALDTYTEQALLQNINSILKEKSRTSVFVAHRLRTI
FT                   SDSDQILVLKEGHVAETGSHRELLERDGIYAELWNTQEQSMDQDIDLEQDQGEDVPPKA
FT                   "
FT   CDS_pept        join(415437..415618,415670..415995,416063..416403,
FT                   416461..416694)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217247" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127079"
FT                   /orf_name="Pc22g01800"
FT                   /product="Pc22g01800 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP97468.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000183292E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB0"
FT                   /transl_table=1
FT                   /translation="MDLSLYCQSNLLYTQESLSKYQPGGYHPVNLGDTFENDRYKIHHK
FT                   LGWGGFSTVWLAKDRDRNQWVSLKIMTANSSISRELENLKFLERQSRRGLSSDYVVQLL
FT                   DAFPHKGPNGVHQCLVFELLGPSVDKVLSDYHESHDKLYPETVLRVSTQILKAVKFIHS
FT                   VGMCHGDISGRNIAFTCTHLSKQTEEQLFDVLGFPEIEPLERIDGTPLGNELPAQLIKA
FT                   AEWTEWIDEDDEDIRLLDFGESFYQGQEPQKLAQPGSLRVPETIFTDCFDYRVDLWRTG
FT                   CMIYSFLFTTWPFWYLGEDEVLIFQMVGFVERLPAEWEPKWESMQMASSHNLELEEGNK
FT                   TDPTYRIVANFARRLWNLEA"
FT   CDS_pept        join(417788..418007,418061..418296)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178297" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670044"
FT                   /orf_name="Pc22g01810"
FT                   /product="Pc22g01810 protein"
FT                   /function="RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAP97469.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="UniParc:UPI000183292F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB1"
FT                   /transl_table=1
FT                   /translation="MVGRYLLPLPSDDEIEVLEKKIQYRFVDRELLREALQASTDRNQD
FT                   GNKTLALFGDLVLDLVLAISGRKENKPRGKIKEMSTQKAGNVHLSKQGFDLGIDKFIVK
FT                   NPSQTVVGINVMATTMEAIVGAVYLDCNKQIAPCADVMVALGLSWPE"
FT   CDS_pept        join(complement(423941..424402),complement(423680..423780),
FT                   complement(423010..423618),complement(418822..422962))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127080"
FT                   /orf_name="Pc22g01820"
FT                   /product="Pc22g01820 protein"
FT                   /protein_id="CAP97470.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832930"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB2"
FT                   /transl_table=1
FT                   /translation="MAEVVGLVASIAGLVQIAGQITKLSYSYVSDIKSAPKTQKLYLQE
FT                   VSALTDVLFRVEKAIQEAESTGLELPLCPSSLNEDILQECRRHLSVLHLDLDKRLRRLG
FT                   WPFQEKDVKKYIDLLHRYRSIFADFLSTSIMFEDPSHICNHLKSRTNLQQTKCLSWDWE
FT                   MVFEFPKRGELAYRSPITALVLRSPWRRQIATFVRTARNLPRMALQCLTQATSSMTIGH
FT                   LSDKRSETTSSVVYVFCQFSSREQQSLTAILQCMIQQVIEQGDQRVLLAMKHLFMDPMK
FT                   QREPAGLAESFATACDLKSTYLLVDGLDEVPGADGLLPYLSSFVENGCRVMVTSRDLGH
FT                   IRKAMDSATKMEICSQFEDLEIYIDSRFKENELPRGAQKLIGKITEKSGNMFLHTKLIL
FT                   DEILDLTTVRHMQKALEKQSTGLDQVYQSTLQRIDMQPVARRELARRLIGWVVFAKRRL
FT                   KIDEVIHAFAVESDEDYIEEDNFVSPDLLLRSCVGLVVLHDDNTVAMVHATAYDFFEST
FT                   VLLPHDIETDIAETCLRYMCLSPFREGPCTSRVQMSRRFHEMLFLDYASRHWARHLNEI
FT                   EKVEEDLSSLVQFFISNERLLNAAVQALHFRNELEPDLLDSLFDSIPQNQTALHVAAYW
FT                   NLTGTIGSLVESGLSTSLADTHGWTPLHYSCANSHFSSSEILVRNGADVDATDDQDWTP
FT                   LFWASFTGSLDIVRLLLSAHAKYTKRSKYGWTALHWAISRGQTEVVLELVQHHQTQLSR
FT                   VTEADIRTLSVDDVRQLNTPENISPMQIAAESKNALIFDLLVAHFEETGSTEEKDFRRF
FT                   WSRESFKVPVAQSTWRNTMKSHKYEYQGRATQLIAGERYIQEDPSSYFKDELIKEDPST
FT                   WKSILLASAIQDADFQAAKLFIQLGADVNYVSEKGSLLNVAAHQRDPRFVQVLLEKGAE
FT                   GLPTESDESALHTAIDLGNLATAKVILDSEHAQVDSWYYGKTPLHAAAGQQDPRFASLL
FT                   LSKGAQPDLLDAYQRPALVIAVDNGLVETAQAVIEGGADVNQLSWMWIHNESGWQNCLN
FT                   LAVFLAGGDTEEPENRNSATEMARMLLSKGADLGFQDEEGKTALHVAAMCRSVGCIELL
FT                   MAAGSKIHTVDRLGRTPIHTMMESVLPSWDVEEVEEALRLLLRGLSEEAVVLLLSQQTC
FT                   QLTSRGSLCEEDEDESQLFTPLASALRRKAWSIARLLMALGAQPPTSLSFRPTVMDAVR
FT                   DLECQIVETLIGSGVSPGGDSVLELVNSIDDRLFAEPSSLLSSPRKKITLSKIKYYFEQ
FT                   ARAKARLQNRNIPHEEIAQASQQILTSLVSAGADVNFYDSEANATPLLLAAEKIPIAPV
FT                   TATLLEVGADCFYSFGSRLDPILTAAAANNTDSLRCLIAHASTSPKAGHWTQHLEYRGQ
FT                   LSTKEVFDCVCLALKRAEKLNYKYANDQTLLHIAADRGNVDLVTSLISHGAHADTPDED
FT                   GFFPIHCAAFSLYGSGHGERLHWPRYHDTVKHLLPMNIVQHTSDHHPYRSVEARAFLQD
FT                   AEICQEISNIRNENGSTMLWGALEYCNDTMFVHLLKLEEDLNSCVTFLGYHPSLLYHAS
FT                   ARGMTEAVSFLLECNVDIEKTDSCGWRPLHVASEWGHVAVAERLIAAGANVCASTAQYH
FT                   DESYTGSNLEGEEWNGHPLHLAVMGGNVEMVGLLLKHGADVNANAGCFKGSDGRTRGPT
FT                   ALHMALDPRAWYPRDREDKDDEHLTDDHEDYLKIARILVEKGASVEGVLDQLQVHHIPS
FT                   FEGFEDVWDKIRGV"
FT   mat_peptide     join(complement(423941..424345),complement(423680..423780),
FT                   complement(423010..423618),complement(418825..422962))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB2 "
FT   sig_peptide     complement(424346..424402)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB2 "
FT   CDS_pept        join(425615..425951,426007..426098)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941386"
FT                   /orf_name="Pc22g01830"
FT                   /product="Putative uncharacterized protein Pc22g01830 "
FT                   /protein_id="CAP97471.1"
FT                   /db_xref="UniParc:UPI0001832931"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB3"
FT                   /transl_table=1
FT                   /translation="MSFSHKEPEVLPSGNTAPQVPQQDRTSQSLSQRVSQPENSESKDY
FT                   AMNSGSVENKENAEKTMDQGRRGTAAIMEDHHVSREALKGPQGQPPRTAEEFKKEGETS
FT                   RAADESHSGDSTEAKGSRGKQGTMEKVKERLAHPLHGK"
FT   CDS_pept        join(complement(427084..427200),complement(426636..427029),
FT                   complement(426341..426606))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076751" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941387"
FT                   /orf_name="Pc22g01840"
FT                   /product="Pc22g01840 protein"
FT                   /protein_id="CAP97472.1"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI0001832932"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB4"
FT                   /transl_table=1
FT                   /translation="MAFAGVFRAFFSLVALILILLCAFAGSHRYFFATADIVKIHLPDP
FT                   TGGNMPQHLSIHVMSICRGTKNNITDCTFLRVPVHSLQTSVLANTQGVLLVEYTISRLA
FT                   ALARTSRLLSTFYVIAIGASGLSSRYWITSFRRGNLGWHLHAAPKHALASNPDLPPSLV
FT                   EFLSLAVTTLTLFSLQTSTFSMYIASTIASIISEEFVYLINTDGNPYGVSASHGDYFLK
FT                   LSWTARTIQYLVVIESFISILKPRIGYLLCDETGFH"
FT   mat_peptide     join(complement(427084..427125),complement(426636..427029),
FT                   complement(426344..426606))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB4 "
FT   sig_peptide     complement(427126..427200)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB4 "
FT   CDS_pept        join(428605..428809,428860..429670,429727..430177)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000182646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941388"
FT                   /orf_name="Pc22g01850"
FT                   /product="Glucan 1,4-alpha-glucosidase BAC8255-Penicillium
FT                   chrysogenum"
FT                   /function="glucan 1,4-alpha-glucosidase activity "
FT                   /biological_process="polysaccharide metabolic process "
FT                   /protein_id="CAP97473.1"
FT                   /db_xref="GO:0004339"
FT                   /db_xref="GO:0005976"
FT                   /db_xref="InterPro:IPR000165"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI0001832933"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB5"
FT                   /transl_table=1
FT                   /translation="MLTLNVLTALLAPGVLSSALPARDLNARADSKPAALQAILNNIGA
FT                   DGSAVSGASAGVVVASPSKSDPDYFYTWTRDAALTYKVLIDELIAGDTSLEPTIQDYVS
FT                   AQAKLQAVSNPSGDLSDGSGLAEPKYHVDLTAFTEAWGRPQRDGPALRATALITYGNYL
FT                   ISKERTSVVKSNIWPIVQNDLNYVAQYWNQTGFDLWEEVEGSSFFTIAAQHRALVEGSA
FT                   FAKALGESCEGCDSQAPQVLCFQQSFWDGKAIVSNFANNGRTGLDANSVLTSIGNFDPK
FT                   APCDDVTFQPCSARALSNHKLYVDSFRKIYPVNSGKEAGTAVAVGRYSEDTYMGGNPWY
FT                   LTTLAAAEQLYDALYQWKQLGSLEITEISLPFFKDLVSSAAAGKYPSSSETYTSITAAV
FT                   KKYADGFVAVVKEHTPSDGSLAEQYTRDNGSPASAKDLTWSYAALLSAARREAGTVPPT
FT                   WGASTANKVPSKCEGSSAKGSYTTPSVGKW"
FT   sig_peptide     428605..428655
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB5 "
FT   mat_peptide     join(428656..428809,428860..429670,429727..430174)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB5 "
FT   CDS_pept        431030..431806
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941389"
FT                   /orf_name="Pc22g01860"
FT                   /product="Pc22g01860 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP97474.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001832934"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB6"
FT                   /transl_table=1
FT                   /translation="MEIVQKNEAFKRVDGEMRFSYVQVFVRKDGMLYSGKWANRFALPE
FT                   TLDGLQEVKQIPIEDRGPEVDATWSAVHVKTPSLLAYADGNLDKQITREIRTCETLRKN
FT                   PHPNIAAYYGYTESCGRVSGLCFKRYPSTLLEAVNPRRLGKAAFLSSARDLVRENMKTS
FT                   LDGILAAIKHLHSLGIVHNDINPANIMLDEDGTFILIDFDSCRYIGEDLRITNTKRTHH
FT                   WHDPAVGISLVKNDLDAFRELQIWLAGSSDEEFNFV"
FT   CDS_pept        join(complement(433907..434251),complement(433618..433848),
FT                   complement(432654..433550))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187465" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127081"
FT                   /orf_name="Pc22g01870"
FT                   /product="Pc22g01870 protein"
FT                   /protein_id="CAP97475.1"
FT                   /db_xref="UniParc:UPI0001832935"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB7"
FT                   /transl_table=1
FT                   /translation="MRNKTFDPLHLINFTDSVDYRPVSPEGLDVNSLSQNRSRYISKLS
FT                   NCSSSWPAGSLDASCPCPVLTTQRHDDDMRNLHLALKSAIEDIIKRWWTDREARFPLRM
FT                   PLESEEEDLLRWLDSNRDLLPLWNERQGSWRPDFLVEKDDAGIEVFRICEINARFCWNG
FT                   YMHAGFGQDSLSAFNLGSRGLVHTVEGETILGGLLDLFDSKIPLHLVKSEEHGIDIAMF
FT                   IEFAQKRLGIKPRLITPDTLRLIPDASQSGKEGYKLCCLAEGDAIGTITTESGEIVEEI
FT                   HQISLELHQREINALDPEMRRQISLRCFNDMRTILLAHDKRMLGLVLEELNDLVCRNVI
FT                   TSKQAEWLRRGLAHTILPGSTALDGFIENCKASDVFQTDYLLKPIRDGKGAGILFGDEV
FT                   DHSEWLALLEPLRCPRLRPGKTLYVVQRKVHQPYYDVPLGSKAKLERCHMVGTYHAVNG
FT                   HYLGLGVWRCSPGRLCAVSNGATWMCSVKEGS"
FT   CDS_pept        join(complement(435405..435474),complement(434531..435357))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187453" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127082"
FT                   /orf_name="Pc22g01880"
FT                   /product="Pc22g01880 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97476.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI0001832936"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB8"
FT                   /transl_table=1
FT                   /translation="MHRLFRVVHTAKVTTASYSTHPVRDLRTSTLVPLIEVAKPALASD
FT                   ASHLRDIYETLEAKGILQVQLGFNDENSTYLRSLISNLHKNHNHGLPITHSAERGWFWD
FT                   VRPSPTSFESHQTRSETMFRFEWHTDCSYEEQPPRFFALQVLQPDRYGGGTLSVLNVDR
FT                   LLTLLSPFAQRWLSSYNYKINVPPEFTKTARTQYIVGNLLAVNLSQSSGSRLRFREDIT
FT                   VPLTLDASKALDELKEILYSGAQEESLHLPPQSLPQGSIIMMDNRRWLHSRNEVKDPNR
FT                   HLRRVRWDATPFGPCGS"
FT   CDS_pept        join(436252..436433,436485..436718,436775..437750)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127083"
FT                   /orf_name="Pc22g01890"
FT                   /product="Pc22g01890 protein"
FT                   /protein_id="CAP97477.1"
FT                   /db_xref="UniParc:UPI00018329F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPB9"
FT                   /transl_table=1
FT                   /translation="MTTERYSLAEVLAVAKTHPFYNPDIVYPADAETIENLRKAVTDQK
FT                   EKPKLIEQPLLEKKALYKAIERLTHDVNPRNTYRQSSYMSITGGGSGGVPMMFAVDVHE
FT                   NRRQRSQMGEFLKLCGVSQPGDWVLSIHTAGGFYRSLDLMTEIMENAGATVLSAGSYMP
FT                   PKDVAKSLADYHVNILAGDSSHVVQTVYHISLMAKEDRDRVRLDKIIYTSEPLTGPQRA
FT                   FIKTILGEVKIISVMGSAEAGPWAISSPDLTGEQSLTSNSTDFVIDTRNMVVEIVSPSV
FT                   IDGVSTPNPILLPQGEEGLIVQTSLQRLRNPLVRYVTGDIGSLHPLPSAACAVIPEADW
FT                   GHLRVLRMHGRDPRFSFKWFGGYFEFDRISAFMQEEECGILQWQILLGRLESSPQATLE
FT                   IRLLRSPLRDGILSDDALIKRVEAFFIVLPENEPLFRVVFLDGLGGFERSATAGKVIKF
FT                   VNQWD"
FT   CDS_pept        join(439099..439126,439232..439419)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216638" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670045"
FT                   /orf_name="Pc22g01900"
FT                   /product="Pc22g01900 protein"
FT                   /protein_id="CAP97478.1"
FT                   /db_xref="UniParc:UPI00018329F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPC0"
FT                   /transl_table=1
FT                   /translation="MGLIDKLQAKLELYRLEQRYARRKHRSTFSTGAQYVDGEYVYSGA
FT                   RSPTSTVSKHSTGSWRPSGWGSQTSR"
FT   CDS_pept        join(440556..440623,440693..440855,440915..441085,
FT                   441141..441828,441879..442675,442725..442829,
FT                   442884..443006,443189..443299,443371..443853)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216640" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976024"
FT                   /orf_name="Pc22g01910"
FT                   /product="Pc22g01910 protein"
FT                   /function="binding"
FT                   /protein_id="CAP97479.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR021841"
FT                   /db_xref="UniParc:UPI00018329F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPC1"
FT                   /transl_table=1
FT                   /translation="MDQAIQRLLNDKLYDRRKQGALELEKIVRDAVFQGEQEKIQKIVE
FT                   QLCHDYAYAVHQPHARNGGLIGLAAASIALGSEGVAPYLGEIVPPVLACFSDQDARVRY
FT                   YACESMYNIAKVAKGEILLFFNEVFDALAKLASDSELSVKNGAELLDRLVKDIVAESAA
FT                   SYVSILQLPEKEATELENQEDQELPMAFSLARFIPLLKDRIHVIQPFTRNFLVSWLTLL
FT                   DTIPDLELVSYLPEFLEGLIKFLGGPNKDVNIATQGLLDRFLAEIKRITRLKKGIEESR
FT                   KSQKSNRQSVASDVMSNATEQNAQTDGASDDRYDVAVADSVSDTTVDDEIAQADGDWIP
FT                   GQDVQIDHPKILDILVGFVNTSYEEEMQLTALRWLDSFFEISPEDILPFVPRLLTQVLP
FT                   AMSSGSDQVRKAANQVNTSLVQYIYSLSDDTTEEAQAPSSKIPSATASKETIERRSSTP
FT                   GVRPSETASSDTKKQTVQENSVAATPRSSVVSTPLPPADLDYAAAVNSLTLQFLNENEA
FT                   TRVAALVWLIMLHRKAPRKVVAFNDGTFPALLKTLSDPSEAVVTKDLQLLSQISRNSED
FT                   SYFTSFMVNLLQLFSTDRHLLEVRGNLIIRQLSLNLSPERIYRTLADCLEKEEDLEFAS
FT                   IMVQNLNNNLITAPELSELRKRLRNLDSKDGQMFFVGLFRSWCHNAVSTFSLCLLAQAY
FT                   EQAYNLLQILSISASNFLNPKNTPSSTNVSTASSCSSPRAPPSPPSRTSILRFTETNFP
FT                   STTQTAPPFDRSTGTRLKPRDENSIRWVELLDKFKSVQERARRSQGSTRQSFDQSGPIN
FT                   NPSLTAALSVAAADRPKDRSGLPDAPRGAPGPSNAAAGNAGLGGSGAGVSGTAASRALD
FT                   SAAKGASSTQRHRSGLPNLGRLGIGGRRSKK"
FT   CDS_pept        join(complement(446177..446857),complement(445885..446116),
FT                   complement(444262..445808))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204521" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941390"
FT                   /orf_name="Pc22g01920"
FT                   /product="Pc22g01920 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="CAP97480.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR013967"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00018329F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPC2"
FT                   /transl_table=1
FT                   /translation="MPGRYRQRPAGGDNNSVKTPLQPKSVNSQNSIDRLVRPFKCPGSA
FT                   TPTRASEKPSRKRRKVNYANADGSVEDGEKPYTNDDRLALETREANKFPAYKPKDKEVA
FT                   FRQRFQVPFLNKATGEYSSGRVAPTLGMRRGATFVVKPLHDPSGEFAIVLYDPTVDDVA
FT                   EEPAPENQEAPTEDTPKLDEPIVHKSLADILGLKKNVEDRPKVPVVIDPRLSKVLRPHQ
FT                   VEGVKFLYRCVTGLVDKNANGCIMADGMGLGKTVSLGNPDFRTLVLTNTASMHRIDVDA
FT                   TQAVLRSRKNHHSEMCDCMSVKFVKWLGKDATTPFAIDGKATKAELISQIKQWAIASGR
FT                   GIVRPVLIVSYETLRMYADTLNDTPIGLLLCDEGHRLKNKESLTWTALNQLNVTRRVIL
FT                   SGTPIQNDLSEYFALLHFANPNLLGSQAEFRKRFELPILRGRDAAGTDAEKKLGDERLQ
FT                   ELSGIVNKFIIRRTNELLSKYLPIKYEHVVFCNMSEFQRGLYNHFIKSPEIQSLLRGKG
FT                   SQPLKAIGILKKLCNHPDLLDLANDLPGCEHAFPEDYSPPDSRGRDRDIKSWYSGKMMV
FT                   LDRMLARIRQDTNDKIVLISNYTQTLDLFEKLCRSRGYGSLRLDGTMNIKKRTKLVDTF
FT                   NNPDGQEFVFLLSSKAGGCGLNLIGANRLVLFDPDWNPAADQQALARVWRDGQKKDCFV
FT                   YRFIATGSIEEKIFQRQSHKQSLSSCVVDSAEDVERHFSLDSLRELFQFKPDTRSDTHD
FT                   TFKCKRCRPDGTQYIKAPAMLYGDTSSWNHFVNTGEKGPLHQIQDLLLRQETGEQDVSA
FT                   IFQYISH"
FT   CDS_pept        447863..448381
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670046"
FT                   /orf_name="Pc22g01930"
FT                   /product="Putative uncharacterized protein Pc22g01930 "
FT                   /protein_id="CAP97481.1"
FT                   /db_xref="UniParc:UPI00018329F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP45"
FT                   /transl_table=1
FT                   /translation="MRLNQLLARKKADKGKGKAVVPGDASAATISKGKGKSKATPVPAT
FT                   PVKTAKGPKTRSKSTKKRLATDIADKRGGRGEKKKKAKNTPAPPSASYTTPRSGPSFDK
FT                   ELYATPLDWPAISRSEDSDWFNDVFARLREVRDRVRYDIDAMQNLGFARGWINENDVVD
FT                   SDKLEVMLF"
FT   CDS_pept        complement(448477..449319)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941391"
FT                   /orf_name="Pc22g01940"
FT                   /product="Pc22g01940 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP97482.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00018329F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP46"
FT                   /transl_table=1
FT                   /translation="MPTPPIPNQRLEILEKAESYEDSDEGYQFAGTLVLYRLNGLLLHG
FT                   RLKGRSSSPSDINADDIINVKQIPTSAYNPDYSIEFTLAPENLLNSCYIKKPQLLSYDR
FT                   VSEGPRPNSIAEDVLKEARVCEVLMQHPHPNIATYLGCQVSNGRITGLCFEKYPRTLMK
FT                   EVDPGALMKRALRNTREVSEDYSRVLIDVESGLHHLHSLGLVHNDLNPSNIMVADDRAV
FT                   IIDFGSCRKIRESLEDVGRTYEWHDEKIQQSLPENDLTALEEIRIWLGLSLGVFQFDV"
FT   CDS_pept        join(449388..449431,449505..449641,449764..449813,
FT                   449897..449977,450140..450244)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670047"
FT                   /orf_name="Pc22g01950"
FT                   /product="Putative uncharacterized protein Pc22g01950 "
FT                   /protein_id="CAP97483.1"
FT                   /db_xref="UniParc:UPI00018329F6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP47"
FT                   /transl_table=1
FT                   /translation="MGRKGELFFGTDVESWKTAVCAVLVTANSTYLPKASEKCVGTNDQ
FT                   YGSERMAYFLGANEGWVSRKVRLLARGIHRRDEMGKVYVSSAVAGQSITSSGQLLYNHV
FT                   LSGSYLGHARSGDFSLARGPIALLAADLVRITRT"
FT   CDS_pept        complement(450562..451470)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217182" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670048"
FT                   /orf_name="Pc22g01960"
FT                   /product="Pc22g01960 protein"
FT                   /protein_id="CAP97484.1"
FT                   /db_xref="UniParc:UPI00018329F7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP48"
FT                   /transl_table=1
FT                   /translation="MDQLALPPVSVMPSLMTALPTDTVVRVFKRLQHVKLEAETIVQKF
FT                   EQDAQYSGNQFLVLLKLRPQMAERLFNDHRCLEGIDYRFEFEGDIGVLRLVPGYKHEYT
FT                   TTGLLQKINLQLDRMGLNEYYRWGGATRYKSTARGKEGDQVFSPAQRWPSSDGLSWPTM
FT                   VIETGVSESRPKLVEDARWWFGSSEGQVRIVILISVTNRAVHIEKWQLAPPDAPHPLTR
FT                   TYINTLRDIPINVPPSTRQPLGIQQPYSCAEIEITDHNVVGAPLVIPFCALFDVPSRPP
FT                   HMHDVVLDGSTLRFIAELNFL"
FT   CDS_pept        join(453230..453392,453445..453784,453857..454190,
FT                   454255..454341)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822811"
FT                   /orf_name="Pc22g01970"
FT                   /product="Pc22g01970 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP97485.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00018329F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP49"
FT                   /transl_table=1
FT                   /translation="MAADFWAGYISGAIGIIIGNPLDVVKVRLQAGNAHADASPAHLSR
FT                   FEKASSLVRGAAAPILGYGALNAILFVAYNRSLAALDGSVTDPTNPVGVSPYKIWLAGA
FT                   AGGLASWTISSPTEFIKCRAQLDRRPEVSSWAVAKDIFRTRGWRGLYFGGGITSARDSI
FT                   GYGFYFWSYELCKRFMTSDDDGSHQAAMKILLCGGIAGIVTWGSVFPLDMIKTRLQAQT
FT                   IADHSPRATESQSLLRSRQTLSSFQIAKDTYRAEGIKAFYRGLGVCSVRAFIVNAAQWA
FT                   AYEWLMKSFNHSWDAQVKSQEATTGL"
FT   CDS_pept        join(complement(455192..455232),complement(454948..455127),
FT                   complement(454775..454889))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941392"
FT                   /orf_name="Pc22g01980"
FT                   /product="Pc22g01980 protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP97486.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniParc:UPI00018329F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP50"
FT                   /transl_table=1
FT                   /translation="MGALRRVKNKRRTRDYDQVVADIKTPRHLQQYKDSKDVEDLPGLG
FT                   KFYCTECSKWFESDYNLKAHTKGKNHKRRLRILREEPHSQLLAERAIGLGLVDNGKREE
FT                   NSDEMKE"
FT   CDS_pept        join(complement(456332..456373),complement(456090..456248),
FT                   complement(455850..455951))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976025"
FT                   /orf_name="Pc22g01990"
FT                   /product="Putative uncharacterized protein Pc22g01990 "
FT                   /protein_id="CAP97487.1"
FT                   /db_xref="UniParc:UPI00018329FA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP51"
FT                   /transl_table=1
FT                   /translation="MGLHIQELVTTFTKKDSTGTGSRAVTAVTTAIQYAGIGLSLPHAT
FT                   ARRAGQFDRRCLWPRILKDLLKRYKACDGYNSATNHGVSNYKTPFAQFSRFGQKG"
FT   CDS_pept        join(456391..456426,456523..456540,456656..456730,
FT                   456814..459036)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976026"
FT                   /orf_name="Pc22g02000"
FT                   /product="Pc22g02000 protein"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="aconitate hydratase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAP97488.1"
FT                   /db_xref="GO:0003994"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI00018329FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP52"
FT                   /transl_table=1
FT                   /translation="MISTRLARAGALAPKFRLLSGTRAFATVNDPLDKKVEMTNQETGH
FT                   YINYKKMSENLAIVRSRLQRPLTYSEKVLYSHLDDPHGQDIQRGVSYLKLRPDRVACQD
FT                   ATAQMAILQFMSAGMDRVQTPTTVHCDHLIEAQVGGEKDLARANEINKEVYDFLASSTA
FT                   KYDIGFWKPGSGIIHQIVLENYAFPGGLIIGTDSHTPNAGGLATAAIGVGGADAVDVMA
FT                   GLPWELKAPNVIGVRLTGQMSGWTSPKDIILKVAGLLTVKGGTGAIIEYHGPGVESLSC
FT                   TGMGTICNMGAEIGATTSIFPFNDRMYDYLKATKRQHIGDFSREYAASLREDEGAQYDQ
FT                   LVEINLDELEPHINGPFTPDLATPISQFKEAVKTNKWPEELKVGLIGSCTNSSYEDMSR
FT                   AASIARDALDHGLKSKSLFTVTPGSEQIRATIERDGQLETLEEYGGVILANACGPCIGQ
FT                   WDRQDVKKGEANSIISSYNRNFTGRNDANPATHAFVASPDLVVAMTVAGTLNFNPITDT
FT                   LKDKDGKEFKLKPPTGDGLPTRGYDAGRDTYQAPPADRSAVSVAVSPSSDRLQILEGFK
FT                   AWDGKDATDIPILIKCKGKTTTDHISMAGPWLKYRGHLDNISNNMLIGATNEENGEANK
FT                   VKNCFTKEYDAVPATARDYKARGVKWVVIGDWNYGEGSSREHAALEPRHLGGLAIITRS
FT                   FARIHETNLKKQGMLPLTFSDPADYDKIRPEDKVDLLCTQLEVGKPMTLRVHPKDGGAA
FT                   FDVSLSHTFNESQIEWFHDGSALNTMARKA"
FT   CDS_pept        join(459832..459915,459985..459997,460048..460407,
FT                   460503..460923,461074..461125)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246879" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941393"
FT                   /orf_name="Pc22g02010"
FT                   /product="Pc22g02010 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP97489.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniParc:UPI00018329FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP53"
FT                   /transl_table=1
FT                   /translation="MTTQLVQLPEVERLSASVVRILGGNPGKFTLQGTNTYLIGRGHQR
FT                   ILIDTGEGMPAWAANLQSVLSQEKATVHQALLTHWHGDHVSGLPDLLKLCPQAQIFKHQ
FT                   PDSAQTDIHEGQVFSVEGATLTAFHTPGHTVDHMVFMLEEEDAMFTGDNVLGHGTAVFE
FT                   DLKTYLNSLHRMRDRVSSGRGYPGHGAVIENAGARITEYIKHRQQREDEVLRVLRFGKL
FT                   DVAAGESSPVHKQAWTPIELVKQIYRDVPESLHLPASHGVLQVLMKLEDEGRTVHESDS
FT                   GKWSLASERSALKRSDDIPLSNPSRIEK"
FT   CDS_pept        join(461583..461880,461943..462315,462362..462732,
FT                   462781..463120,463196..463331)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191477" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941394"
FT                   /orf_name="Pc22g02020"
FT                   /product="Pc22g02020 protein"
FT                   /function="alpha,alpha-trehalose-phosphate synthase (UDP-
FT                   forming) activity"
FT                   /biological_process="trehalose biosynthetic process "
FT                   /protein_id="CAP97490.1"
FT                   /db_xref="GO:0003825"
FT                   /db_xref="GO:0005992"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniParc:UPI00018329FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP54"
FT                   /transl_table=1
FT                   /translation="MPSIEPKNEARLLLVSNRLPITIKRSDDGKYDFSMSSGGLVSGLS
FT                   GLSKSTTFQWYGWPGLEVPEAEIPVVKQRLKEEYGAVPVFIDDDLADRHYNGFSNSILW
FT                   PLFHYHPGEITFDESAWEAYKEANRLFAKAICKEVQDGDLIWVHDYHLMLLPEMLREEI
FT                   GSTKKNVKIGFFLHTPFPSSEIYRILPVRNELLLGVLHCDLIGFHTYDYTRHFLSSCSR
FT                   LLGLATTPNGIEFQGKIITCGAFPIGIDPEKFKEGLKKEKVQKRIAMLEQKFQGVKLMV
FT                   GVDRLDYIKGVPQKLHALEVFLSDHPEWVGKVVLVQVAVPSRQDVEEYQNLRAVVNELV
FT                   GRINGKFGTVEFQPIHFLHKSVNFDELIALYAVSDACIVSSTRDGMNLVAYEYIATQQK
FT                   RHGVLVLSEFAGAAQSLNGSIIVNPWNTEELAGAYQEAVTMSDEQRALNFAKLDRYVSK
FT                   YTSAFWGQSFVTELTRISAHSADKFQAKKLAEADSNGGDVPPTTQNA"
FT   CDS_pept        join(463962..464519,464547..464558,464616..464699)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216642" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822812"
FT                   /orf_name="Pc22g02030"
FT                   /product="Pc22g02030 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP97491.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00018329FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP55"
FT                   /transl_table=1
FT                   /translation="MAPSHLLRATMPLRASITTPLSLTRPSILQSTTYLTTLRNASTTT
FT                   PTPTQPKTTGTETQAPSRLRNYASALKTGTVVSVGRMDRTVRVCHRHTSWDRHIRKFYP
FT                   QETHYLVSDPRNSLREGDIIEFSSGAPKSRNVHHVVERIITPFGEAIADRPAVLSKEER
FT                   EAEREKRWAAKYLRRESKRLGREAGVPNERVGKVKRIVQERVAEDEQMQESQRG"
FT   CDS_pept        join(complement(466639..466676),complement(466417..466582),
FT                   complement(465186..466358))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184015" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941395"
FT                   /gene_name="nudF-1"
FT                   /gene_synonym="lis1-1"
FT                   /orf_name="Pc22g02040"
FT                   /product="Nuclear distribution protein nudF 1 "
FT                   /biological_process="cell division"
FT                   /biological_process="mitosis"
FT                   /biological_process="transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="spindle pole"
FT                   /protein_id="CAP97492.1"
FT                   /db_xref="GO:0000922"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017252"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00018329FF"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HP56"
FT                   /transl_table=1
FT                   /translation="MSQLLTSRQAEELHKGIIAYLTSVNLHHSSAALREELGDSIRVDD
FT                   TTLKKYEGLLEKKWTSVVRLQKKIMDLEARCASLQSELDTATPTSLNRKNQDPVSWLPR
FT                   APARHDLESHRSPVSCLAFHPIFSSLASGSDDTTIKIWDWELGELERTIKGHTRAVLDV
FT                   DYGGPRGGTLLASCSSDLTIKLWDPADEYKNIRTLPGHDHSVSAVRFIPSGAAGSPMSG
FT                   NLLVSASRDLTLRIWDVTTGYCVKSMQGHGDWIRDVTPSPDGRFLFSGGDDRVARLWDI
FT                   SSGDTKSTFLGHEHYIECVAFAPPTSYPHFAALAGLKKPPPASSSAEFVATGSRDKTIR
FT                   LWDTRGNCIKTLVGHDNWVRSLVFHPGGKYLLSVSDDKTLRCWDLTQECKCVRTIVAHG
FT                   HFISSLRWAPPLVKDAGANEGANGTEAASNGAKEDATKMSIRCVLATGSVDLKVRVFAA
FT                   "
FT   CDS_pept        join(467263..467322,467389..467597,467677..470092,
FT                   470148..470180)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976027"
FT                   /orf_name="Pc22g02050"
FT                   /product="Pc22g02050 protein"
FT                   /function="binding"
FT                   /protein_id="CAP97493.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001832AC0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP57"
FT                   /transl_table=1
FT                   /translation="MAEATEDFSSLPLPDRFAHKNWKVRKEGYEDAKGQFEKTPDESHP
FT                   VFVPFIQDPSLWKGAVADSNVAAQSEGLAAYCAFLKFGGAQACTRSRSYTIGPIAEKGL
FT                   PSTRPAGKASAQEALLLCVELDKADPVIEELLPILSHKVPKVIAACLAALTLIYHNYGC
FT                   KIVDPKQTLKALPKVFGHADKNVRAEAQNLTVELYRWLREAIKPLFWADLKPVQQGDLE
FT                   KLFEAVKQDPTPKQERFTRAQQDAMATASAAPAGEEGDEPAADGFDEEEDGVVVDAFDL
FT                   AEPVDVFKKVPGDFHDQLASSKWKDRKEALDALYNVVNVPRIQDGPYDEIVRGLAKSMK
FT                   DANVAVVTVAANCVDVLAKGLRNGFTKYRGVIMAPMFERLKEKKVTVADALGQALDAVF
FT                   TTTTLTDCLEEIFEYLKHKNPQVKQETVKFLIRCLRTTRTVPAKAEQKAIADAGTKLLT
FT                   ESAPAIREGAAEILGTLMKILGERAMNPYLDGLDEIRKTKIKEYFGTAEVKAKERPKPI
FT                   VAPPKPAAPAGRKVVGKKPATGLKKLAPVAAPPPPEEPPAKPAARGIPSKLGAPKPGGL
FT                   PTPGSGLKLQRKLAGPGATASPSRRVAAPPEEDVAPPPPAPKFGLGRGLAGRPIARPSA
FT                   PAEPAPAAAPVPSPAANAMAAAERAELEALRAEKENFNRTVEEMKSERSKLNSTITELQ
FT                   NQNAQLIEDHTRDVLSIKAKETQLVRARSDAETAEGSVQKQQREIERLKRELARALRAS
FT                   AISPPNAASDAGSMGMPDTNSMYQDHIANSNAASRSGLHMGSRFESSRPRSYASATPSE
FT                   ERENNGMESPGPSSRNGGLGRRNLSPTYGYSAVGSPTRSSARNSNTNITEDDQQQPRSS
FT                   EPAENWKRAAEVTSQLKARIEQMKVRQGLSRPQR"
FT   CDS_pept        join(complement(472824..472829),complement(472473..472553),
FT                   complement(471698..472408))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216644" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941396"
FT                   /orf_name="Pc22g02060"
FT                   /product="Pc22g02060 protein"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAP97494.1"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="InterPro:IPR001921"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="UniParc:UPI0001832AC1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP58"
FT                   /transl_table=1
FT                   /translation="MVPPAKSGKKAAALPYPQGKAGNGKKAAKNPLIEKRPRNFGIGQD
FT                   IQPRRNLSRFVKWPEYVRLQRQKKILNMRLKVPPSIAQFQATLDRNTAAQTFKLLSKYR
FT                   PETKAEKKERLVQEATAVSEGKKKEDVSKKPYNVKYGLNHVVGLVENKKASLVLIAHDV
FT                   DPIELVVFLPALCRKMGVPYAIVKGKARLGTVVHKKTSAVLALTETRAEDKAEFAKLLS
FT                   AIKEGYTDKYEDSRRHWGGGIMGSKANARIEKKEKALAAAIKV"
FT   CDS_pept        join(complement(474998..475066),complement(474448..474933))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670049"
FT                   /orf_name="Pc22g02070"
FT                   /product="Pc22g02070 protein"
FT                   /function="protein transporter activity"
FT                   /protein_id="CAP97495.1"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI0001832AC2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP59"
FT                   /transl_table=1
FT                   /translation="MINAVLVFNNNGQPRLTKFYTQLDTQTQQSLIAQIYRLVAQRPAS
FT                   ACNFLPLPPLLSQGASSSASGPSDAPTQITYRTYATLSFIMISTSTESPLALIDLIQVF
FT                   VEALDRMFENVCELDLIFGYETLHAVLGEMIVGGVVVETNIEKIIAAVRAQEGSLGKKK
FT                   AVQAASTSLGRGALPGLGAWR"
FT   CDS_pept        join(475240..475751,475836..476262)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216645" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941397"
FT                   /orf_name="Pc22g02080"
FT                   /product="Pc22g02080 protein"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP97496.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="UniParc:UPI0001832AC3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP60"
FT                   /transl_table=1
FT                   /translation="MNSIPACRNSSSRISLYTTIRALSSASNSSSKRELKDLTPSDLCY
FT                   YWDTRPPKDEQLAFADKVFTPSRHSPVKLWSAAKFRTTPFASVEPEVAFLGRSNVGKSS
FT                   LLNAIMGKEICWTSSKPGRTREMNAFGIGGTKGGESKVVLLDMPGYGKASRSEWGEEIM
FT                   KYLQGRKQLRRAFLLIDSTHGIKQTDAEILRLFRHHAIPHQIILSKVDKFLVRQFKQIK
FT                   SGVTPANIERLQLLLQGIKPIVQPDPGVAEGPGSLGEILTCSAEARIGPGRALGIDAVR
FT                   WSILSAAGIDGSLQDSRLAVPSAAETPVTLS"
FT   CDS_pept        join(complement(480040..480465),complement(477288..479975),
FT                   complement(477104..477229))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670050"
FT                   /orf_name="Pc22g02090"
FT                   /product="Pc22g02090 protein"
FT                   /protein_id="CAP97497.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0001832AC4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP61"
FT                   /transl_table=1
FT                   /translation="MTSNAPTSLHISEIDSALTDHNASVSAPSHATHSPGSRFTRPRKR
FT                   EMDERKELGQGPSNAAIGQFSFAPTTRTTVVTTTTTTTTSFPPLTINPPRAVKDLDARQ
FT                   YPLAASPTPSALRNLKFKIGDKSIIFNEPEDTTNAATEYKEKSEALISSNGQIRSVNSF
FT                   ISEGENPTRRLTAPRIASQPSTHPSNTRRRAVSPISHFDPRPSVLPRTRPSRVPSEPIT
FT                   RRTRQSGGSAHAAGLATPDTESNLGGAGENAAPRPRIHSSVFPRREPPLPSPLSSEIGA
FT                   KGLQAVNQNAYLQNGLSGIRSDPGTQESQATEPDESCSTAHESASFGHDTTYGTQESAS
FT                   EERPELMSQLSAIDNAMAQDMCLPSPSLSPVAAMNALHGESSFESEGLDVDTDSSLDHN
FT                   VSRFSKALRLQDANETRVSGHSLANSRSPSSLLDMPKVLEFFDSVPDEVKTYLMYQFLR
FT                   RCPKPTLHFVADVVNPTLKCDFLTLLPLELSLNIVKYLDVQTMCRAAQVSKKWRHITNS
FT                   DEKSWKTLLDQDGYHLSDGELERAIRQGWGWQLPSGPHDPEEDLSIVPLSRADMEVSPV
FT                   PSMAGPSSRSPLGSLPINRRGKRKANTRASSRKLAKRKASSSGGEITDPDWKRGIAASE
FT                   GPYAAANAAAAAIPYAEVGLPSLRGLFLFKVLYRRHVAIHRGWMQPDVKPQHIAFRAHD
FT                   RHVVTCLQFDADKVLTGSDDTNINVYDTKTGALQATLEGHEGGVWALEYHGNTLVSGST
FT                   DRSVRVWDIERARCTQIFQGHTSTVRCLQIVLPTEVGRDADGQPEVMPKEPLIITGSRD
FT                   SNLRVWKLPKPGDPVYYQNAPIADDSNCPYFMRVLSGHQHSVRAIAAHGDTLVSGSYDC
FT                   TVKVWKISTGQTLHTLQGHTMKVYSVVLDHKRNRCISGAMDHMVKVWSLDDGAPLYNLE
FT                   GHTSLVGLLALEQDFLVSAAADSTLRIWDSVHGHCKNTLSAHTGAITCFQHDGQKVISG
FT                   SDRTLKMWDVRNGECVRDLLTDLSGVWQVKFNDRRCVAAVQRDNMTYIEVLDFGAARDG
FT                   VPESKLAKRIVVNRRGQEVTGGIEDDDDLSD"
FT   CDS_pept        join(481937..482038,482116..482157,482220..482242,
FT                   482294..482486,482541..482820,482876..483041,
FT                   483114..483310,483381..483481,483543..484061,
FT                   484116..484350,484406..484596,484644..484934)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941398"
FT                   /orf_name="Pc22g02100"
FT                   /product="Pc22g02100 protein"
FT                   /function="zinc ion binding"
FT                   /biological_process="mitosis"
FT                   /protein_id="CAP97498.1"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR003511"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001832AC5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP62"
FT                   /transl_table=1
FT                   /translation="MPRAKKTVALEAVSESGTSQPKIQVDKIHRFPVIGQSLELMKITL
FT                   HMTIASLLFMRGLLPIDVFGERVLRANRFHERYNYSHFVNGKHKGNFARNRSEYVPIRV
FT                   IERHMSNEADHLLDILENGIFDALLRGVLHAVQFTIIADKGSPNKILESYTFTFGTSGE
FT                   RGPADRLLSDPRIDFVSPLEDRADMRNMIFEGKALIRRLVKMCAESPALPNERSLGIHV
FT                   FYISECPGSYDVPGFAASQDDTVEYPRTSYWERTRRFIGSVDSGFHTVGLRVNSLLSTS
FT                   PGGEAHFPSAEETNDHAVLRSDEVGIPTLAQTPLDVVGEIYLSTDESTASDTDDEMISV
FT                   AEFKALHYANAAVAAGVRRHDSRKSRRYTEKRVDDRIFFNQEDLESHQSRVQEMAQSVA
FT                   DSLAVNLDDSDSETDSLEKLDRIERSGKSTVPVNWSQDDDYATFPVSRDGIQLALARQQ
FT                   TRENFPTLTYIRRLQEAGSKPIVTARTVHYVENCHGAVKKSDGENKDNGSLPGPSGRMT
FT                   KYGHKNWRPYRCECNTWYFKPSKSIQCANCKEYQHTLCYGYYSAKDTRIPDIHYCYTCL
FT                   IGYDFDSGLMNELIKLIRMRRTLDYVLAAEGIPSLNWQLAKRLNCTDDEARAAVYSLRK
FT                   LGILKPARWRVKHEHKVGGSKFWLNMTTPSCNTIYSEVVDSMLLIGKYKYDIPPPLPQP
FT                   MIRTHWSRSGIPILHNFTSESDEWYNTMDPRWQPALWKRVRSDPSANGYFFEGQTSNSV
FT                   SKRLLESVEEGFEDGSTREAKKMKVK"
FT   CDS_pept        join(complement(485985..486239),complement(485822..485931),
FT                   complement(485661..485763))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670051"
FT                   /orf_name="Pc22g02110"
FT                   /product="Putative uncharacterized protein Pc22g02110 "
FT                   /protein_id="CAP97499.1"
FT                   /db_xref="UniParc:UPI0001832AC6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP63"
FT                   /transl_table=1
FT                   /translation="MEDPPLIAVCSPSWSPSHLKGQIDNRFTDPVHRSERDLVPKAPVL
FT                   STKSPLCSQISARVLRTLHDPYKYSEEAVTCVSMVSLQELHVGRHETEDRLRPALTPVD
FT                   SMAVDKSSHNCTSPCRTRPCAASWTHEAGTSSDMTLRGRNFTPIEIRDRLK"
FT   CDS_pept        487142..489367
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216648" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941399"
FT                   /orf_name="Pc22g02120"
FT                   /product="Pc22g02120 protein"
FT                   /protein_id="CAP97500.1"
FT                   /db_xref="UniParc:UPI0001832AC7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP64"
FT                   /transl_table=1
FT                   /translation="MGHRELTPVHVPLRTSSRKPVQHDPMSTQEQSRADRRTSKAQRFF
FT                   GTDISLPTEHGGWQEPPNVRRPSFGKTNNAPKQSSGFVPFPRSSENTLIPDQNLRVRAS
FT                   SPLLGHDYRSQEAAPPVPKPSKKVHHSGSSSTLFSYFSSKESSKSPKSQLQPRVRHGLG
FT                   SEPQVTYTQTQDPPKEPKRKMRPPKIDLSVLFPKPRNPAPQTLLSPHRMVNSPSPVSTV
FT                   APDYSSNKIERMTGGTRNSRRHADPPPRRSSVTKNNPPKHGVDNSDLPSIAESKNSEWP
FT                   EQSLERTVGTSEIDLALDRYAGRRSLFSRSSTYTTSREHLQEQPHPQESRKSSRRGHSP
FT                   SRPKETYLSPPACPDPKRGRGLSTSQESWKTTESKPKSEKSSVTKKSSKSTLKNKDLRN
FT                   TSMLCLSSSSEDEGDEDHTPTEPKRNASKSRRDSVATYDEYEPQVYTASTAHATTATAA
FT                   RRVDRALSTSTRGSRQTEKSQPVPVPVPRPRKASQHSNGKSSQRSGRTTQTPRSSGVPT
FT                   IPDEILAQFPQQPLRSPAELKELNRRSRVIAVTRQEQDLLEAMRIRKGKVTPSLFNAPG
FT                   ADRRSLASGPSRDSFCGSDTSFLRLSNVFPPFDVRSEKGATQYKDTPSQSSGSDGEPKP
FT                   RTAVSSSSVSGDYSESLPSPATSGASPLTPTLPIHRFSPLPSPKPPPRGPPPAIPEDQK
FT                   QHTRRRTDSSEAILLDDAGEIKRNNGIPLWSFDFDWNQESANIATVH"
FT   CDS_pept        490151..490537
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670052"
FT                   /orf_name="Pc22g02130"
FT                   /product="Putative uncharacterized protein Pc22g02130 "
FT                   /protein_id="CAP97501.1"
FT                   /db_xref="UniParc:UPI0001832AC8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP65"
FT                   /transl_table=1
FT                   /translation="MNDDMRGIRMGLVEMPWTARRHQLSRLRGWPELSKRKYCKYDMGF
FT                   PPTRYINDNICTPYMHLPMYLGIAETTPALEPPLCDPLSDRRPSKVLVYNPGLSLSEHS
FT                   ILSFPLSRTFFSQVLRNTLIHTKE"
FT   CDS_pept        join(490817..490885,490962..490991,491062..492042,
FT                   492138..492434)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941400"
FT                   /orf_name="Pc22g02140"
FT                   /product="Pc22g02140 protein"
FT                   /function="nucleotide-sugar transmembrane transporter
FT                   activity"
FT                   /function="sugar:hydrogen symporter activity"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97502.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005338"
FT                   /db_xref="GO:0005351"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004689"
FT                   /db_xref="InterPro:IPR007271"
FT                   /db_xref="InterPro:IPR021189"
FT                   /db_xref="UniParc:UPI0001832AC9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP66"
FT                   /transl_table=1
FT                   /translation="MGDRAQRQPSGLRAAANIAPWILLTAESTAFVLLAHYSRVMPPAG
FT                   GKRYLTSTAVFLVEVVKLAISLTMALYDVSKTAPPSMPATSLFFSLTSAVFSGDSWKLA
FT                   IPAGLDVLSNSLLFIALSNLRAASFQVTFQLKFLTTAVFGLMLLKRSIPPRKWGLLLLL
FT                   IVGVALVQVPDASPEQMLHDEHASHHFPRSLEEWKAVKQGAGAGSSLQKRSATYEGIEE
FT                   DILTADPHLNPAIGLLATIGASLASGLAGIYFEKVLKDSSNHISLWVRNVQLAVYSVFP
FT                   ALFIGIVFRDGERIAEDGFFQGYNWAVWSTIIIQALGGIVSAFYVSHAQKDARSLATTA
FT                   NILLSIVGSIWLFDFEVTSSFFLGSAAVLIATHYYGNPTFNPAMGASRPPPIRIDAYEK
FT                   DPAGPEGSPVAPPNDFSIKLPTSPFLSDGMSSSRPTSPAPGHTRVSSSRNASASYFDEK
FT                   "
FT   sig_peptide     join(490817..490885,490962..490982)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP66 "
FT   mat_peptide     join(490983..490991,491062..492042,492138..492431)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP66 "
FT   CDS_pept        join(492884..493106,493168..493287,493349..494324,
FT                   494403..494584,494633..495321,495378..495977,
FT                   496009..496160,496213..496310,496368..496884,4
FT                   96931..497912)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216651" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941401"
FT                   /orf_name="Pc22g02150"
FT                   /product="Pc22g02150 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP97503.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001832ACA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP67"
FT                   /transl_table=1
FT                   /translation="MRRHHQNPNFKPFQVPNKRRTNASSPSKSSRTGIIDQRLIQGSQQ
FT                   PQYNSSSPRKPFNGLASSAHDEDPQLDDFASEDRDEAIRDSGFRVPTSTPLQPSRQSDL
FT                   HPPQFSRFFQPSSSIGSSDPVLGPLSSPLALFRQKKNGTQTGQRSLETNRPYHDETSQS
FT                   SPQGPVTQASQEALIGNRPRNPFSNIPPSVRGIVLVSVNDIPENYRSMFPFPLFNAIQS
FT                   KSFHSVYNSNDNIVLSAPTGSGKTVVMELAICRLVNTLKDERFKVVYQAPTKSLCSERF
FT                   RDWNSKFSSLNLKCAELTGDTDHMQLRNVQASQIIITTPEKWDSMTRKWKDHMKLMQLV
FT                   KLFLIDEVHILKETRGATLEAVVSRMKNIGSNVRFVALSATIPNSEDIATWLGKDATNQ
FT                   HVPAHREHFGEEFRPVMLKKVVYGYASSLNDFAFDKVCGSKLPEVIGMHSCKKPILIFC
FT                   CTRNSSLATAKELARLFTLTNPPARLWKEPKKRLEAHNEDLKTTLVAGVAFHHAGLGPA
FT                   DRHTVETGFREGNISVICCTSTLAVGINLPCHLVIIKNTVSWQDGGCKEYSDLEMMQML
FT                   GRAGRPQFDDSATAVILTRKERVAHYERLVQGSESLESCLHLNLIDHLNAEIGLGNISD
FT                   IESAVKWLAGTFLFVRLRRNPTHYKLKEGANQEDEDELLRQICEKDIDLLRKCDLVEAE
FT                   SLSSTQFGDAMARYYIRFETMKVLLSLKPKPTLSETLNVIAQAEEFREIRLKAGEKLLY
FT                   REINRDSGIRFPIKVDLALQAHKISLLLQSELGAIEYPDSEQFQKHKFTFQQDKSLVFA
FT                   HVNRLIRCLIDCQIARGDSIAIRNALELARSFGAKVWDHSPLQMKQIEQVGVVAVRKLA
FT                   AAGITSIEGLESAEPHQIEMVLSKNPPFGSKLLSRLKEFPKLRISVKMLAKVRNCYVIM
FT                   EVRMNYVNVRFKVEVAFMNDKTPTYFQRRPVHVCCLVERSDGNMIDFRRASAIKLQEKL
FT                   EIELTAELTSADHVIVCHAMCDEIAGTWRQAELRLNLPSHLFAAMRDKNANAQNTGASN
FT                   IQSRHSEGNLSSKDATKLKAHTFRSHDRVMASTKTKSRRDADDFDGDDLQLDDFLIANE
FT                   RRDKPKEPTKPQPPQFDDIDWFSIDATPPTPAKRAPPKVSNPQEDDWAVDIDEAEEEYE
FT                   PVRLANGKWACNHKCKDKSSCKHFCCREGLEKPPKPPKRSILATQKEAGLNQLTISASI
FT                   TKPTPKNSSSSRNQMAKQRVTGPKNDDHVSKMKKMSTSQAGKKDPSREESVLSERDKNL
FT                   PSYTKKREKTSTKPLYSDYGDEVFDDLPSPSRLLGNRGSGFATSVSPVVNNQTKSNITD
FT                   VAVKKTKKTKNRDPEPSPSASLPNLAQKERTKPSISKPQHEIIEIPDDTPPDSTELPMA
FT                   IEKGSPVKQSTLPLPERADQPPNLKRKASQDETRTEEPKKRAKQSPFVSALKTHPSDLL
FT                   SNEQPLSPEQPASPVSPAAVSPMLAGRMDLTARWDDGIDLLDEFKDIIKFI"
FT   CDS_pept        join(498624..498647,498709..498756,498807..499979,
FT                   500035..500358)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941402"
FT                   /orf_name="Pc22g02160"
FT                   /product="Pc22g02160 protein"
FT                   /protein_id="CAP97504.1"
FT                   /db_xref="UniParc:UPI0001832B93"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP68"
FT                   /transl_table=1
FT                   /translation="MTRMHYASRTMEGVEMARIAARDLRRRLPGGDNCDAASRSPAVKI
FT                   DLSGRKLTDEGFDIFIDALLETLQKEKDDKHPDGFVRLLKLQLGGNCLTFKSLPKLGMA
FT                   IRLSTGDLSDFDLSYNCIEVSTAGQRAAWKYFLNSFEECYMLKRVNFSGNPLGSPGVEI
FT                   LARVYIRSKLAYPTAFSGEGHDFSVDQGEDLTSDDHGPGVDSFFSLSIYDDGGPDSAHT
FT                   GDQDPTPQPQGASEKTSERNRRHFRKTRGLRSVPELILTEIPMSSIGVIHLAGMLFMQE
FT                   SREFLRFYLPKTKGAASRPETEKKNPSITWLLNEHLPQRVRQAPCWATEMAQRGLSFDP
FT                   SLTVAIDNLETPPSSDFLRGGKSWKVRHEIKFLCVVRALYAPASEGEIRGSEIWTMALK
FT                   MAKMMETVLSNEEVIQAQLSSGGKVFECLGLERDLVDAINIGVFLSRKLLLDGQSQEVW
FT                   RLGMSLDIWSDVMGMALDKGNVLTAQQRMNILAYVGRGNRRVPEKAMEIWRFLFDVDCV
FT                   MYHAS"
FT   CDS_pept        join(complement(502980..503179),complement(501892..502868),
FT                   complement(501669..501810),complement(501533..501593),
FT                   complement(500757..501398))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201335" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822813"
FT                   /orf_name="Pc22g02170"
FT                   /product="Pc22g02170 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97505.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001832B94"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP69"
FT                   /transl_table=1
FT                   /translation="MPDSAAAGVAPATPSPAPARARASCSRCHRRKKRCDRLLPSCRNC
FT                   VSARMRCSFEDDDLQTASYPIVYVQGLEEKLRRLGRAVGVGEQNAPHATEATAVLDNNP
FT                   PFRDFEVPETATVYPECSSHGIYRSEVANASTIADNTPPIQDPHVSPRPTSSQTSTFGQ
FT                   QLTALSLEATAERHLGSTTGLSFAELTQMVLRRLTPDKADFVFNSQQDNTTGTNLLDLS
FT                   FPADPFNDSFFQNLSESISVHPLLFGDLFLPEFTGSDAPLGSLVWPADETYVRRLVDFY
FT                   FAHSHTLYPILKRSEVMDAFERIHQNPQSLATQAPLDIFRIWMVLAIGSTAYSSVTLTE
FT                   ESESMMFYNNALQYSEQALGGDEMVYTPVYYFSAEENPTDESLVCLGGYNAPIDTWFLV
FT                   GTAARLALGMGLHAASSYHKFPLDGQQRRKRIFFSIYMMDRVVSITLGRPFALHDDDID
FT                   VTPSMMAVPLHILSLRRIAGKISRQVYGNFKNSKMNLQEREAIIASLHQELLAWRRGMP
FT                   FPLPDIDDRVPHLNTTWYDFNYYTHLAMIYRPSPLFPVSDVKRIKMLETAASMSLRQAF
FT                   SMHQQQRFAYNWLNFLALFTATLSLVYAITAQPDDLGVVLRDTRAIADLDLATQLFETL
FT                   GLKFVAAKKIQGMIAEISRRYKEVRASKTMEPNMGYRE"
FT   mat_peptide     join(complement(502980..503116),complement(501892..502868),
FT                   complement(501669..501810),complement(501533..501593),
FT                   complement(500760..501398))
FT                   /db_xref="UniProtKB/TrEMBL:B6HP69 "
FT   sig_peptide     complement(503117..503179)
FT                   /db_xref="UniProtKB/TrEMBL:B6HP69 "
FT   CDS_pept        complement(503744..504199)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941403"
FT                   /orf_name="Pc22g02180"
FT                   /product="Pc22g02180 protein"
FT                   /protein_id="CAP97506.1"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI0001832B95"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP87"
FT                   /transl_table=1
FT                   /translation="MSPNGQAYLVKPDAPEGATRFPQARLAPRSNHRTIYISGTACCRP
FT                   DGTWPGVTENPDGTCTTDIRKQTAAVLENVDNIIKGATNGKGGIHNLIDAVVYILDMKT
FT                   QYAGMNEEWNKVFKSRDSAPARVTIGVKELPDPRMIVEVKAVAVVDT"
FT   CDS_pept        join(504768..505954,505990..506173)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976028"
FT                   /orf_name="Pc22g02190"
FT                   /product="Pc22g02190 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP97507.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001832B96"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP88"
FT                   /transl_table=1
FT                   /translation="MDQLPAGIPGKASNSDSGTEEQFERKTAHQIPSAISTESMDEPAV
FT                   TKYPEGGWTAWGVVLGSWMAMFGSMSFMNSIGTFQTYLLRNQLSGYSPEAVGWIFGVYN
FT                   GLTFLLGVQTGPIFDARGPRALICCGGILTILCLMLLSICTEYWHFMLVYGVLGGISLS
FT                   LIFGPAIAIVAHYFNARRGFATGIASSGGAVGGVVFPLMLQRLFDTVGFAWATRIAGFV
FT                   CIVTFVLAGILIRPRFPVKPLTLSTVRPDLTIFRQAGLALTSLGVFFLEWGLFIPFTYL
FT                   TSYAIDHGSSAAFSYMLLSLINAAGVFGRWVPGFYADRLGRFNMLILTVLGCLLSILCL
FT                   WLPTKSSEPMMVAFALVFGFFGGSNVSLAPVCIGQLCKVESFGRYYSTAYILVSIRTDT
FT                   LLSMFTGTALGGKFIEVCNGGYCGVIAFAAASYLASFICLVMAKALCCGKSNIWSKF"
FT   CDS_pept        506661..507650
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000080955" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822814"
FT                   /orf_name="Pc22g02200"
FT                   /product="Pc22g02200 protein"
FT                   /protein_id="CAP97508.1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI0001832B97"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP89"
FT                   /transl_table=1
FT                   /translation="MSEPIVQYYHIHDFTFEDGTGPTSIQLAYLDINPTADKAALIPTC
FT                   FRGRLATTLTFSNGALKDYRVIVVALFGNGESSSPSNMTNFPPSLNYQDCVRAQHQLIK
FT                   SYLNIRAIDVVVGFSMGGQCSYYWTLMYPELVRNAVIICSSARTSRHNYQFLEGPKAAL
FT                   EYSVDYKKGENNGASSQASAGLRAFGKAYSAWLTSPEWFEKEMYKSMGYEMLADWDKDA
FT                   AGNNYYNWNPDDLLAMVGVWQRGDVTSISGDASLQETLSRVKASVLVMPCSTDQYFRWE
FT                   ASEKEAHAIPRSTFRVIPSAWGHLAGLGYNAEDKAFMDQAIAGFLKKQ"
FT   CDS_pept        join(complement(509498..509529),complement(507746..509441))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127084"
FT                   /orf_name="Pc22g02210"
FT                   /product="Pc22g02210 protein"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="CAP97509.1"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="UniParc:UPI0001832B98"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP90"
FT                   /transl_table=1
FT                   /translation="MSVVSISDGVGSNISETDLRYFAARLHVETLDNQDAEDYLTLLRS
FT                   LETVLRSIDNASDYIPPDLLPQETLENRKFVKPAPEDNPFNGWSHQCDLRSAVPASNLL
FT                   RGRTVAIKDNISVGGLPTTLGMPQTLFHQEDGYPISPIDAVVVSRILRAGGIIKGTSTC
FT                   ESFCASPLSFTSATGPVHNPLLHNYTAGGSSSGSAVLVAAHRLALKRSDSSTGHTVELS
FT                   IGTDQAGSVRIPASYNGLYGLKPTFGLVPYTGAGSMSPMIDHLGPLAAELEDVAALLEV
FT                   MAGYDGYDPRMTPETPLVHQVKPYLKLLLQARQEMRSTSRPGQKLRVGLLEESFHMPGV
FT                   AADVRDIVYKAATQYFEAVGASVVEVSVPMHQQGPAVWTAATRPSMSSYLCQGSPSGHL
FT                   SFLSPHTQIKWPPSQETYDTLTCSNPAVVNIMLSEKFSREACKGGLEAKAHRLVFALRA
FT                   AYDAALQHVDILVTPCAPTVAMPHPNPKGRDGRRASILDRLGAAVGLTSNTCPFNVTGH
FT                   PGMNVHCGFSTTEGHPGVPLPVGMQIVARHWADEQLIEAAALFERGREILESTGGGSE"
FT   CDS_pept        join(complement(510936..511031),complement(510739..510854),
FT                   complement(510188..510666),complement(509990..510126),
FT                   complement(509846..509914))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15941404"
FT                   /orf_name="Pc22g02220"
FT                   /product="Pc22g02220 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97510.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001832B99"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP91"
FT                   /transl_table=1
FT                   /translation="MSSLLTDSLFGVKGYVAVVTGGASGLGFMIARGLVTNGAKVYLVD
FT                   LPSVSTDKSVAELNELGREAGGSAHGMPCNVSDKDAIQNIAGQIGQQEKHVDMLISNAG
FT                   IRRDPPVQCNVLKASLSQLQTSMWSSRHSDWDDTFRVNTTAHYFLSVAFLPLLEAASRL
FT                   ELPDGKLGRNGGRGVVVITSSCASMHNVTNVDLTSYATSKAATDHLVKLLAAKFSRFYV
FT                   RVVGINPGFVPSNMNPVGEEGNLFSALFDKVPAKRAGNEDDIAGTVLYLVSRAGAYVDG
FT                   ISLCVDGGRILLANGQE"
FT   CDS_pept        join(complement(513422..513550),complement(512188..513340),
FT                   complement(511754..512130))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161565" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670053"
FT                   /orf_name="Pc22g02230"
FT                   /product="Pc22g02230 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97511.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0001832B9A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP92"
FT                   /transl_table=1
FT                   /translation="MDAKAYEGSYWLSYQWHQLKEQEHARPVLTAVVVVLLTYLLYTFM
FT                   YTTDIPHIKGMPEIPGAVPMFGHLLKLGEDHATVCEKWWRQYNHSVFQIKLGNTRAVVV
FT                   NSFDDCKKMLLGSQNAVIDRPKLYTFHGVISSTQGFTIGSSPWDESCKKKRKAAGTALG
FT                   RPALRNYYPMFDLESYCILRDMKKDSRNGQIEIDIRPYIQRYALNTTLTLCYGIRMDAV
FT                   YDELLREILHVGSSISLLRSASENLQDYIPALRYLPNNEKDTRSKDLRQRRDTYLDLLL
FT                   NKVREMIKNGTDKPCISAAILKDQETKLSGVEVSSICLSLVSGGFETIPGTLTSCIGSL
FT                   STEQGQAWQDRAYEDIKRHYPDDRDAWTSCFKEETIPYINAIVKEAGRYYTVSSMSLPR
FT                   KTVSEVNWNGAIIPPKTMILINAQAGNHDVDHFGPDAGSFNPERWLKTLNPPTEAESTG
FT                   LGHLSFGTGSRACSGQYLASRLLYSALVRILLSYKIVASKESPPNTDYVEYNQFKTALV
FT                   AIPKEFKVKLVPRDAAMTSECLDVAEQRTREHYKE"
FT   CDS_pept        514190..515767
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822815"
FT                   /orf_name="Pc22g02240"
FT                   /product="Pc22g02240 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP97512.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001832B9B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP84"
FT                   /transl_table=1
FT                   /translation="MNNILPKEKYNQEKHDYQTNQRADSFAVEEPLHPSTKRDLNARHA
FT                   LFIAWGGTVGTGLFITTGKALATGGPAFLVGSYVFASILVYFILTGVTEMATFLPVRGG
FT                   SMSRYGGRFVSRSLGFAMGWLYVYSFAILVPFELTACAILIDFWQPGINSAVWITILLV
FT                   LLVILNVLPVRFYGEAEFIFTGVKLATIIGLLLLSFILFWGGGPDRNRLGFHYWKDPGA
FT                   ANTLILEGDAGRLIAAIATVISSIMPFTFTPEMVVGTAAEIKEPRKNVPRVAKHFTWRL
FT                   VVLFVGSVVGISVICPSNAPTLTSGSDAASSPWVADIRQAGIGGLDSVINAVALIAAWS
FT                   TGNAFLYLSSRCLHSMAMEGNAPRIFQRCTAKGVPIYAVGATACVSLLAYLTLNSSSAA
FT                   ILNWLLNLVNTGGFLSWVCCSITYLRFRRACEVQGIPKSGLTQRSPLQPYSSWITLICS
FT                   SILCLLNGFTVFFPSEWSIPSFISAYLGLPAFFILYFAHRFTYRKEPWVIPSHLVDLQL
FT                   DPAELEDH"
FT   CDS_pept        join(517626..517953,517991..518326,518368..518408)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822816"
FT                   /orf_name="Pc22g02250"
FT                   /product="Putative uncharacterized protein Pc22g02250 "
FT                   /protein_id="CAP97513.1"
FT                   /db_xref="UniParc:UPI0001832B9C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP85"
FT                   /transl_table=1
FT                   /translation="MTDILPRERALQESGQINTLQQERWDLWREEESENTEPFNIHELL
FT                   RTEVKLRETAQREVALKEKLAIYQKQPTTDGSSAPTEIIQGLRAEVTMLNEKYWMLERK
FT                   WWSIKGYGDHTQSGICIACYAKIVPGGEDAVAGTAGAVSIAIYQNGSSQPVIALWNVTV
FT                   VRKLVDLSSAPSKRRELRRCSILVLTGGISKGSGMPRCWGSYTLTSTILLILLRILRQA
FT                   SQTQASITELLF"
FT   ncRNA           519649..519839
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="U2"
FT                   /db_xref="Rfam:RF00004"
FT   CDS_pept        join(complement(522833..522957),complement(522654..522753),
FT                   complement(522234..522584),complement(521912..521997),
FT                   complement(521731..521876),complement(521637..521674))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127354"
FT                   /orf_name="Pc22g02260"
FT                   /product="Putative uncharacterized protein Pc22g02260 "
FT                   /protein_id="CAP97514.1"
FT                   /db_xref="UniParc:UPI0001832B9D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP86"
FT                   /transl_table=1
FT                   /translation="MDPQWAFGGAIRRRPGAVPSRPGPLHTTQPHSLVFVFGLVCSLDS
FT                   AKPSRYEVQQLPVDPGHYGRKGHLHWKSLSTSFLLQTPGQAECLMKKEVASTGGSVSPV
FT                   TQCNEAYASTEAKSQGPKIEITTVCSGQTPDGVGDLGKKGGGLLHLLSGKGKKKEEEDS
FT                   GGDASLYTFSTLIDKVPTGSIALPESEMTLFHKFADPINSSYTLNNLTMSPTVHVISST
FT                   GNPRQARGFVCFQHHDRTTAMEPPNIALWGQRNKGLPHTKDPNGASNVIDITPGLQHKA
FT                   "
FT   ncRNA           523073..523263
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="U2"
FT                   /db_xref="Rfam:RF00004"
FT   CDS_pept        join(523785..523978,524055..524502)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127355"
FT                   /orf_name="Pc22g02270"
FT                   /product="Pc22g02270 protein"
FT                   /protein_id="CAP97515.1"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010036"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001832B9E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP93"
FT                   /transl_table=1
FT                   /translation="MVRTKRQNTQPLEDSSVAPETFTDGLPLPKLIAFDLDYTLWPFWV
FT                   DTHVSAPVKARDNNSRAVDRWGESFAFYPAVSSIVYACKHRSIPLALASRTQAPDLARD
FT                   MLKSLHIIPTFSDNPAANAKSIRALDYFDFIQIYPGNKTSHFSRIQQTSSVAYEDMLFF
FT                   DDEARNRNVETELGVTFCLVRDGMTRDEVDRGVRAWRKRNGIKKETAEEP"
FT   CDS_pept        524838..525593
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942455"
FT                   /orf_name="Pc22g02280"
FT                   /product="Pc22g02280 protein"
FT                   /function="transferase activity"
FT                   /protein_id="CAP97516.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniParc:UPI0001832B9F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP94"
FT                   /transl_table=1
FT                   /translation="MATLKPPTNTHRSSSASHSSGPPKAPLKADPTATIADTVVFQGRY
FT                   LVTIGAGTVVHPRAKFYAYEGPIFVDDGCIICEKAVIGAPPTSSRSPSPSRPPSTSPTE
FT                   SGASTPEPRKEISTRISYFVTVGPLATVEPGAHVHSSATIEALATIRRGADIGAHSKVC
FT                   SRCEIAAGGSVAEWVVVYGQGPGMRRKRARGVKEMSPAVVAAAQVAQSPLPGPAPAGKV
FT                   IEDARLMVLQKEREVLGRMLIPAAGGRKK"
FT   CDS_pept        join(complement(531872..532163),complement(525991..531815))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216655" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942456"
FT                   /orf_name="Pc22g02290"
FT                   /product="Pc22g02290 protein"
FT                   /biological_process="protein import into nucleus "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAP97517.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006606"
FT                   /db_xref="InterPro:IPR012929"
FT                   /db_xref="UniParc:UPI0001831F2A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP95"
FT                   /transl_table=1
FT                   /translation="MAETAIQLPYLSTHYGVSESSLTTLRQAPTVELVDQLLRSISKKA
FT                   QESDELKSDKLRLEVELENSVRSNESKVKVLKASVEKGHAEVSDLRQKLHESETTRSSL
FT                   ESEISTLKTSSSSNESETTSLKARISSLEASNRDTLSLLESKSAAYDKLAEELSLQHKK
FT                   TIELRRELSTAEQNLQSANAASASARFREQSLQQELDLTKKNNEWFETELKTKSAEYIK
FT                   FRKEKGARVSELQRENEEANSTIDSLRRSENSLKSRLDETEQRYETSLASIHQLKEEAI
FT                   QATESFRVELDSSNRLAELQGSAAQTAKQRVQECQLALEKAKDDAAQEISRLRVELETE
FT                   SNDKSAAERRIGELEALVAQLESEPARGRSASPAVSINGGAPSTPLRSSIMRAGTPTGS
FT                   FSPRASRGKGGMNVTQMYAEYDRMRTALAAEQRTCQELRNTVDEMVLELDSTRPEIEEG
FT                   RAEQTRLDHAVVEMSTLLEAAGKERDAALKEARKWQGQVEGLAREGDILRQQLRDLSAE
FT                   VKVLVLEVAVAKHGEEYDREELEKIARGEVEESAKDLNETGRFISKHLTTFKDLHELQE
FT                   QNHTLRRMLRELGDKQEGDEAQAKEATRRAEMDELKELRIRAQTNRDEIANLSAQMQSY
FT                   VKERDTFRSMLMHRKPTGEDPSVFSQSMPLGAAPQGAMETPGPDYAELLRKVQAHFDTF
FT                   REETTTDHKALRQQVNELSRKNSELMSDISRSSSQLAAASQRAELLQSNFNMLKNENTE
FT                   IQKRYSALFENANRQDLRTQQAAEDLVEAKGLVESLQRENANLKAEKDLWKNIEKRLID
FT                   DTENLRNERGRLDSLNANLQTILNEREHADSESRRRLQASVESLETELQSTKRKLNAEM
FT                   EESKKASMRREYEQETSQKRIDDLVTSLGAVREELVAAKTTRDHLQSRVDELAVELKSA
FT                   EERLQVMNSRPSVSAGTTEGTTEGLESGEGSGLSREQELSIEVSELKRDLELAKGELEH
FT                   AKQLAEDYQAISQASEERLESATETHDQYREETDRLVEEKNTKIQDLETRIEEISAELS
FT                   ASNTEMTKLREEQAEATRRLDEQKANFESEITRLKADNERHVTAAQYHQEDLNAQAEIA
FT                   KHAQQNYETELVKHAEAAKNLQAVRAESNQLRLDIAELRTKSEGYKADLSQKEESWAEQ
FT                   RAAYEGELSELQKRREEVLHQNSVLHSQLENITSQISSLQRDRMNVSDDEQEGDQAAPN
FT                   LEGLQEVIKFLRREKEIVEVQYHLSTQESKRLNQQLDYTQSQLDETRLKLEQQRRAAAD
FT                   SDHNALNHSKLLETVNELNVFRESNATLRSQLKQTETVRDQKIARENELVQEIEPLKTR
FT                   IHELESQSEAKDGEMQLLQADRDRYQQRIQNILQKYDRVDPTEMQELKEKLTNLENEKT
FT                   EAVSEREALQTQMESLQAQIAAFPEQLKQHSDERAHDLRTKLTEQFKARSKDLSARVKA
FT                   KQDELNVVLQEKEVIQTELQTTKKELEELKAKVAEAPANVSPTPAPAPAPAPAPAQAQA
FT                   PAPAAAEAAEETPVNATPASQFPTATVEIPGPGDAQKIQALEQKIQRLEAALAEKDGLL
FT                   ATQASEQDAKIKERTDRLKDMYNTKLNEAKAAHRQEIEKLSAGERSIPGTPGAGTPGGA
FT                   PDATPATPSKTFELAGFTLPELTDAQARELVAKHETIRTIVRNNIRGGVAREQQKLQQE
FT                   AQASGANEAALAGLRQKSADEKEALIKAHENEIKEKVTSAVELVEKKTAARLSMLDTRF
FT                   RTANAKIDVVSKAAAETPQKPVVEVWEIAKTARPAPVAVPAAKPPVPGATSVQTVAPAP
FT                   TLAAPQVPVTATSDPVPAPGPAPAPVPASAPVTAAPNIPTEQIAPPTAASEHAATQQGA
FT                   AQPTAPVNPFGQVQQTDQNQQTSSLPSKPPAGNPPGLMRALQSGLPIARGGRGGRGSGQ
FT                   QFGHQQHDQQQQQGQGQNQRGPGLQRGRGGRGGQGRGGNQNQNTAAQAQSPTANRGNLN
FT                   ASARQFIPGGNKRSRDDGPDTTPEGGSGGKRQRGGGGPQPRGGGSS"
FT   CDS_pept        join(532720..533597,533799..533808)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216656" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942457"
FT                   /orf_name="Pc22g02300"
FT                   /product="Pc22g02300 protein"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="transcription factor TFIIE complex "
FT                   /protein_id="CAP97518.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005673"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="InterPro:IPR003166"
FT                   /db_xref="InterPro:IPR016656"
FT                   /db_xref="UniParc:UPI0001831F2B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP96"
FT                   /transl_table=1
FT                   /translation="MSYLQNQLKSFNASVVESANRMPTQRRVASNQPVSGSSSQVPSSA
FT                   PTPSSSSDIKKKRHDPDIVYSQPANTGTGKDIMTQVLFAIEHMKNKNIPLKFSDIISYL
FT                   SLQHRAHDQGYVQALRSILQMHEKVEFDPSGANGEGTFRFRPPHNIRNSEQLLKYLQAQ
FT                   TTAAGMSVRELREGWPNVEEEINRMEKEGKLLVTRNKKDDHPKMVWPNDPSLIEHFDDE
FT                   FKQIWDKIKVPDVKVVKEELDKFGITPTNKNKVLGPRVIAPSKKAKKPRRSGKTTNTHM
FT                   TSILRDYSHLKRKR"
FT   CDS_pept        join(complement(534972..535035),complement(534751..534868),
FT                   complement(534081..534603))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115444" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976269"
FT                   /orf_name="Pc22g02310"
FT                   /product="Pc22g02310 protein"
FT                   /function="3,4-dihydroxy-2-butanone-4-phosphate synthase
FT                   activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="CAP97519.1"
FT                   /db_xref="GO:0008686"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniParc:UPI0001831F2C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP97"
FT                   /transl_table=1
FT                   /translation="MPSPTEVAHQFDSIEDTIAAFKNGEFIIVLDSQDRENEGDLIIAA
FT                   ESITAAQMAFLVRYTSGLICAPITPDLATRLALPQMVTENADPKCTAYTVTIDSSDDSV
FT                   TTGISAEDRALTCRTLASPTAQIDSFRRPGHIIPLQARPGGVRERTGHTEAAVDFCKLA
FT                   GKAPAGVIAELVEDGEIVEGKPEIGGNNGMMRRDGCLRFGKKWGIKVCTIEDLVAYLDR
FT                   VEGTGAAANGKY"
FT   CDS_pept        join(complement(537461..537503),complement(535795..537405),
FT                   complement(535445..535752))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216657" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670298"
FT                   /orf_name="Pc22g02320"
FT                   /product="Pc22g02320 protein"
FT                   /protein_id="CAP97520.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0001831F2D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP98"
FT                   /transl_table=1
FT                   /translation="MDKLPVEILSKIIDYLSPREKVQLQSISKKFFALARDNNQWRLHC
FT                   YEQSWAARQAARSAARPSESLISDATVSLSALGQESLSDIIRPSVPPVNGDSDDTGELS
FT                   WSERARAAAEWDSSAEGEHVDWYSEYIARHGPISLSWVEQPLIRKGEGKRGQSYEVKGM
FT                   GLLKDWSSARQNKIVAPLEDGSVCIWDLNHSHSANSQASKGKILGVSEPGILMTNLSGR
FT                   RDQSPSKTSLEFINLGEGVSVDSLRQRAYLAVGNVLNEVDLETLRVISQQRYPWSIFAL
FT                   SQETDYSVPLTLATTLSLQIYDSRLSAVEEEEAISSRCEQIASSHVPELGIFAQSDSPL
FT                   FQLQSNGQPPTRIRSPEPSDKGANYAPLFQPGPLSILHPPAPHVNTILLAGRFPSILCY
FT                   DRRYFPRLQTTVHSGGRLCGLASVPAPRFPIFSGSTYPESHSVVACGDYNGRGSLELYD
FT                   IKPAPEDDHRPANMTSTLSPEHKNRQSAASSKLLSVGSHGNRIVFSDAEGNIKWTERNG
FT                   RSEVRRWNINTSQPQIPFGRRSQRSTSQTEEDQPPRKILPTGGNLTGDELLIWTGERIG
FT                   RIKFSIPADYETEVDDKEVEEDDDVFMHAEVDEATREEMRHRRRDDWEREQRYGDYMRR
FT                   ALERQADEVRWMGSRGLG"
FT   CDS_pept        join(complement(539813..540147),complement(538236..539754))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216658" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976270"
FT                   /orf_name="Pc22g02330"
FT                   /product="Pc22g02330 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP97521.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015729"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0001831F2E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HP99"
FT                   /transl_table=1
FT                   /translation="MKLFPSSPSALYCACVNTLPDQDKVVRVLSRVSLPLLRRDISAYL
FT                   VSLSLCLLNHNSFPVPSCIYPLPCTFNRIHWILVSFIEMQHSQLAPLPNNVPFRIVSKT
FT                   IGQGAYACIKKACPLDSDNPVFAVKYIHKDYAARHGKISARQLQLEVTVHRHVSGHGNI
FT                   ISFYQTGEDDVWRWIAMELAEGGDLFDKIEADEGVGEDIAHVYFSQLVSAVSFMHSKGV
FT                   GHRDIKPENMLLTGDGNLKIADFGLAALFEYKGTRKLSTTFCGSPPYIAPEVISSSTRG
FT                   QNKGAGYHPDLVDIWSCGIVLFVLLAGNTPWDSPTDDSFEYHEYVETNSRTTDELWQKL
FT                   PPATLSLLRGMLTVDPEKRFSLEDVRRHPWYTRANKYLSTEGKLRDPINLATSMFESLH
FT                   IDFSQDPLSQSGKGSSRSFDPMDMDGDDGGANAGLSSTQPEMLGGGMLMDWDSPQNADL
FT                   FSSTQPFEKKFASQDAAIAGHLEDEPSMSQFSQQPSVPVSRTQNAQKFQDIIPSRSLTR
FT                   FYSAWELKLLVPLICEAFHRLGVPVPSVPAVGAGDTSAMIRVIAKDGRMCPLQGKVLIE
FT                   CVSEGLFEVEFVKIKGDPLEWRRFFKKVAILCKDAVFRPDE"
FT   CDS_pept        join(540718..540824,540916..541248,541303..541405)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942458"
FT                   /orf_name="Pc22g02340"
FT                   /product="Pc22g02340 protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAP97522.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR015582"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0001831F2F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPA0"
FT                   /transl_table=1
FT                   /translation="MDYSMEDTQNSAPDAQQASKLNSSGQKSDTQSVTKRLQAELMQLM
FT                   LSPSPGISAFPDADGNLLSWTATITGPTETPYEGLTLKLSFAFPNNYPYSPPTVLFKTP
FT                   IYHPNVDFSGRICLDILKDKWSAVYNVSSVLLSLQSLLGEPNNASPLNAQAAELWDSDQ
FT                   AEFKRHVLARHQDLDDE"
FT   CDS_pept        join(complement(543774..544102),complement(542417..543683),
FT                   complement(542080..542364))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000267656" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942459"
FT                   /orf_name="Pc22g02350"
FT                   /product="Pc22g02350 protein"
FT                   /function="nucleoside:sodium symporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP97523.1"
FT                   /db_xref="GO:0005415"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniParc:UPI0001831F30"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPA1"
FT                   /transl_table=1
FT                   /translation="MDKTQEADPTGSHVVHHADPVLDPENQHHHPHQHHTAYATEGRQD
FT                   EVVYSKDAEFEKGIVPEQTPMDNGSKNSNDEEAGENLPAKRTWYRRVQKQQRHIVHAVV
FT                   WLVFTGWWIAGLILHRHDIGWLIPFLLYLAITLRILFFYVPISIVSKPMHWVWDHTALP
FT                   FVRLIPEKLRTASAAALCIGVILIGSFVSEESMDNTRANRAVSLFGMVVFIFGLWLTSR
FT                   NRKKIVWHTVIVGMLAQFIVALFVLRTTAGYDIFNFISTLARELLGFASEGVIFLTSED
FT                   FYAYNTAFVPSSFFIVNVVSAIIFFVSFVQLLYYYNVLQWFIGKFAVFFFWSMRVSGAE
FT                   AVVAAASPFIGQGESAMLIRPFIAHLTTAEVHQIMCSGFATIAGSVLIAYISIGVSAQA
FT                   LVSACVMSIPASLAVSKIRWPEEEETLTAGRVVIPDDEEHRAANALHAFTGGTWLGLKI
FT                   AAMMSSILLCIIALVGLINGLLTWWGRYLSINDPPLTLELIVGYICYPIAFLLGVSRDG
FT                   DLLKVGQLIGLKLVTNEFVAYDRLQHWDDYKDLSDRSRLIVTYALCGFANIGSLGNQIG
FT                   VLSQIAPGRASDVSRVAFSAMVTGAISTFTSAAVAGLLITNEKQYFGSSS"
FT   CDS_pept        complement(546596..547156)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942460"
FT                   /orf_name="Pc22g02360"
FT                   /product="Putative uncharacterized protein Pc22g02360 "
FT                   /protein_id="CAP97524.1"
FT                   /db_xref="UniParc:UPI0001831F31"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPA2"
FT                   /transl_table=1
FT                   /translation="MSTSSNENTIFDFEVRKDEIDLAKSVPKLKGASNWRMWETQMFMM
FT                   LRFNNPVYVQLIRDEIKMPPPPRLPSTQIHLVAVSEPCFSKRLRATKKSKLTLLQRLLK
FT                   LAPSKLSLQIWSYASTAVMAKRSGKGLEKWEKANNRAFLQFVSTLEPHISSSLYDIINV
FT                   RVAYLATERSSLESVAPCHLPPV"
FT   CDS_pept        join(complement(549662..550104),complement(549516..549613),
FT                   complement(549143..549204),complement(548646..549014),
FT                   complement(548426..548479))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942461"
FT                   /orf_name="Pc22g02370"
FT                   /product="Pc22g02370 protein"
FT                   /protein_id="CAP97525.1"
FT                   /db_xref="UniParc:UPI0001831F32"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPA3"
FT                   /transl_table=1
FT                   /translation="MAEVVGVVSSVITFATVVVQVTESIITIKDCWSQFGDASSDLKYL
FT                   LKDFELFGLVPAEIEEDVLQEAFAFALTGNKHAMQSLEFSREAATSLQALTNELASDMN
FT                   SSSRLRKSYAAAKVVMQRGKLERHMARLRNAIQLLSLSQQCYTRALLRVQPDLIAEKLL
FT                   VQDMKNTAKFKPNAHQHEHTVSDVNVEDQTMRSWLNCLAIHRANNQGNSEIQSRVHLVH
FT                   GGLQLGVNHRQIDLSLLNNGYSKGRIPPKLVDGSKSLDISVNSPLPDLIQTMLGPDLLT
FT                   SKDLQVEGPWGFDSKNTTLVHCVVRKIGATKAALQGSHPWKKQRDILTGLIYLNVNVDS
FT                   K"
FT   mat_peptide     join(complement(549662..550032),complement(549516..549613),
FT                   complement(549143..549204),complement(548646..549014),
FT                   complement(548429..548479))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPA3 "
FT   sig_peptide     complement(550033..550104)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPA3 "
FT   CDS_pept        join(complement(552222..552496),complement(551898..552168),
FT                   complement(551495..551840),complement(550513..551438))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670299"
FT                   /orf_name="Pc22g02380"
FT                   /product="Pc22g02380 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP97526.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831F33"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPA4"
FT                   /transl_table=1
FT                   /translation="MTLRPLMQRARSVFHRMKLDSDEAASSSVDIDRNTVEAEKTDGPI
FT                   THPEDTLPNNGAELPGVPYEELQHGIQEVEAVTQTWSKVSLIFVFINMWFLYFTYAWIS
FT                   SIDGSLSTYVASSFQQHSLSGLPTAIADAFSAAVFLPVAKMMDTWGRAEGFLVMSICAT
FT                   VGLVLMASCNSFPVYCAANVFYYIGFGGMQFAVDVITADLSQLRNRALAYAFTSSPYII
FT                   TAFAGPKVANLFYAHTGWRWAYGTFAIIFPIVAAPLFFVLKFNLTKAKKGNAVVIRENS
FT                   GRSFFESVWFWTLEFDLIGVFIFTAGLVLFELPFDIASEAPNGWGTDYIIAMIVVGFSM
FT                   LFFFAFYERYIAPTPLLPYSFLTNRTVVGACLLDATYQLSNYCWNNYFSNFLQVVNDLT
FT                   IAEAGYITNTFDVVSGILLFFVGWAIRKTGRFKWLLYISVPLYIFAQGLMIYFRRPGQS
FT                   VGYQVMCQIFISIGGSIFIIVQQLSILAAVDHQHVATALALLNVVGTIGDSAGLTISMA
FT                   IWNNTYKKALTWYLPDLTDLAMIYEDLETQLSYAPGTQMRAAIQKAYGYTQVRMLSAGL
FT                   GVMVLAFAWTIMIKNIDLKKVAQVKGMVF"
FT   CDS_pept        join(553810..554079,554140..554895)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166524" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127356"
FT                   /orf_name="Pc22g02390"
FT                   /product="Pc22g02390 protein"
FT                   /function="phosphatidylinositol phosphate kinase activity "
FT                   /protein_id="CAP97527.1"
FT                   /db_xref="GO:0016307"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="UniParc:UPI0001831F34"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPA5"
FT                   /transl_table=1
FT                   /translation="MGNTRRESALTKSIQSGLLREPDKCKKTAWRRFLAFFTVRRIRLV
FT                   RYELELFVRLRKEIWKFDEDEYKASFRTSAQPPLKMIGDMGYSGSTFFSSLDGHFVIKS
FT                   LPRRFEHTFFQADLLEPYYYYMRDHPDSVLVWITDYVLSPYVTLGTLFGCTPAHHIVME
FT                   NILLGKDEDPNGGQWETYDLKPIDYFYPERDLIPEPLVSEETLNKLADTFNDKLHLWKK
FT                   DYDAFMQSLEADTKFLGEANAVDYSLFLVRMPASSKPAILGRHSPWREGLPSADGKWKY
FT                   RAVILDFFWARHKFHAQALSGAVQTFNVVGRKGPMSITTTAGEYREKFLTMVREMIQVQ
FT                   Q"
FT   CDS_pept        join(555487..555610,555665..557268)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199889" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942462"
FT                   /orf_name="Pc22g02400"
FT                   /product="Pc22g02400 protein"
FT                   /function="deaminase activity"
FT                   /biological_process="purine ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="CAP97528.1"
FT                   /db_xref="GO:0009168"
FT                   /db_xref="GO:0019239"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="UniParc:UPI0001831FED"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPA6"
FT                   /transl_table=1
FT                   /translation="MANTENEWELEEGIPQVGDPFIQQYLKGRDALIMEERKRRHDANL
FT                   RKSLSPIAARATKIVSQIRAQEQNELWSSGLDEVAAHQADEILYPGVMFNLAKGRMENT
FT                   KLWKIVEKMPKGSLLHAHMDAMFDINFLIDQAFSTPGIHMLAPKPLITAHDYENAPVLF
FT                   QYSSQPLEASQDKPSIWSETYEPSSLISIQKAASSFPKGGEKGFREWLHTRCVLMPEHS
FT                   YHHHHGVDAIWSIFTKTFPIVDSLLMYEPIFRACLHRLLAQLAEDGIRYVEFRIGFVFQ
FT                   FRKEGNDKPEEDHFEWCRVVEDVVSQFKQTDAGKDFYDPRIIWTTLRWFGNEAIVNSMK
FT                   QCIETKLEFPNLISGFDVVGQEDNGRPLVDLVPVLFWFRKQCAEEEVDIPFFFHAGECL
FT                   GDGDATDHNLFDAILLGTRRIGHAFSLYKHPLLIDLVKEKKILVECCPISNEVLRLASS
FT                   IKSHPLPALLSRGVPVSLCNDDPAILGHGRNGLTHDFWQALQGLENVDLVGLSMMAQNS
FT                   IRWSCYEDQSTAEWKAGIQNGVMGTGLKAERLQAFASDFEKFCEWVVLEFAEYDTGDD"
FT   CDS_pept        join(557656..557820,557925..563114,563167..564090,
FT                   564146..564163)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034150" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127357"
FT                   /gene_name="atg2"
FT                   /orf_name="Pc22g02410"
FT                   /product="Autophagy-related protein 2 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="late endosome"
FT                   /protein_id="CAP97529.1"
FT                   /db_xref="EMBL:ABO31073.1"
FT                   /db_xref="GO:0005770"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="InterPro:IPR015412"
FT                   /db_xref="UniParc:UPI0001593027"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7KAL3"
FT                   /transl_table=1
FT                   /translation="MASYFMPSFFQKRLLKYALSRLGLVDTEALDPDNLGIRWGQRSTI
FT                   ELRDIGLKLEKLSTLLNLPPSCELLSARVQLLRITLPADFHNSGILCEANGIDVHIRLL
FT                   SEESKKGQHVKRESEKHDYSAVPTPSGLAESFLESEPKEEREELQAAIASQSQVLPQDP
FT                   LAWSTDDDNELGLGSETLSLPSFVAGFLKGVVDRLQLKITDAVVRVDMELKQDGTSKRQ
FT                   PEHKPDLVAGLLSVGEIDVHGVSEKTVGPEESLPFREGKRLISMADINFGLLSDPSVFS
FT                   NYSRFAPPASPTTTMRSKGSQPSSRAPSPSPLDRSDEEPLAMTQSTIFEPPQAFGHFST
FT                   TTDRLEASAFSDGRFSDADSESGSHRGGYMEDSQIFGDDPFQDNPGYLDSVIDTQFDDF
FT                   DDEQSPVIHPEEGRGAGSEWRSHLSHGTRSLHQSQQGESSDGPLVPSGSYHVSQTHDTH
FT                   HSQIGSEIDEITQTTQHYDDYENEHDEISELSVSSHPPSTSSPRPEPERTSLGEETSNA
FT                   DLDESKLFSHDEAQSLYMSATSQGMSGSFMPQMPGGWGSFDSAPGAHGDRSKVIAPIDP
FT                   AHSAHDQGEADSRCTAPSEDNVTEQHDLDDQAQSQTLHKDRTSTPSSSGLHRINEMRKS
FT                   VLTVDKILLWLPPAASEEEEEEQVSAEPSPVLQKGNVGSDLNESTASFAESAPGESLLA
FT                   SRAYKSTRFGRDFSEARAQPSAGTGLPEIAVEVFSVSVHFDIATGWLLTKIGQRLSHTL
FT                   GTAERDPAEKQLRKDQPARTPPVHLVVHALSIKFIERVSGHVYSSDNSGSPLSPPYSME
FT                   DVILRLNLSGLNARLSAQSTTTKLNFDVSKFALGFASEDIIFFDERLKMRESTRDVLAP
FT                   SQGDISISLVKSADLAKVDISTLPLHINLNIQRLEEALGWMGGLSTILELGGSMSSVST
FT                   VKGSPPLSKQRPRGVHFETPAPGVHAPKGTSALWKVNARVGAILLDVTGETHSLQLTTT
FT                   AVKIVSRFEGIGIQIDKAKMIGPLSINDTSSDSPAKVTLNNIRLEFLFAPKEVDLDRLL
FT                   TLITPSQDKFDVEDDIMLDTLLRQRRQGSVLRMTVGRLETSISDTGGLEPLSSLAVELS
FT                   RLSNVTKYLPEDDRPGILTLILVRDFQGDVHVGGEVGDIESRLTSVEVAHITMPSLTAA
FT                   HIGTMTVRRNNNEELVGHALWPPNKYQDPDSSYPPVLMARFIPDEMDPTYKIKLHNLLV
FT                   EYTVPSVTAFLGLGGDKMSGDLASSMVNSIANLAEHSMSSPSMTGRSMSNESSSSTKPI
FT                   KLSVVFRDCVFGLNPRNSPAKGLAVLTNAKFGGTIHGDESAEASLDVRKASLMIIDDVY
FT                   HESAYNLHQRGSVVPQDTQAQAYIDKGYVPVSSISSATAGVKLTSAEDGTKSLDVELRD
FT                   ELLILETCADSTQTLISIMNGLQPPPPPNVNVKYRTEVMPIQDMFASFTGDAFAADPPL
FT                   PHDNDMATISEGSSREGQLTDELEYVSDFYPVKGGLGGAGIEAIDTDSNDLLDSFHSQY
FT                   QVSSSMTELDFQGDHFAKKSAVGGTAHRWDSTRNTYGFANDTKLERSPLRVRMRDVHFI
FT                   WNLFDGYDWQRTRDTISKAVKDVETKATERRSRGSRVSPSAEDEEESVIGDFLFNSIYI
FT                   GIPANKDPRELHREINHDIDDFTSETGSYATTTTVTGAGSRQGRPTSKREKKLRLHRSK
FT                   HHKMTFELKGVSADLIIFPPGSEETQSSLDVRVKDLEIYDHVPTSTWKKFATYMREAGE
FT                   KESGTSMVHLEILTVKPVPELAASEIVLKATILPLRLHVDQDALDFMSRFFEFRDETAQ
FT                   PSDTPGDVPFLQRVEINAVQVKLDFKPKRVDYAGLRSGRTTEFMNFFVLDGADMVLRHV
FT                   IIYGVSGFDRMGQTLNDIWMPDVKQNQLPSVLAGLAPIRSLVNVGGGVRDLVVVPMREY
FT                   RKDGRIVRSIQKGALAFAKTTSNELVKLGAKLAIGTQTVLQGAEDLLTTPNAPAFEEDS
FT                   LDEDEAKKISLYADQPVGVVQGLRGAFSGLERDLLLARDAVVAVPGEVVESGSAKAAAK
FT                   AVWKRAPTVILRPAIGVSKAVGQTLLGAGNTLDPSNRRKMEDKYKRY"
FT   CDS_pept        join(566065..566509,566570..566652,566724..567890)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942463"
FT                   /orf_name="Pc22g02420"
FT                   /product="Pc22g02420 protein"
FT                   /protein_id="CAP97530.1"
FT                   /db_xref="UniParc:UPI0001831FEE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPA8"
FT                   /transl_table=1
FT                   /translation="MNENLNYSAANGIWHGELLDSPLCQKCLQLHDHACTPLSKPFLAD
FT                   SADALSLPPRSIKSRITGALSLHDYHKFLSKSADRSGDPVDHTGKKLKRKTAALHLNRS
FT                   SPLSISYPVSVSSIASSPPPLSPSYSHSIVSQWSEEPEIGEAQTVQYQSTQSPRLPVVS
FT                   DLGTRARPNRKRVLQQRARAQAEEAERASKPQTSDSMLASTQAVATVSHGGACFEILNP
FT                   RKSLDLARIVSYIEDVDNCSTVSTDNQRDSTFPIEQGLDRVSLSQFTDASLPSFYSTNS
FT                   LYTSLPDEPSTPKGQPTDIPSSSPRIGEHVRSLSDYSLNEQTFNHWSRPAQRTENNDLR
FT                   IDTHNDHPSSDKGTPQSPQMASITEESNPPNLDFSRRPSTPSTQTFYSESEIGEPGSPV
FT                   YANGDWAQVDERDRGILFDLQEAETADQHNHPDYQYYPYSQEQEPPTPRETPLETPSGS
FT                   PMHPTFDSAYPYPSSISTSKLPYSAPFDPYTYDPVYFDPHVQSVLAAANAETMGLRGSP
FT                   ARALDELQRGARSGETSPRFEFQRRKSDDRKSGTQRKGLRKFFSWKS"
FT   CDS_pept        complement(568390..569298)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216659" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670300"
FT                   /orf_name="Pc22g02430"
FT                   /product="Pc22g02430 protein"
FT                   /protein_id="CAP97531.1"
FT                   /db_xref="UniParc:UPI0001831FEF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPD4"
FT                   /transl_table=1
FT                   /translation="MFEDFSFTSPSSRPARLALDPDDRLMVDSDSTLISPLSSRCPSPQ
FT                   SHRFRNISRSRSSHFHRNQQPPTSVPFPYDSDHKRLSISTLTQKLHEHTLTPTPDLQSQ
FT                   HTHRTGRHTPVSRYPGAGYVLTPPDTDHSDDGVDCLSSPSASSTTSPTFMPPDLVSELP
FT                   DFGLGKPFHNPQSHPYQQDIRAQRQQISRLQCNESEVEAMQRSLLDEPATSDCCDEDDC
FT                   HPSSLPPRSSPRRRAVTLSRSRFAPEGGEGRARRKSSSAGVLASRVEKTHGGFGKRNEQ
FT                   GLRRKSLVSAALASMVERDDD"
FT   CDS_pept        complement(571569..572054)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942464"
FT                   /orf_name="Pc22g02440"
FT                   /product="Putative uncharacterized protein Pc22g02440 "
FT                   /protein_id="CAP97532.1"
FT                   /db_xref="UniParc:UPI0001831FF0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPD5"
FT                   /transl_table=1
FT                   /translation="MVEGFAFPCLVKPSDLFSPPLRPIPCRRFMTSTIVEILYPLLAGR
FT                   SNGIYRFLSTIVGGSGLQTFSSRAQQDLTSNLIYQLLPATTIRLLHNPTATYVSSTDFA
FT                   PAHLVRIHRLPIKNGQYARACIYPFLFVTSCIWCLFFPLCFQHSISKSISRISRMFV"
FT   CDS_pept        join(572926..573021,573067..573155,573194..573353)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976271"
FT                   /orf_name="Pc22g02450"
FT                   /product="Putative uncharacterized protein Pc22g02450 "
FT                   /protein_id="CAP97533.1"
FT                   /db_xref="UniParc:UPI0001831FF1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPD6"
FT                   /transl_table=1
FT                   /translation="MDLETSHNAYALDPEAHRRSPPNKSRILERDQDMCRKLKHVEVMG
FT                   VKLTSCTMSSDRMHVEIGNSARLRYASDSWRHPGRVMTSKLQVLNVRSASFVREGLGSS
FT                   AWEAWEVGSC"
FT   CDS_pept        join(574180..574403,574474..574788,574841..575780)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000241290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823053"
FT                   /orf_name="Pc22g02460"
FT                   /product="Pc22g02460 protein"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amidines"
FT                   /protein_id="CAP97534.1"
FT                   /db_xref="GO:0016813"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniParc:UPI0001831FF2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPD7"
FT                   /transl_table=1
FT                   /translation="MACSHFLRTLPRTRLQSAKPVFSNPARTFSSSRIQAMLTTELSET
FT                   EVSALRTNKERLASDLHHSCQWGSGIRWGNGPTDTGMQRLALSQDDKSVRDWFIQTMKA
FT                   LKCNVTVDEMGNIFAVRPGRRANVPATFIGSHLDTQPTGGRYDGILGVLAGIEVIKTMN
FT                   DMGLETEGGVGVVDWTNEEGARFPISMVSSGVWAECIPLAHAHNLKEVPTVASLPTAAS
FT                   APETMKSALQKIGYLGDVPCSYKSTPMAAHFEVHIEQGPYLVSANQRVGVVTAVQAYRW
FT                   FRLNVIGRDTHTGTTAFEHRADALYAFAQMMVRAREVAASKGCLASVGIVEAKPGSVNT
FT                   VPGQVSFSLDIRGPETEQVAEVEKELRTDFDAIAAAEGAGIGKPCRVEWTLDFDSPAVK
FT                   FHEDCIDCVQQSAQAVVADASVADTKSLVRTIMSGAGHDSVFTSKRVPTSMIFIPCKDG
FT                   LSHHPEEFSTADDCATGASVILQAVVRYDRKRFL"
FT   CDS_pept        join(complement(576856..576857),complement(576750..576799),
FT                   complement(576499..576659),complement(576179..576442))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216624" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942465"
FT                   /orf_name="Pc22g02470"
FT                   /product="Pc22g02470 protein"
FT                   /protein_id="CAP97535.1"
FT                   /db_xref="InterPro:IPR005326"
FT                   /db_xref="UniParc:UPI0001831FF3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPD8"
FT                   /transl_table=1
FT                   /translation="MLIPKDDRKKIHEYLFREGVLVAKKDFNLPKHADIDTKNLYVIKA
FT                   LQSLDSRGFVKTQFSWQYYYYTLTPEGLDYLREWLHLPAEVVPATHIKQQRSHAPPRGM
FT                   MGGEEQRGERRGPRAPREGGYRRREEGKEGGAPGEFAPSFRGGFGRGRGAAPQE"
FT   CDS_pept        577233..578141
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216623" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942466"
FT                   /orf_name="Pc22g02480"
FT                   /product="Pc22g02480 protein"
FT                   /protein_id="CAP97536.1"
FT                   /db_xref="UniParc:UPI0001831FF4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPD9"
FT                   /transl_table=1
FT                   /translation="MAPSNVNVLLSSFPGLSLPATLSFTLPSTATTSDLTAKIASYLPE
FT                   SLLLHSLALTTTNNKHLTATSECIRSFLPTRDGVFTSTLLPLRLTAPIRGGKGGFGSQL
FT                   RAAGGRMSSKRKRNQGDNNSSSRNLDGRRLRTVNEAKALAEYLAVKPEMDKKEKEERQR
FT                   RWQSVVEMAEKRQDELKNGSGRQKLDGQWMEDREEMSEKTREAVLRAVKDGQWTDNLRD
FT                   AILGGSSTSASDEGSEEDASSSEDEESEENGQSSNSVSKPSAAPKAAPRKFIGFDDDDE
FT                   FMSDSDDEMDESAKGKGKARA"
FT   sig_peptide     577233..577301
FT                   /db_xref="UniProtKB/TrEMBL:B6HPD9 "
FT   mat_peptide     577302..578138
FT                   /db_xref="UniProtKB/TrEMBL:B6HPD9 "
FT   CDS_pept        join(578484..578946,579005..580455)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216622" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942467"
FT                   /orf_name="Pc22g02490"
FT                   /product="Pc22g02490 protein"
FT                   /protein_id="CAP97537.1"
FT                   /db_xref="UniParc:UPI0001831FF5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPC3"
FT                   /transl_table=1
FT                   /translation="MSLCSRAVFRNSRLSLLHLPLKSIPRSRARTLFSLSRAAPQPRVL
FT                   TDLRRQCRCFSTTCFHREQPPSEPQVGTLADSLPVCCPGCGAFSQTVEENEPGYYGTSR
FT                   KQIRKLLAARKEAIEHEIIQQNEAISTEGDKLSAQQDDTVEEAVPPKPIQAFPDEAIDP
FT                   ENNFLGPPGRITEVCDRCHDLIHHNKAVSSPKPTILSIRNYLEESPHRHNRVYHIIDAA
FT                   DFPMSLVPRIHWALMLQEQRSRNRRSTNEKYERGRKLPSLSFIITRSDLLAATKEQVDS
FT                   KMDYIRTELRAALGRSGREARLGNVHMISAHRGWWTKEVKEEIREHGGGIWVVGKANVG
FT                   KSSFIEACFPKDSRNVDKIEEWLQRRRGEDEIPNRPEATLLNPDSLLPPAPREDLYPVL
FT                   PVVSSLPGTTVSPIRIPFGRGKGEVIDLPGLERGLLEDFVRDEHKRDLIMTKRIKPERS
FT                   TIKPGQSLLLGGGLIRITAVNPQDTVMSASFLPLESHITNTQKAIATQAEEVPYRGTVI
FT                   MKEGTGSTMASAGVFDLKWDTTTSNLPTSLAKAVNDRGIPVPSLPYRVMSADILVEGCG
FT                   WIELSIQIRSKRDAEGEPSYPQVEVFTPNGKHIGSRRPIECWNFIAEKKKIDKRKRPRT
FT                   RY"
FT   sig_peptide     578484..578570
FT                   /db_xref="UniProtKB/TrEMBL:B6HPC3 "
FT   mat_peptide     join(578571..578946,579005..580452)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPC3 "
FT   CDS_pept        join(580852..580980,581152..581545,581604..581809,
FT                   581862..581941,582013..582180,582239..582452)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942468"
FT                   /orf_name="Pc22g02500"
FT                   /product="Pc22g02500 protein"
FT                   /EC_number="3.5.99.7"
FT                   /function="1-aminocyclopropane-1-carboxylate deaminase
FT                   activity"
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring nitrogenous
FT                   groups"
FT                   /protein_id="CAP97538.1"
FT                   /db_xref="GO:0008660"
FT                   /db_xref="GO:0016769"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001831FF6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPC4"
FT                   /transl_table=1
FT                   /translation="MMLSFRGSENVRELAMPWRFSLTQTYDPVENPTGLISFGMAENVV
FT                   FTQDSVSYRSSAPTAARLPAAAAVHLNNILKPHAPIDPEHIFVADSPTSLGSMLGYNLA
FT                   EPEDGILVSRPVYGRFELDYGVESGVRMVYADTTAEEAFSPACVENYERALKECGKEIR
FT                   AVLLVNPHNPVGRCYPVETLKAIARFCNKHRLHLISDEVYASCVFDSGDSTAVPFTSIL
FT                   SLDLAELIDPNLVHVLYGFSKDFASGGLHLGFLVTQNEQLRQACKAILRLHGASQAAVT
FT                   IGTAILEDQAFVSSFTAEARKRLASAYRLTTSVLDKEGINYVKGGNAGFFVYIDLSPYL
FT                   PPDGTITPRNREFALAQRLVDAGVFLHPGEEHSRSIGWFRLVFSQEEDTLKEGLNR"
FT   CDS_pept        join(complement(586302..586376),complement(583742..586242),
FT                   complement(583487..583685),complement(582825..583427))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216621" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127358"
FT                   /orf_name="Pc22g02510"
FT                   /product="Pc22g02510 protein"
FT                   /function="ATP binding"
FT                   /function="leucine-tRNA ligase activity"
FT                   /biological_process="leucyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP97539.1"
FT                   /db_xref="GO:0004823"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006429"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00018320B5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPC5"
FT                   /transl_table=1
FT                   /translation="MAAAAASVAELDPSNSSKNTLKLENTEKRDTLVAIEKKYQAQWKE
FT                   NKVFEVDAPSFEEAPQGAMTPAELREKYPKFFGTMAYPYMNGTLHAGHSFTASKVEFMA
FT                   GFARMEGKRALFPLGFHCTGMPIKACADKLANEVKKFGKGFEGYNEEAEAAEDAVAAPT
FT                   QEVKTEAAEKFSGKKSKAAAKTVKMKYQFQIMLAIGVPLEEIHKFADAAHWLDHFPPLA
FT                   IRDLDSMGARVDWRRQFVTTDANPYYDAFVRWQMNRLHELGKIMYGNRYTVYSPKDGQP
FT                   CMDHDRTEGEGIGPQEYSAIKLQVKEWSPEMAELVKGKVEDDAKVYFVPATLRPETMYG
FT                   QTSCFVGPKINYGLFKLKEKEYIVVTKRAAWNMAFQGHFFGDKFPKTQDELPQVLEAPG
FT                   SAFIGTLVNAPLSFHTAGIRILPMESVSAAKGTGVVTSVPSDSPDDYATLMDLAKKAEY
FT                   YGIQKEWAELEIFPLIETPTYGNLTAPALVKQLKINSPKDVTQLAQAKDLAYMEGFYKG
FT                   TMLVGNYKGEPVSEAKDKVRKELYESGDAFPFADPMGKVVSRSGDDCVVAYLGQWFLNY
FT                   GENDAEWQQETLNHVVNNLNTYSAECKNGFEKNLSWLNRWACARTYGLGSQLPWDKQFL
FT                   VESLSDSTVYMAYYTIAHLLHGDRYGKTTGPLKVTADQMTDEVWDYIFTRREISDELVS
FT                   KSGISKESLQQMRREFEYWYPLDVRVSGKDLIQNHLTFFLYIHIALFPKEYWPRGVRAN
FT                   GHLLLNGEKMSKSTGNFLTLKDSVDKFGADATRIAFADAGDSIEDANFEESVANSNILR
FT                   LYTLKEWIEEVVKDEALRTGPADAFADKLFNNELNSLVRETQKHYQDTDFKLALKSGLY
FT                   DFTSSRDSYREASTAAGVGIHRDTILRYIELQALMLAPIAPHWAEYIWLEVLKKSESIH
FT                   FAQFPAVPEPSPELTAAQNYVRGTASNIMGSEANFTKKLSKGKAITFDPRKPKKLTIFV
FT                   AKKYPNWQEKYIDLVRESFDSLNLSFNDKELNAKVGKFGEMKKAMPFVQNLKRRLVNAG
FT                   ESPATVFDRKLPFDEFAVLSEMVGGLKRTSGFKEIEVIAVDEGGKTGEVVGTGEKREGL
FT                   SGENAVPGTPTFQFVNVE"
FT   CDS_pept        join(586908..586946,587164..587739)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942469"
FT                   /orf_name="Pc22g02520"
FT                   /product="Pc22g02520 protein"
FT                   /protein_id="CAP97540.1"
FT                   /db_xref="InterPro:IPR007741"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI00018320B6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPC6"
FT                   /transl_table=1
FT                   /translation="MVNLFKRLRKLQTMLQTKVGTGAAIFPNVASASKEFPAVTRLHLT
FT                   YARKIDQGHGGARHFWRNCLPRLKYHNPAVPMTVAQTSNQQGPAALTIYFAERVGSAAA
FT                   ALANEKKVVDELAPAPEANEQSAVLDIKNRTYQQIWDRVQAMTGAKVVPATSDDIALSQ
FT                   KLAEIKKRSGPDRQRVLAIRQAKKDQERMLAEARGQVDKQV"
FT   CDS_pept        join(complement(592273..592283),complement(591992..592082),
FT                   complement(588159..591932),complement(588097..588105))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192269" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127359"
FT                   /orf_name="Pc22g02530"
FT                   /product="Pc22g02530 protein"
FT                   /function="ATP binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="Mre11 complex"
FT                   /protein_id="CAP97541.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0030870"
FT                   /db_xref="InterPro:IPR004584"
FT                   /db_xref="UniParc:UPI00018320B7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPC7"
FT                   /transl_table=1
FT                   /translation="MLTGVRSFDNTRSETIQFHTPLTLIVGYNGSGKTTIIECLKYATT
FT                   GDLPPNSKGGAFIHDPKLCGEKEVLAQVKLSFKATSGAKMVATRSLQLTVKKTTRQQKT
FT                   LEGQLLMVKNGERTAISSRVAELDQIMPQYLGVSKAVLDSVIFCHQDESLWPMSEPSVL
FT                   KKRFDEIFEAMKYTKAIDNIKALRKKQNEELGKFKIMEQHAKEDKDKADRAEKRSVKLQ
FT                   DEIEALREETQKMSQEMRRVAELADKAWTQSESYAQVLGALEGKRIEAKSIQTTIDNLK
FT                   RHLVELDESDEWLESTLEQFETKQLQYQQQEESHKENYMEIKERIEQTRHRLGLKQAEN
FT                   GKFENDKANFERQSQRRQSMINEIARANNIRGLDETMGQSEIDTFMQKIKRLLRDQNQS
FT                   LDRVKREAQKELREVQETLNEIGQTKSALQETKNAAKRQIAANDKEATTYQKKLNEIEV
FT                   DEGFQAALESKVEDITSRLEHAKERAKTAPWDQDIQDTNAEIRRLEDESSRLNTELIDS
FT                   TKKAGELARLDHLKKESKDRERSLQTMKGAHGDRLKKVVGPDWKPETLERGFQQALDSE
FT                   SKQVADAERERDGVSRELEHVEFKLKTAKKNLKQRQKELDECVKEIHEAVDAEPSEYPE
FT                   IVKERQAQYDLARKDADQYAGMGEYLTKCLDAAKRTKLCRTCQRSFKNEAELQTFTKKL
FT                   DALVKKAGLDAEDETLKGLEEDLETARAASASYDTWVRLSETVIPELEQEEQECESQRD
FT                   QLLEKLETQDGKVSEKTESKRDVEGLAKTVSTIARYDAEIKTIKSQIQELSAKQQDAST
FT                   ARTLEDIQEEIASINEKSRELKKTLSKVTNEKEKTRSEINKLELEFRDVKSNLDNAKFQ
FT                   LEKKADLTVRMEEFKKLNNQQREAIEKADRDIENLTPELLQAQARYDDISQRADERERD
FT                   LQHEISRLSENIHQLDLANDDINSYNQRGGPGQLERSKKELQEIEAEIGKLEADQSEIT
FT                   REINKISTQLKDSENTKRQYSDNLTYRQATRSLNTVVEEVEQLEAQNAEVDRGRFKQES
FT                   ERWTREHNALAAKQASKMGEMKSKDDQLMQLLADWNTDYKDAASKYKESHIKVETTKAA
FT                   VEDLARYGGALDKAIMQYHGLKMAEINAIAGELWQKTYRGTDVDTILIRSDNENAKGNR
FT                   SYNYRVCMVKSGAEMDMRGRCSAGQKVLASIIIRLALAECFGVNCGLIALDEPTTNLDR
FT                   DNIRSLAESLHDIIRTRQQQANFQLIVITHDEEFLRHMQCGDFSDYYYRVSRNERQKSI
FT                   IERQSIAEVM"
FT   CDS_pept        join(592845..593982,594079..594122)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192280" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942470"
FT                   /orf_name="Pc22g02540"
FT                   /product="Pc22g02540 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="signal transducer activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAP97542.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="UniParc:UPI00018320B8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPC8"
FT                   /transl_table=1
FT                   /translation="MALSRPQPCEGMPLPSSQMTLSSDEVHTGYSMEQQQAHGSYGGNY
FT                   GVQGAQHEGYQGVQSDGVWTERVLDEMKDMLLLLTPQGRITYANPSCKDITGRVAKQLE
FT                   GSLLAQYIHEDDQPILQRDMDDSVATNQSFRTHLRFQKTNGTYCLMEAYGHSHVANQEE
FT                   RQAGRTTTANGPCAGFFLVCRPYINKVSQLLDSFLEYKIENARLIQQIAKLKQEEDAEA
FT                   TTARVPSSRSDQDNRGPVTENQGRRSIRSGEMSSDPDTTDTVGPNSEESDTSQSTGYGP
FT                   GRNTREVYSHIDGIEVMTGLNYAEGERSQGLSTGVSRGRLVHCDIDITTAADQERNAQE
FT                   GDRRKRLKAQHVCSDCGTADSPEWRKGPNGPKTLCNACGLRWSKKEKKRHESA"
FT   CDS_pept        join(complement(595864..595892),complement(595431..595721),
FT                   complement(594902..595358),complement(594664..594846))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076650" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976272"
FT                   /orf_name="Pc22g02550"
FT                   /product="Pc22g02550 protein"
FT                   /protein_id="CAP97543.1"
FT                   /db_xref="UniParc:UPI00018320B9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPC9"
FT                   /transl_table=1
FT                   /translation="MLLTLQLSSSSSGSGSQALTTFSPIDSDSTFSPPPTTGMSLTFEP
FT                   LSKSFSVISCKSESDILDLVVRTLEDCDSKVDKAARYYFTDIPAAWGPSIFACLDDEKL
FT                   LPRKYRKSWNSRDHVLCLKLPNLIHNSIQRWFANCASEWERSGLITPNEKDMIDGTFGT
FT                   TLTLTNSPFTKTLKEPDILVDPDDQHLPSVVFESGWSEPLNTLEADCELLLRGSGGLVQ
FT                   VAIIVNWTLNHTHQTVSGEASVWQLNNSDQPIRRQTEVIFPDPKLPIPQGLSITRGELW
FT                   RRSLAPTRNPNEALRLDIDILRGHALRALSRMRLGPAT"
FT   mat_peptide     join(complement(595431..595696),complement(594902..595358),
FT                   complement(594667..594846))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPC9 "
FT   sig_peptide     join(complement(595864..595892),complement(595697..595721))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPC9 "
FT   CDS_pept        join(complement(597444..597682),complement(597089..597388),
FT                   complement(596578..597007))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192291" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670301"
FT                   /orf_name="Pc22g02560"
FT                   /product="Pc22g02560 protein"
FT                   /protein_id="CAP97544.1"
FT                   /db_xref="UniParc:UPI00018320BA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPD0"
FT                   /transl_table=1
FT                   /translation="MQLLFPKKHKHHRIVLWLMAGEFPLTIVMLTLTGIASHDLYRTLL
FT                   WQDGADNGFNSAPNEALYAAANYQPFKAPMVWSDFTTDYNLVMGVLSTFFLITKLPTHW
FT                   MKLFYPPVAVAVHGSLVILYIVSAAYQAGSDTSDPRHPQPGAPWYIAKSCSVASKKSNI
FT                   PYCMQAKALFAVTILMIVYYVVILGFNIHSCFITPEEREAILEQREERRIEKEFEEEII
FT                   KSPSMIPMTPGSMPQGPGMVPRTPGVPPIAVGGSFSPYAPRTLAFNRLGNASTASDLPL
FT                   RDNSRATQPQYPSPQSHEVSPESSTGSPMYFPPPPKKAAKA"
FT   CDS_pept        join(complement(598369..598400),complement(597915..598314))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823054"
FT                   /orf_name="Pc22g02570"
FT                   /product="Putative uncharacterized protein Pc22g02570 "
FT                   /protein_id="CAP97545.1"
FT                   /db_xref="UniParc:UPI00018320BB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPD1"
FT                   /transl_table=1
FT                   /translation="MTAMAVTNEGPPLHGHRCDLTSPPTSAFRRRFVRKAASFLGGSGF
FT                   SADPVEGNYVMRAPCRSAILSHRLACDERRSSLDPRHLIGVMTPACYLRWRFAAIKHWP
FT                   DAPPKHTSIPLHGLSMLIRAPSCMRWLVPSATRWSRAHI"
FT   CDS_pept        join(598730..598885,599102..599487,599607..600075)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127360"
FT                   /orf_name="Pc22g02580"
FT                   /product="Pc22g02580 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97546.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI00018320BC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPD2"
FT                   /transl_table=1
FT                   /translation="MTSQRDESLPHELRTAAEPRQNRLYPVRLSHIEQVNPSVRLLQFA
FT                   LPSQENNDNNQQPFSFLPGQWLDVHIPSLAQAGGFTITSTPADAEVLPSPEASTDSLAG
FT                   EALEPSSESQGRPPYVELAVQDSPSNPSVAWLWRPREEILGRELNIRVGGSFVWPPTGI
FT                   SINDVKNVVFVAGGVGINPLISMLSHLNNNEPHTPNPKTIHILYSSRLPQHQGTGSADA
FT                   ILDQVLFLPRLRQIIRSQESSHRLRISLDLFLTDLASSSDLLSSGSPSDLKIHPGRISD
FT                   HDLRSAAVGTGDELDSQGTVCYVCGPPDMTDSIVEKLVAILGDDGEQRVFFEKWW"
FT   CDS_pept        join(complement(602174..602188),complement(600747..602125),
FT                   complement(600422..600686))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192313" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942471"
FT                   /orf_name="Pc22g02590"
FT                   /product="Pc22g02590 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP97547.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI00018320BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPD3"
FT                   /transl_table=1
FT                   /translation="MARRLVRASVQLGLFATFILLVVVILDNRYSVLPSSIHGHLPSHY
FT                   SGYVITDVTVTACSSLNPFSSCKLDPESWYRVDKDLYLRSGWTSSAYVQFKRKKEEELG
FT                   PDDKVVIDLKISRLTPQSESVGKSEIEAWEPRPGGIWLKRSSSRHASDSESAVTYVDVL
FT                   YGADAVDPRPNWEVKDTPILLDSRTEELETRLSIRRGHPQAKLKKPVPRINENGKFKVM
FT                   QLADLHMSTGLGHCRDPVPTEAETGQKCEADPRTLEFVERLLDEEKPDMVVFSGDQVNG
FT                   ETAPDAQSALYKSVKLLVDRKIPYAAIFGNHDDEGDLNREQLMALYEDLPYSLAVAGPE
FT                   DIDGVGNYVVEVLDWGKSTHSALTLYFLDTHSYSPDERQFRGYDWIKPSQTRWFKNTAQ
FT                   SLRRKHQEYNHIHMNVAFIHIPLPEYRSSGKYFKGSWMEPPTAPGFNSGFKDALEEEGV
FT                   LFVSCGHDHVNDYCMLEQDDNSKPSLWMCYGGGVGLGGYGGYDDFVRRVRFFDFDRGPG
FT                   RVSTYKRLEWGQTEAKIDEMMIVDGGTVNSPEEAT"
FT   CDS_pept        join(complement(603561..603648),complement(603495..603508),
FT                   complement(603370..603446),complement(603007..603309),
FT                   complement(602800..602948),complement(602592..602734))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942472"
FT                   /orf_name="Pc22g02600"
FT                   /product="Pc22g02600 protein"
FT                   /function="phosphatase activity"
FT                   /protein_id="CAP97548.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00018320BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPN0"
FT                   /transl_table=1
FT                   /translation="MGSNALPYLETKPKLIFFTDFDGTITVDDSNDFMIDNLGFGREER
FT                   LVLGNQVLDETMSFRDAFRKMLESIKTPYDECIEILLKNMKLDPYFEEFYHWAENNNVP
FT                   IVILSSGMRPIISALLEKFLGHKPASHLTIISNEPTSRDGKDINSEGGWQIEYHDDSHF
FT                   GHDKSLEIKPYAALPDGERPILLYAGDGVSDLSAAAETDLLFAKQGKDLVTYCQRKGMP
FT                   YTTFENWSTILSTSKDILSGKVSASEVAAKASLGL"
FT   CDS_pept        join(603843..603849,603996..604142,604204..604274,
FT                   604337..605317)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976273"
FT                   /orf_name="Pc22g02610"
FT                   /product="Pc22g02610 protein"
FT                   /function="tRNA (adenine-N1-)-methyltransferase activity "
FT                   /protein_id="CAP97549.1"
FT                   /db_xref="GO:0016429"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="UniParc:UPI00018320BF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPN1"
FT                   /transl_table=1
FT                   /translation="MSQGDRVILHGKQPSLSKALKRGEKLQTPRGAVEHDSIIGKRVWD
FT                   TVQSRKGLNLRVSLPTLEEYVALTPRLVTPIYPQDANLIASLLDIHVNTPAAGEIQPTT
FT                   EILESGTGHGSLTLHLARAIHAANTTPPPRPSRSQINYLEGRVTRPGEKDTEQAGEEPA
FT                   EQTADPAQEEWDAWRAQRNAVIHTVDVSPKFSALAEKNIRGFRRGIYAGNIDFYVGPVE
FT                   NWIAQQKQQRKKTGLASLTGGNPVDPFLSHVILDMPSSNLRIPHVTPMLKRDGLLVVFM
FT                   PSITQIGECLQLIRDHRLPLVQEKVIELGSGMSGGRIWDVRFATKKSGADPSSWAVPSD
FT                   AEGATPVEADEQSAASDAISEVSTLEEPPKGGESVLVCRPKVGVRIQGGGFVAVWRRIE
FT                   DR"
FT   CDS_pept        join(complement(606747..606812),complement(606576..606630),
FT                   complement(606434..606503),complement(605505..606324))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199831" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942473"
FT                   /orf_name="Pc22g02620"
FT                   /product="Pc22g02620 protein"
FT                   /protein_id="CAP97550.1"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="UniParc:UPI00018320C0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPN2"
FT                   /transl_table=1
FT                   /translation="MYTEESVHTLPDGLDLYAKTWKTSGSPLAVLAFIHGFSDHCNAYH
FT                   DLFSTLASAGVEVRSFDQRGWGRSVKQTSDRGNSGPTSQVLSDIHSFLQSLPSRPDLPL
FT                   FLMGHSMGGGEVLNYIFHPESPYNRETYNRPNFTGVLLYSPLIAIDPSSRPSKLTVSAG
FT                   RVVAKLVPNKQRYSPLDHSLLSRNEDVVREVMADELCHDTGTFEGLAGMLDRGIFLEGM
FT                   FAAGPEAWVESELPFWFGHGDGDRITSYAAVQDFVGAFTENGGNVKFCPYEGAYHKLHA
FT                   ELPETTERFLADVKAWVLSKVPATKEVVVQHEVEGVEGEDTAAHEDAGADGKAKL"
FT   CDS_pept        join(607409..608014,608085..608486)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112414" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942474"
FT                   /orf_name="Pc22g02630"
FT                   /product="Pc22g02630 protein"
FT                   /protein_id="CAP97551.1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="UniParc:UPI00018320C1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPM2"
FT                   /transl_table=1
FT                   /translation="MPLLYQVKITVKFLNVLFSFVTFLTLGSMLYYFRQRVPSILRPAI
FT                   SQSLLRPKYSGRMFSAIPQADASYRTLALSPSEDSPDIRQKYRPFILDDNSTEDWVNEL
FT                   DLATAADMAENNLRVTNQRLKVLVLYGSLRKRSYSRLVALEASRILFRLGCDVRVFDPE
FT                   GLPVKNEIDTAHPKVQELRELSLWSDGHVWVSPEQHGNLTAVFKNQIDWIPLSTGSVRP
FT                   TQGRTLAIAQVCGGSQSFNAVNSLRILGRWMRMFTIPNQSSIPKAYTQFPDEGQPDDQR
FT                   LMPSGNRDRLVDCMEEFVKYTILMRPHIDLFGDRFSEREERKIKEAKLKAATAS"
FT   CDS_pept        join(608713..608767,608954..609078,609134..609248,
FT                   609304..609482)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217895" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670302"
FT                   /orf_name="Pc22g02640"
FT                   /product="Pc22g02640 protein"
FT                   /protein_id="CAP97552.1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI00018320C2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPM3"
FT                   /transl_table=1
FT                   /translation="MLTLVLATVQNDARALWKPYATQRTIAGSISRVELLRWFHEGKRI
FT                   GKDFVLVDLRRTDFEGGTIRGSLNLPSQSLYPTIPTLYSVLSQGGIANVVWYCGSSRGR
FT                   GVRAANWFAEYLEEQRDMTIKSLVLEGGIKGWATAGKDYTQLMDEYDELKWVK"
FT   CDS_pept        complement(609665..610036)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823055"
FT                   /orf_name="Pc22g02650"
FT                   /product="Putative uncharacterized protein Pc22g02650 "
FT                   /protein_id="CAP97553.1"
FT                   /db_xref="UniParc:UPI00018320C3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPM4"
FT                   /transl_table=1
FT                   /translation="MGRGASITVGKFLCHLEGHPGLKAFMRIYHQIPIAGTEYADPDIL
FT                   AQRAVLPEVYGELESLMLLKGCPAVPQFLGHAKKKHKESTDSLLVATHIFRVEKSPRGT
FT                   SDEGILLELESLRARGATL"
FT   CDS_pept        join(610866..610880,611123..612022)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000038810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670303"
FT                   /orf_name="Pc22g02660"
FT                   /product="Pc22g02660 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97554.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000183218E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPM5"
FT                   /transl_table=1
FT                   /translation="MQTQIASIIAALASEGAIHPMDTVITRMQSPMYSSVYKHLNGTLN
FT                   RALFSGLYQGFGPTFVAGTLSSVAFFTAYEASKMAFDNAQSAGYMLGVPRPLIHVASSA
FT                   VAELLACAIQNPGEVLKQNAQVFQQPLNAQRGPSPTMEMLRQFRKYPSGLWAGYTALVA
FT                   SQLPSMCLTFCLYEMFKENLLERWKTEKDDIRQQLEATVLGAGAAGGCASWFFVPIHVV
FT                   KTRMRLAVGEQTGSTQSSLKAVPGLSSRIGAFAIARNVLRKEGVAGLFRGSVLTCVTAV
FT                   VGGGLYIGCYEGAKIYLCNYQAS"
FT   sig_peptide     join(610866..610880,611123..611155)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPM5 "
FT   mat_peptide     611156..612019
FT                   /db_xref="UniProtKB/TrEMBL:B6HPM5 "
FT   CDS_pept        join(complement(613332..613418),complement(612944..613282),
FT                   complement(612783..612893))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048422" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942475"
FT                   /orf_name="Pc22g02670"
FT                   /product="Pc22g02670 protein"
FT                   /protein_id="CAP97555.1"
FT                   /db_xref="UniParc:UPI000183218F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPM6"
FT                   /transl_table=1
FT                   /translation="MSCINPLITTSLSSFSYSQSDKPIIKTISIPRTIYLAVLSSGTQP
FT                   AHYAVYIPTCDTGDVGKLIHVTGNPAQGFFLEFRRNYDFDAPQPSFQLIPLAQVDDRYI
FT                   KDTVGNKEIGDTIARDRFESVATTVQPPSRSPNPFDLSAPNCQNWLLDYTEKLVAEDYV
FT                   PDSTLSVIRNAPKVL"
FT   CDS_pept        join(complement(614240..614909),complement(613729..614162))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162057" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823056"
FT                   /orf_name="Pc22g02680"
FT                   /product="Pc22g02680 protein"
FT                   /protein_id="CAP97556.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001832190"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPM7"
FT                   /transl_table=1
FT                   /translation="MALEFRFLNSVDPTCFATHIYFGGSSYSSPDTLSLHEIMAVPIHD
FT                   PLVGPILINQHGRVRLTPSMIPDASNFDAKDSSFFNKWSELPSPNQVREKAEAQWLSGT
FT                   SLDKRRSLLYGGAHVRPPPAVFEDMGLVVKWGIQVGISEAQSIYAIHRFLNGRIPVPEV
FT                   YGWRTDRDEKFIYMQYMRGRTLEEAWESLEHNERDIVCHQLRTAFNNLRQLKQDPSDTF
FT                   IGNIMRSPLYDRALHLNYLSEAGPFTSVHEFHEWFTFLPRRPMPDPHSVPIEPFRHELF
FT                   DDSSIKFTHGDLHRSNIILTPSKPYRLLAVVDWEQSGWLPEYWEARKAQYTAFHREEWS
FT                   TKYLPMILDQYASTADPWDWYISAMGC"
FT   CDS_pept        join(complement(617458..618313),complement(616200..617389))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294222" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942476"
FT                   /orf_name="Pc22g02690"
FT                   /product="Pc22g02690 protein"
FT                   /protein_id="CAP97557.1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI0001832191"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPM8"
FT                   /transl_table=1
FT                   /translation="MYGQAHQGQHVMMNGGQAHQRFGMPIPKFQSQTHHSHHTQQPHHH
FT                   AHHTQATHNLTHQHNFPGGALATTTTSHFNSTHLQNGVPTAEDDIDESMNEHWQQQLQL
FT                   AAESRQATSPHYHARVIAQQTKGIQLMSSNTDTENGTDGRNGASAAKPASRQGWNALDF
FT                   GGQGLRALTTSLFNYGFIEKLYLNSNKLKVLPPAIGQLRKLNHLDLSGNELTELPEELG
FT                   MLSNLKKLLLFDNNIRTLPYEMGYLYRLETLGIEGNPLNDVLKSQIMKDGTKALIKYLK
FT                   EEMPVHLPPPDRDWVILDDTSTSSNSNTEKITVLSYNTLCDSSATQSHYGYVPSRVLSW
FT                   EFRRELILNELRSHNADIVCLQEVDQGSYNNFFREQLAYNDYKGVYWPRGRAMGMQEED
FT                   ARMVDGCATFFKGSKYILLDKQLINFGQTAVRRPDAKGQDDIYNRLWQKDHIAVVVFLE
FT                   NRQTGARFISVNAHLYWDPAFKDVKLIQTAILMEEITKLSDNYAKWPACTDKTAFRFSE
FT                   AESGSETTPVVEPAPSMEYTSGDQIPVLMCGDFNSSPGSAAYNLISTGRLPEDHPDLEK
FT                   RLYGNLSKVGMTHPFKLKSAYSSMGELSFTNYTSDFTAILDYVWYSSNTLHVSALLGEV
FT                   DKEYLRRVPGFPNFHFPSDHVALLAEFTVKGKKGKVVEADFGPQRH"
FT   CDS_pept        621201..622370
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192335" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127361"
FT                   /orf_name="Pc22g02700"
FT                   /product="Pc22g02700 protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAP97558.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI0001832192"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPM9"
FT                   /transl_table=1
FT                   /translation="MALGFSAATASGSDLHSNLSSTLAASSSSLSSLTDYSTYPLMRQG
FT                   DRTYFRDPENVYPLPCDLPEIHRQSLRTFMLLRVLGGPFCNPHLANRPPKRVLEIACGS
FT                   ALWSGLCHDYFTRRGHPDVAFAGIDVISIAPDLRKQGMNWQFKRHDLRRPRLPFPDNYF
FT                   DFVFIKDAGMCPSSPAQSASGLSEPLRVLKSGGILEVWDSDWSFRSLLPNPAPARKTSS
FT                   KEQEIADATATYTFSSATPFTRAQNKFMVDYNSWLEKSFDRLKLTALPCATIGLSFNSE
FT                   VDLLENVDSRRVAIPLGDLRWERDGQIKDSNGRPRKALTPEQIAIRRTALLTTIQMIEG
FT                   LEPILMESSGKGRDEWDRWWAAMTADLLQKGGLSSGECLEVSAWWGQKK"
FT   sig_peptide     621201..621272
FT                   /db_xref="UniProtKB/TrEMBL:B6HPM9 "
FT   mat_peptide     621273..622367
FT                   /db_xref="UniProtKB/TrEMBL:B6HPM9 "
FT   CDS_pept        join(complement(623192..623237),complement(622885..623084))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192356" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976274"
FT                   /orf_name="Pc22g02710"
FT                   /product="Pc22g02710 protein"
FT                   /protein_id="CAP97559.1"
FT                   /db_xref="UniParc:UPI0001832193"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPS9"
FT                   /transl_table=1
FT                   /translation="MVNPELRRQVINVYKGREYPLGYQYFRDRLHRAFASQKQITDDEQ
FT                   IRKGIARAEFVKKGKFCLYCWDAYPSGAVEDMVLIA"
FT   CDS_pept        join(623569..623979,624223..624396,624476..624829)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192357" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127362"
FT                   /orf_name="Pc22g02720"
FT                   /product="Pc22g02720 protein"
FT                   /protein_id="CAP97560.1"
FT                   /db_xref="UniParc:UPI0001832194"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPT0"
FT                   /transl_table=1
FT                   /translation="MLSVIGGRSAESNIGTISPRQHNMLPKSAFPAQLSASISLCSNGT
FT                   RRLFSATSPTTFSQKLPDSASTPINPRWLTMTKRRVGKCMMFGMKPSQIDEGGKILQQL
FT                   AKEWRELVAGSEGFLTDKKRRSLFRHNVVWGEQQGHVNNVTYVRYAETARVNWTRNIGN
FT                   YIDTANKKEWINMLGSTGIGLILKSIKVDYKFPMESPDKITVYQRLIPDPSGHLSSQSA
FT                   FRLEVMILSEAHQRPAARCFEDIVIYDYKKNRKTVNIPPFVMEQFEAMWKQQEQEKENW
FT                   RRRIAEIETRVRNLELKSWDRADAVEDNGSA"
FT   CDS_pept        join(complement(626159..626200),complement(626012..626104),
FT                   complement(625715..625955),complement(625414..625652))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000174302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942477"
FT                   /orf_name="Pc22g02730"
FT                   /product="Pc22g02730 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP97561.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniParc:UPI0001832195"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPT1"
FT                   /transl_table=1
FT                   /translation="MSQRKSTFLSREVLTSQEAKWKRLVKTNYIDPNGVKRDWESAERQ
FT                   TRPTDSPVDGVNIVAFLNKTNGSEILLEKQYRPPIDQVVIELPAGLIDAGETIEQTAVR
FT                   ELKEETGYIGVADKTTGIMYNDPGFCNANFNMVYVQVDMSLSENQNPKPCLEDNEFIEC
FT                   FTLPVLELSAELQRLESEGYAIDARVGSIAEGIEIAKRLKI"
FT   CDS_pept        join(629305..630991,631048..632357)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192370" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823057"
FT                   /orf_name="Pc22g02740"
FT                   /product="Pc22g02740 protein"
FT                   /protein_id="CAP97562.1"
FT                   /db_xref="UniParc:UPI0001832196"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPT2"
FT                   /transl_table=1
FT                   /translation="MTRSAASRKNQSNRQENGLVGPGKKVTKQKSSGHLNGNSGNGSAT
FT                   GPGASTHFDLSSVRSTSDTAVTPPTVSGKGGDSTKADGNVRGMLNGHSKGGEMASAQEN
FT                   GDVTQNGGIAGHVSRSGNSKRSGSNASINPLQLASTILKSCPMYDTIAILIFLLQLPPM
FT                   VLTLVQFLFASLTFMPPSGAAAGSLSSNFDIFQGPAGTPSLGTMIAMDGFCILLWGLFM
FT                   WTWAQNFAIDLAHVQVAITLGGGGSGKNGGVNALCVGIVLLLHLVRSKGIQDFVLGHLV
FT                   SAKVLSPDLLSQYSHLLPAEFRRSEAQTSPSWLRSLLAVHILAQAATAMARRAMAKNRS
FT                   PTPLRAGKRGDTEASAGSQGQADSALESAASVSSSFVGPDGQLKDGKDRFTSAKKRRRQ
FT                   ANQVRSRQPFWAALASTKVTVMREYEHSRAISKTARNLTMTEEDLQGVSLDDGLIWITD
FT                   VDSSSIKFAAGDFTDDPAVSGSFEAGRLGGDMEPFYVCVNGALWATASICRVSDAKGPS
FT                   VVQWRGEIAGLAPNCAYTCAFVRSDTDEEICVMSVKTPTTADTEQVISAVSTPPQPTYR
FT                   PSSPTTTLKNSIGNAESKLNEKRNRLKKTKNDHKAVISKIRKELENFNTRLHSGNDENR
FT                   QKQRSLQLERNIRQTEEATAVLEIQLDTMENVPEEEMEEWSAHKADFEREVELFNSTKE
FT                   EVAAARTAAAQQVAALELELSQAIQKRERLQGRRTRVNEQYERIISANAQGLNERERRA
FT                   AEQFAREQDQSKMESNFHEQFGSISQSVQDFQLRTSQLWQQASAIEQSIQQQQQQMLLE
FT                   SGPLTPEGNLPGTNPLPETSGPSFNASTTSAPSARSLLGGLSFPARSSPLQISSSPVHE
FT                   MPSNPTSPSQDLPFLPQFPTSPIGNASSYFASDINNRDRSFSNRSTRSSQYGSDFLDTN
FT                   RLPPLQLDLSELLGETKPRPGSDGNGFLHHGGRRVLSPFQRAVSRGSGTGSGSGGSGSG
FT                   TGSPHSSRD"
FT   CDS_pept        join(complement(633869..633920),complement(632953..633812))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192381" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127363"
FT                   /orf_name="Pc22g02750"
FT                   /product="Pc22g02750 protein"
FT                   /function="FMN binding"
FT                   /protein_id="CAP97563.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI0001832197"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPT3"
FT                   /transl_table=1
FT                   /translation="MKLAFPVAHGTARTGLGELPCIKNYSLPFLGTSLSLRTSPHVPYT
FT                   QHRSRYDQRRYTSNATASLKENDCAGKANASSRAGNVPQPSTPSTSISDQVRLLMRRVP
FT                   YPVAIITATDPSGPENTTSFRGMTVSSFSTVTLTPDPVISFNVRRPSETLNALLASRRF
FT                   LVHLLAPGPATATLARDFSKGNVTLAAMLRGHGEFEFAALPTKNEEGQPQRPLPILKRR
FT                   PEAVAANDGVDFPFVFECTLHPQKIDVQDHSIVLGTVVRAIEGSESVSAQGQDDKVLDE
FT                   HSPERLCLTYANTKFWKMGGEL"
FT   CDS_pept        634255..634812
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192392" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942478"
FT                   /orf_name="Pc22g02760"
FT                   /product="Pc22g02760 protein"
FT                   /protein_id="CAP97564.1"
FT                   /db_xref="UniParc:UPI0001832198"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPT4"
FT                   /transl_table=1
FT                   /translation="MSMHTSLRRTAATITNSTTTILPTRLPTQSSSTTFICSQCRHATL
FT                   LRRPKRPYTFTQLITLSDGSTFTHRTTSPAPIYRSTRDTRNSLLWNPSSSKLMNVEEDE
FT                   AGRLAAFRARFGRSYDASAPVADEETAKDPAAAKKAEADAKAQAKEDQEEEDNLLDLIS
FT                   AFGQNEAPPPPEKKPFKPSGKK"
FT   CDS_pept        join(complement(637334..637367),complement(637220..637279),
FT                   complement(636670..637154),complement(636215..636595),
FT                   complement(635561..636163),complement(635347..635505))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192403" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976275"
FT                   /orf_name="Pc22g02770"
FT                   /product="Pc22g02770 protein"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAP97565.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="UniParc:UPI0001832199"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPT5"
FT                   /transl_table=1
FT                   /translation="MDLDSGDSPWGDEPSQFKPSDDSSKPSTQGGAAQTPASDSSPAVR
FT                   VPGRRGPRGTRKISAQATKLESVDDSVDPLGPLGEAPAEATPTPTDEAPAPPQKEPFAG
FT                   RGARPFSSASQASSGVGAADSANVEEESAIFRGPPPVQPPAQPDGPKRQTQPSMSVEQA
FT                   AKPTFQIYVGDPHKVGDLTSSHIVYQVSTKTTSKAYRQPEFTVSRRYRDFLWLYNSLHG
FT                   SNPGVVVAPPPEKQAVGRFDTNFVESRRAALERMLNKIASHPILQHDGDLKIFLESEAF
FT                   NVDVKNKENREPDIGPSKGMLSSFGISVGGGTKFVEHDDWFHDRKIYLDALENQLKALL
FT                   KSMDTVVLQRKGLAEAAGDFSSSLHALSAVELSPALSNPLEGLSELQLRIRELYDRQAQ
FT                   QDVLTLGITIDEYIRLIGSVKMAFTQRQKAFHTWHAAESDLQKRKNNQDKLLRQGKTQQ
FT                   DRLNQISADVADAERKVHQTRLLFEDMGRLMRNELQRFEKEKVEDFKSGVETFLESAVE
FT                   AQKELIELWETFLLRLDAGEEGLPYYVPPEASDAAAPAEPTASASESGPLAAEDDA"
FT   CDS_pept        join(complement(638535..638678),complement(638000..638475),
FT                   complement(637823..637934))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192424" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670304"
FT                   /gene_name="mde1"
FT                   /orf_name="Pc22g02780"
FT                   /product="Methylthioribulose-1-phosphate dehydratase "
FT                   /EC_number="4.2.1.109"
FT                   /function="metal ion binding"
FT                   /function="methylthioribulose 1-phosphate dehydratase
FT                   activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP97566.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0046570"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR017714"
FT                   /db_xref="UniParc:UPI000183219A"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HNY8"
FT                   /transl_table=1
FT                   /translation="MCPADQTVATNNNDHLVQSEDPEHPANLIPELCRKFYNWGWVTGT
FT                   GGGTSIRQGDHIFIAPSGVQKELMQPHNIFVLQWPTPKYPASERNYIRKPLKLNPSACT
FT                   PLFLTAFEQGAGCCIHTHSQWAVLVTLLVEREKGPDACFEISNIEQIKGIPRGKGKGML
FT                   GFFDTLKIPIIENTAFEEDLTSGLEAAMNKYPDAYAVLVRRHGIYVWGDNTAKAKTQCE
FT                   SLDYIFQLAVEMHKLGLPWVK"
FT   CDS_pept        join(640762..640891,641029..641105,641151..641579)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076532" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670305"
FT                   /orf_name="Pc22g02790"
FT                   /product="Putative uncharacterized protein Pc22g02790 "
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP97567.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000183219B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HNY9"
FT                   /transl_table=1
FT                   /translation="MNPRPLVASAQCFRKMYDMIDESTIALEWLDTTLAELKYCPDMHY
FT                   KPVNILLSGIQTNAKVADLGLGEQLSRSAKLLQPYAMRAPEVFLGKACTELSQVWAVAA
FT                   MLLCWIKPGVLGAWDSPLLLLNNAWSMAKIQRLFAYWEISTSETDVLKATVESARCLSE
FT                   VLELQSILHLDEETKKVEMPQQLRDLLRFILVPDPKLRPSGFICACIE"
FT   CDS_pept        join(642400..642516,642569..642848,642912..644191)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192435" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976276"
FT                   /orf_name="Pc22g02800"
FT                   /product="Pc22g02800 protein"
FT                   /function="calcium ion binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="CAP97568.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001580"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR009033"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018124"
FT                   /db_xref="UniParc:UPI000183219C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HNY5"
FT                   /transl_table=1
FT                   /translation="MRFNTALTSALVSSASLMGYAHAEEETADTTVIDRPTFTPTSLKA
FT                   PFLEQFTDDWESRWKPSHAKKDDKSDDEWAYVGEWAVEEPSVFKGIDGDKGLVVKNAAA
FT                   HHAISAKFPKKIDNKGKTLVVQYEVKPQNSLVCGGAYLKLLQENKKLHQDEFSNGTPYV
FT                   VMFGPDKCGATNKVHFIFRHKNPKTGEYEEKHLKTPPVARTNKVTSLYTLIVNPDQTFE
FT                   ILINGDSAKKGSLLEDFNPPVNPEKEIDDPKDSKPADWVDEVKIPDPEATKPADWDEEA
FT                   PFEILDEEATQPADWLEDEPESIPDPEAEKPEDWDDEEDGDWLAPTIPNPKCADVSGCG
FT                   TWTRPMIKNPEYKGKWEAPLIDNPAYKGVWAPRKIKNPAYFEDKTPSNLEPMGAIGFEI
FT                   WTMQNDILFDNVYVGHSVEDAEKLRKETFDVKFPIEEAEEEASKPKPEVNEEGTTVTFQ
FT                   EDPVTFVRQKVNHFVELAKEDPVNAAKTLPEVAGGLGALLLTMILVVVGAIGASSPAAP
FT                   AEKKGKQPAGAPKEKKEQAVSSSAETSKGGATKRTTRSSAE"
FT   sig_peptide     642400..642468
FT                   /db_xref="UniProtKB/TrEMBL:B6HNY5 "
FT   mat_peptide     join(642469..642516,642569..642848,642912..644188)
FT                   /db_xref="UniProtKB/TrEMBL:B6HNY5 "
FT   CDS_pept        join(644846..645560,645614..646251,646314..646730)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271507" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670306"
FT                   /orf_name="Pc22g02810"
FT                   /product="Pc22g02810 protein"
FT                   /function="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating) activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="valine metabolic process"
FT                   /protein_id="CAP97569.1"
FT                   /db_xref="GO:0004491"
FT                   /db_xref="GO:0006573"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000183219D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HNY6"
FT                   /transl_table=1
FT                   /translation="MAACRSVARSIPSLRAVPRTVSVTARAASSTRSLATTSLSSLASR
FT                   RAILPSSSLSATRRLHATAQRLVHATTSAVSTATEYPTSHQKIANPIDTANFIDNEFVA
FT                   SKASTWIDLHDPATNNLVTRVPQSTDAELKAAVESAEKAFPAWRATSIMARQQIIFKFT
FT                   NLIRTHWDRLAASITLEQGKTFADAKGDVLRGLQVAETACGITTQMTGEVLEVAKDMET
FT                   RSYREPLGVVAAICPFNFPAMIPLWCIPVATVTGNCLVMKPSERDPGAAMILAELAKEA
FT                   GFPPGVINIIHGTAPTVDFILDEPAIKAISFVGSNRAGEYIYSRGSANGKRVQANLGAK
FT                   NHAAVLPDANKNQCLNAIVGAAFGAAGQRCMALSTTVMVGETKEWLPEIAERAKALNVN
FT                   GGFEEGADLGPVISPESKKRIEDLITSAEEEGATILLDGRGFKPEGYPNGNFVGPTIIT
FT                   NVTPDMKCYKEEIFGPVLVCLNVETLDDAIDVINANEYGNGAAIFTRSGSTASKFQKEC
FT                   EAGQLGINVPIPVPLPMFSFTGNKKSIAGGGANTFYGKPGLQFYTQQKTVTSLWKSEDA
FT                   VSTKAHVVMPTHS"
FT   CDS_pept        join(complement(648034..648087),complement(647927..647968),
FT                   complement(647155..647721))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192437" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823058"
FT                   /orf_name="Pc22g02820"
FT                   /product="Pc22g02820 protein"
FT                   /protein_id="CAP97570.1"
FT                   /db_xref="UniParc:UPI000183219E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HNY7"
FT                   /transl_table=1
FT                   /translation="MAAPADVTIQDLSGKWEMDSTHSNPTDPILTLQGMGWVMRKALSY
FT                   ATVTIYVKQYADSENPALIHIDAQQVITGGIQGTKEERKLDWEVREHVDHIFGKLQGRS
FT                   RHIAGAKSEDGAVRPVIEIQTKVGSPEEDAKVQKFLTGETLIDGSKSEGFLAEEGEAVF
FT                   LQSFVKNTESGWTAEQVWGFETVEGERRHTRRVVVTKDGKVASARLVYAFKDRKTDE"
FT   CDS_pept        join(648410..648448,648511..648570,648632..649954)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192448" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942479"
FT                   /orf_name="Pc22g02830"
FT                   /product="Pc22g02830 protein"
FT                   /biological_process="microtubule-based process "
FT                   /cellular_component="dynactin complex"
FT                   /protein_id="CAP97571.1"
FT                   /db_xref="GO:0005869"
FT                   /db_xref="GO:0007017"
FT                   /db_xref="InterPro:IPR006996"
FT                   /db_xref="UniParc:UPI0001832266"
FT                   /db_xref="UniProtKB/TrEMBL:B6HNZ0"
FT                   /transl_table=1
FT                   /translation="MSFNKKYAGLPDLDPSPDIYETPDLTDEASTLPTATIRTDSDHDD
FT                   AGSNSDIDREGVNPDQARMHFMGAAVDARDVNFSDSISMKRQAYRSKSMSRRRRRRRED
FT                   GVEEVGDLSDSEDESLERRLARLRREVEDLKVEMANKTDAEAGGAAAPEKPGENLGDGV
FT                   AELSRALDNLHASRGAANSPHSAAALLSQKLGPETRSTTDAKTQSSADASKAVSTVPAP
FT                   NTSSAGVLSHAAAFDSRLALLESSIGISSSSNPFIADGINESTSHPVLPALDQLASRLS
FT                   ALTGLLVGTSPASTAPGVSNAAPGMTTPHMEALSTRVRKLTTDAEALTAARRKAFEAAK
FT                   AVHNARLASSDTDVVPALEASTDDDHAAKIQALYSTLPTIQSLHPLLPSVLERLRSLRA
FT                   CHAGAAHAADSLNELEKRHAEMASEIEQWREGLTTVEEKMQQGEAALRSNVETVEPWVR
FT                   DLESRLARLEGPAAL"
FT   CDS_pept        join(complement(652034..652043),complement(651622..651903),
FT                   complement(650161..651566))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942480"
FT                   /orf_name="Pc22g02840"
FT                   /product="Pc22g02840 protein"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="CAP97572.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniParc:UPI0001832267"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPS8"
FT                   /transl_table=1
FT                   /translation="MLKAFAFLALLFPALILLHLLVAPYTKVEESFHVQAVHDVLANGL
FT                   PNGFNDLNLNRANYDHFSFPGAVPRSAIGAVALAMLSKPVIWLNEEINRQLLARAILGL
FT                   LNASSLAIYARGLRRSFGQPAAIWYILLQASQFHLIFYASRPLSNMFAFSMTTLAMCLL
FT                   LPSRIPTSQDQKQYSLALALLTTAGVIFRSELAILVGTQTLFLLATRRINLQHTVIAGL
FT                   IGLTTGLALTIYLDSTFWQRFPLWPEFEAFRFNVLAGQSSEWGTEPWTFYFLNAFPRLL
FT                   FNPLSYLLAIPIALRHPATRSPALALLIPSLSFVAIYSFQPHKEWRFIVYIIPSLTAVA
FT                   ALGAAYLWTHRSRSVFARLATHALATSTLAAFCLSNFVLLPASAANYPGGQALDAMHYQ
FT                   HSILNLHDKTNAPVNVYLGNLACQTGVTRFLQQPASSGWVYDKTEDKTVKSTSGFWDRF
FT                   DYVVVEADDEAGFMDADETSLRRALPASEWERVLVVDSFAGISVLKPGTPATGTAERRV
FT                   IRTIAGARAVELFDGLREYVRNSLARGWWVEVKMRPRVQVLRRVNRKG"
FT   mat_peptide     join(complement(651622..651844),complement(650164..651566))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPS8 "
FT   sig_peptide     join(complement(652034..652043),complement(651845..651903))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPS8 "
FT   CDS_pept        join(complement(652708..652946),complement(652196..652433))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942481"
FT                   /orf_name="Pc22g02850"
FT                   /product="Putative uncharacterized protein Pc22g02850 "
FT                   /protein_id="CAP97573.1"
FT                   /db_xref="UniParc:UPI0001832268"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPR2"
FT                   /transl_table=1
FT                   /translation="MGYSLHATVPVTPSNDFTSENMKCMPGRGVPVLLHITQFHLSVPE
FT                   YAPCSCESCRVSGLGVINDIEVLDYEWLVGREVTASKMPDCPGLYWVAGVGKRTSHHGP
FT                   HTGDQVDGLRFHACAIVCRAEARLGLCATPSDCIFQYSLGSHLRGVAGEGHTAS"
FT   CDS_pept        join(complement(656237..656272),complement(655976..656113),
FT                   complement(653772..655898))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192482" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670307"
FT                   /orf_name="Pc22g02860"
FT                   /product="Pc22g02860 protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAP97574.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI0001832269"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPR3"
FT                   /transl_table=1
FT                   /translation="MKALFSKGSKNGASNPPATAPPVKKDLQVPQISPLEKRLQDMGSI
FT                   RADGSDKFYGMENYGNTCYCNSILQCLYYSVPFREAVINYPQRTPMDSLEAALAKNLRY
FT                   QNPNAHLEAEALAAKQKASSPPSARQAGVPPNPNQKPEDKDSPEYKKKVALQTLPILET
FT                   KNNASSYGMSESLFTSLKDIFESVVGSQARIGIVRPQQFLDVLRRENEMFRTAMHQDAH
FT                   EFLNLLLNEVVANVETEATKQAFTEKALPPTESADSLGTLTPSTGSKSPNTTRWVHELF
FT                   EGTLTSETKCLTCEKVSQRDEVFLDLSVDLEQHSSVTSCLRKFSAEEMLCERNKFHCDN
FT                   CGGLQEAEKRMKIKRLPRVLALHLKRFKYTEDLQRLQKLFHRVVYPYHLRLFNTTDDAE
FT                   DPDRLYELYAVVVHIGGGPYHGHYVAIIKTEDRGWLLFDDELVEPVDKSYVRNFFGDRP
FT                   GLACAYVLFYQETTLEAVMREQAQENQAPTTAAAETGDAGKPNGSPFSPPLAHAQSASQ
FT                   APPDNTTSSIPLSRIPTAPQLSTYPEEPLEPNPASPRTVQPPLPPIPDEPAPPLSPKKS
FT                   DHQLRKERRAMEKEKDKNEKNRLKEQDLHNREMQRREADELKRAIEASRADTVDFAAEN
FT                   GSPRKSSSFGFLKRGSRSLSHRLTKDKEPRVSTSDLSSSPLLPEVVPEGPLKDAEPAQP
FT                   VNKPVQPIKPTSPVQPVQSPVSSPRNFPPISNPKQPTQPIRNPEPLAKDQHTNNTKPGH
FT                   TPRWRSFSFKKVA"
FT   CDS_pept        join(complement(658247..658586),complement(658046..658087),
FT                   complement(657886..657942),complement(657284..657450))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942482"
FT                   /orf_name="Pc22g02870"
FT                   /product="Pc22g02870 protein"
FT                   /protein_id="CAP97575.1"
FT                   /db_xref="UniParc:UPI000183226A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPR4"
FT                   /transl_table=1
FT                   /translation="MGGGKVSSAAGMICLVGDGGGRDIIFIRDDSTVLQGRAMSQARNW
FT                   SQTKWNGDCSLYRAQGDRNGRHIKKERRCETELFGSMGISWPPEASAGTGILSVWGCFS
FT                   DIVYPDNPSGMHKKPDKSNSVGIGPRLKGNALSSLGLWPSPGDVEARLPRLAPMGGNVR
FT                   KWYYRMEWLNWYCGACWTPQGVETLNLIWADVGHHQIP"
FT   mat_peptide     join(complement(658247..658523),complement(658046..658087),
FT                   complement(657886..657942),complement(657287..657450))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPR4 "
FT   sig_peptide     complement(658524..658586)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPR4 "
FT   CDS_pept        join(658608..659885,659958..660233)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000018075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127364"
FT                   /orf_name="Pc22g02880"
FT                   /product="Pc22g02880 protein"
FT                   /function="ATP binding"
FT                   /function="histidine-tRNA ligase activity"
FT                   /biological_process="histidyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP97576.1"
FT                   /db_xref="GO:0004821"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006427"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="UniParc:UPI000183226B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPR5"
FT                   /transl_table=1
FT                   /translation="MGKDKGPTFNLKTPKGTKDWSGSDALLRDRIFTTIANVFKRHGGT
FT                   ALDTPVFELREILAGKYGEDSKLIYDLKDQGGEICSLRYDLTVPFARWLAMNPDVRSIK
FT                   RYHIAKVYRRDQPAINKGRMREFYQCDFDIAGTFDAMVPDAEILRIVSEVFEELGWTGR
FT                   YTIKLNHRKILDGVFAVCGVPDKMLRPISSAVDKLDKMPWADVRKEMVDDKGLDPEVAD
FT                   RIEQYVMNKGSRELLDSLLKDETLNANAFAKAGLEEMALMMDYLEAFGVLDKVSFDMSL
FT                   ARGLDYYTGVIYEVVTEGSAGVQADSPEAQKAEKSNKGKSKQPLEEEDRSNDPTLGVGS
FT                   VAAGGRYDNLVGMFQPKAQIPCVGISFGVDRIFSITKARLEREQKSDALRNSEVDAYVM
FT                   AFGGKGFNGMLKERMEICQKLWSAGIKAEFSYKLKPKLPQQFKAAEQGAIPFGIILGEE
FT                   ELAAGKCRIKEMGLPEGHPEKEGVEVEIASLVPELQTRLAKKQQGAISSLAQQLQGTSV
FT                   "
FT   CDS_pept        join(complement(662079..662247),complement(660661..662018))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000255772" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942483"
FT                   /orf_name="Pc22g02890"
FT                   /product="Pc22g02890 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular
FT                   oxygen, NADH or NADPH as one donor, and incorporation of
FT                   one atom of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /protein_id="CAP97577.1"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0016709"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="UniParc:UPI000183226C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPR6"
FT                   /transl_table=1
FT                   /translation="MRPISRAVLRPYVCPTCRHGISAGRRRFGSKSDSPDLYDVVCVGG
FT                   GPAGLGLLAALRASPITSKLKVALIESQDLRKAKAWDLEPNQFSNRVSSLTPSTVSFLR
FT                   SIGAYDHLDVNRVQDYQDMQVWDGQTGSRISFDWSMETSPFEDMRTVATMTENANLVRA
FT                   LLRRIADLGDENLSLFSNATVASIENGSDLKPEGPDLSAWPVLTVKPTGPAAETETPKR
FT                   IAARLLVGADGINSPVRSFADIPTQGWDYGRHGVVATLALDEPATPPFPASKRTAYQRF
FT                   LPALGGPIALLPLPDNHATLVWSTTPENAAYLKSLPTPAFLAMVNAAFRLDMTDLTYMM
FT                   GMQSSSSDSTSHQDELTWRAQHTPLPSQIPPAATAVQAGTVASFPLRFRHAAQYISPRI
FT                   ALVGDAAHVIHPLAGQGLNLGLADVASLSKTIQYAVSHGMDIGDLLTLERYSSERYLPN
FT                   AKIGGACDLLHKMYNVPGEGPVALARSLGLGVVDRLPFVKSFLMKNAEGY"
FT   CDS_pept        join(complement(663894..664187),complement(662597..663787))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192515" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823059"
FT                   /orf_name="Pc22g02900"
FT                   /product="Pc22g02900 protein"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAP97578.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="UniParc:UPI000159300F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPR7"
FT                   /transl_table=1
FT                   /translation="MDQHDDFDSVSWKHDPDSDVSRPTTASTDAAEPSETRRDSNGKRR
FT                   MSSAQEEPQAGPLADAVDLAGIGDGVLECRVDSPLKENDGTKDAYISYLVTTHTDFKSF
FT                   QKPDFTVRRRFTDFYFLYKTLYREYPACAVPPLPDKHKMEYVRGDRFGPEFTTRRAWSL
FT                   HRFLKRLTLHPVLRRAPLLTIFLESPDWNAHMRLHSTRVSTNTGSDSAATGIFDNFTDS
FT                   FVNAFSKVHKPDRRFIEVREKADKLDEDLSHVEKTVARVARRESDLETDYAELATQFRK
FT                   LVPLEPAIEMPLQVFAASVEETARGMRGLKDHTDQNYLGSLRDAESYIMSLKSLLKTRE
FT                   QKQLDFEALVDYRNKAVTERDSLAANPAAYYASNPLTSSPASFIRSKMEDMRGVDHEQS
FT                   RRERVRKLELRIDELTREVESAKTTSEMFDEEVIREVADFERIKAVEFRDGLGSFADSH
FT                   IEFYQGVLSTWERFVAEMEGEAEPGHDSDAAAIGAI"
FT   CDS_pept        join(complement(665508..667255),complement(664691..665453))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192536" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127365"
FT                   /orf_name="Pc22g02910"
FT                   /product="Pc22g02910 protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP97579.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI000183226D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPR8"
FT                   /transl_table=1
FT                   /translation="MRIASGIIATLGLAGAVSASLHPRSQETRDFFALHLDDTISPSHI
FT                   AQVLGARHEGQIGQLDGHHTFSLPREQTAQFDTLLNDLRTRRKLRRRSEGIDSRGTSDD
FT                   PLDKILWSHKIAPARQRLQKRLPPVSVPYRSLDKRDNRQAVAFQTNAMSTLGITDPIFR
FT                   EQWHLLNTLQPGHDLNVTGLWLEGITGKGVVTAVVDDGLDMDSNDLKPNYLPEGSYDFN
FT                   ENVPEPRPLLLDDKHGTRCCGEIAAAKNDVCGVGVAYDSKIAGIRILSKPIDDVDEAAA
FT                   INFAYQTNDIYSCSWGPIDDGATMDAPGILIKRAMANGVQKGRGGKGSVFVFAAGNGAA
FT                   YGDNCNFDGYTNSIYSITVGAIDREGNHPSYSESCSAQLVVAYSSGSGDYIHTTDVGAN
FT                   KCFSGHGGTSAAGPLAAGSAALALSARPDLTWRDLQHLMVETAVPVSEDDGSWQVLPSG
FT                   RKFSHDWGFGKVDTYTMVQLAKTWELVKPQAWLHSPWLRVHQDIPQGDRGLLSRYTVTA
FT                   DQLKEANIAKLEHVTVTMNVNHTRRGDLSVELRSPAGIVSYLSVARRKDDMPVGYDDWT
FT                   FMSVAHWGESPVGDWSIIVKDADVNEYSGTFIDWRLNLWGEAVDGTKQKLHPLPDEHDH
FT                   DHPYEDAPVATTSISAAPTKTEAPPNPGENHDRPVNAKPKPTEAKPTPVEDVKIPTNTT
FT                   ASETETPSPSAAGSDYISSWLPTFGASKRTQIWIYASLVMIITFFIGLGVYFQLQRIKR
FT                   RRTTAHDDYEFEMIEDEDEMQPMTGASGRTQRRGGELYNAFAGESDEEMFSDNDEPYRD
FT                   GLANIQEKDGEDGTSHDGPHHEKP"
FT   mat_peptide     join(complement(665508..667198),complement(664694..665453))
FT                   /db_xref="UniProtKB/TrEMBL:B6HPR8 "
FT   sig_peptide     complement(667199..667255)
FT                   /db_xref="UniProtKB/TrEMBL:B6HPR8 "
FT   CDS_pept        join(667257..667316,667509..667555,667637..667811,
FT                   668557..668712)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942484"
FT                   /orf_name="Pc22g02920"
FT                   /product="Putative uncharacterized protein Pc22g02920 "
FT                   /protein_id="CAP97580.1"
FT                   /db_xref="UniParc:UPI000183226E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPR9"
FT                   /transl_table=1
FT                   /translation="MRDQLISVEERNQGRVVRFEDRQRPPTRVPIESPKRPRFLLHSPY
FT                   YITCLDQMPRWLLFSLRRYGLGPGGEADVDMPTVRIEDTTAYIVFRTDIANFPVTAAWT
FT                   YTPAQLGLLPTNQLGPWCGDPALGIRSSRIELVSTISRNIK"
FT   CDS_pept        join(668856..670161,670240..671516,671570..671695,
FT                   671753..671955,672015..673155)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192537" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127366"
FT                   /orf_name="Pc22g02930"
FT                   /product="Pc22g02930 protein"
FT                   /protein_id="CAP97581.1"
FT                   /db_xref="UniParc:UPI000183226F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPS0"
FT                   /transl_table=1
FT                   /translation="MAAMAMRGSPDMANGSSNPHIANGAQRAPGRRNRKKAPSMESHEH
FT                   EAEYDETKTAHTNARDTNSSGQIDRSFSARARNQPEGNLNYTTRKPIPPSTSELPEEST
FT                   TPRALPTEPHSQEPGAAMPEIHVQSPPPVSPPTRSNTTRSVSASDSRRDWASERSPLQK
FT                   LEVTLTGISKEEKRARVQQAEIKARERLARKKAEQEKAELVAEVAREAPTQRAQPESRP
FT                   APGTARRNERRDIPIGDGMRNGHAAAPPQQRQSEGTAVRHNRTVSTNPQYPSIRRPEDP
FT                   QYTRAEATIPSSAKIGKVPRRSVTVSGPAAKPAPANNISHSRSMSQAGPRPMQAPAGLR
FT                   AETTDELLTAPPQGSAESQVKPKKQSVSFNVPPPTPPPIFEWRNAQPARLAAPDFDFQN
FT                   IDMDRSKAWWEGGGSKDRRKSRALPKNYKSPAQKLTGMTEHKNFQPHLFLRCGPLLRYT
FT                   GIKRVKVDGASGPIEKDIWRGSIMIVTKDSRSSYETPPTLRLFSQPMDLLPPPPVVISH
FT                   EDGMQLAPEYVDPTAGLMKIGRDGRPLYVKPVEHVEEQVDLSFVENDDGIYELSPSMID
FT                   YTSEGAKQPMPSNRMHASDGETASLHRDIPGARLYADAARDVTFWRFNLEVELSTTQQR
FT                   IAYRINQGPALGFWVPPVGESMNIIFHSGNGFSPSADSDRVCGPDPLWRDILNEHQTRP
FT                   FHVMIGGGDQIFNDSVITESTFFQEWIKIKNVAERYGASFTPEFRAELEQFYLERYAAW
FT                   FSQGLFSLANSQIPMVNMWNDHEIFEGFGSYHDDFMQTSVISGIGKIAFKYYLLFQHHS
FT                   VPDETETDEPSWLLGAHPGPYIEQKSRNLFMSLGQGVSLLALDCRTERRSNEVLSEETC
FT                   DLLWDRCHREIMKGETKHLVVLTSVPVAYPRVAMLRNFMNSRKSLGKAGVLGGLVNRSG
FT                   GNVEVFDDHWAGKHLKSERTWLVEDLQDLAAEKSVRITILSGDVHLAAIGQFYSNPKLN
FT                   IAKDHDYRYMPNVISSAIADIPETDLIADTLNKRNTVHHMDSNTDEDVVPIFVQDVNGK
FT                   ARNNKRLLPRRNWCSIREYKPGSTPPDTPESEIIETPPPRPNKLQRTLSLGRGDKGSAE
FT                   KPGILRRLSTRGPPPTRTMSFNRGDEAAFNRRASVDVPAQPHENGDSYFPGPGGPAPAR
FT                   PGSFHRRPTNLSQKAVKKAAKQGDDGAGAYINLEGGLAITLNLEISPQDPSGVTTPYKL
FT                   LVPALHYDGTEYDPPPTQIVKGWRKFLPRRKKNNGEADAQREAEEDYSDDDDQDDYEDH
FT                   DLINNTRANAATSQQHQPQYEGYPGSEEDGDSEGEVPQRLPPHMMAEHSRSPEEHSRPR
FT                   KKWFGVI"
FT   CDS_pept        join(673884..673905,673989..674888,674954..675036)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000072912" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942485"
FT                   /gene_name="TrxB"
FT                   /orf_name="Pc22g02940"
FT                   /product="Thioredoxin reductase TrxB-Penicillium
FT                   chrysogenum"
FT                   /EC_number="1.8.1.9"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="thioredoxin-disulfide reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="removal of superoxide radicals "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP97582.1"
FT                   /db_xref="GO:0004791"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019430"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000014825B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPS1"
FT                   /transl_table=1
FT                   /translation="MVHSKVVIIGSGPGAHTAAIYLSRAELQPVLYEGMLANGTAAGGQ
FT                   LTTTTDVENFPGFPSGIGGAELMDNMRAQSERFGTEIITETISKLDLSSRPFKMWTEWN
FT                   DDEGSEPVRTADAVIIATGANARRLNLPGEETYWQNGISACAVCDGAVPIFRNKPLYVI
FT                   GGGDSAAEEAMFLAKYGSSVTVLVRKDKLRASNIMADRLLAHPKCKVRFNTVATEVIGE
FT                   NKPNGLMTHLRVKDVLSNAEEVVEANGLFYAVGHDPASGLVKGQVELDDEGYIITKPGT
FT                   SFTNVEGVFACGDVQDKRYRQAITSAGSGCVAALEAEKFIAETETHQEAKPVL"
FT   CDS_pept        complement(675584..678850)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192548" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942486"
FT                   /orf_name="Pc22g02950"
FT                   /product="Pc22g02950 protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97583.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001832334"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPS2"
FT                   /transl_table=1
FT                   /translation="MYGAASLKFQGGIPPSQDSYMNQYVPNPEITVQSQEHLLSGPTEL
FT                   PEPPAKRLRITHKAYEAASASIALGNLEHNNSKLQTFKSDGPHIVGSMDRLYAGGSSST
FT                   PNESTTSTDLTSPFELKASTSPPPNPLQTFSARSVIFGPNVLESGKVDLSKCRPRSSIP
FT                   SKIHPSVYGEQCVRAAYASRLNPYALHRQEQEFLQDHLCHVHVTIYLNIRNGILLLWGR
FT                   NPMVAVTREEALGCAKDYRWMNLASFAYDWLARNGYINHGCVEAPLAPVKPKRGRRKEG
FT                   PTIVVVGAGMAGLGCARQLEHLFRQYRGSDALPRVIILEGRRRVGGRIYSHPLHSLKSE
FT                   NLPDGLVPKAEMGAQIIVGFDHGNPLDQIVRGQLALHYHKIRDVSTIYDIDGSPVNEVQ
FT                   DAMAEKLYNDLLDRTGFYRHKAKIAPTAQGNREMIDAGRESAVDDGLTVRQYEEARAAG
FT                   TIDLLVPTKRVRRGIKHKTAENEPSVDVASDLAGNSEDDPAALTCQKTGWKLNPGYTVN
FT                   DTIELDQIAEASQAQTLGAVMDEGVKQYQNMLPVTTKDMRLMNWHFANLEYANATNVNK
FT                   LSLSGWDQDIGNEFEGEHSQVIGGYQQLPYGLYMLPEKLDVRTGKIVTEISYDATGSNM
FT                   NQKAVVQCEDGEKFLADHVVFTGSLGVLKQQKIKFEPPLPDWKRGAIDRLGFGIMNKVV
FT                   LVFQEPFWDTKRDMFGLLREPNNSASMVQEDYAANRGRFYLFWNVMKTTGLPCLIALMA
FT                   GDAAHQAESTSDEEIITEVTGQLRNVFKHTTIPDPLETIITRWGQDPFTYGSYSYVAAK
FT                   AFPDDYDLMARSIGNLHFAGEATCGTHPATVHGAYLSGLRAASEIIEPISGPIVMPHPL
FT                   VPEKSKVTRSKSSTPNGQTTKKSRTRGSSSLSSSPTTTQSKPPSTSTSRKPTSTEKSRR
FT                   DAYDQALWTTIYAELGSAPPRPAKSGLNPFLFYQKDYWARCRDQCDEARRAASNNPNAK
FT                   APRDEIRAALGQMWRSATAADKQPYIEQTEINRRANAEAWDKWKVDIAEWERKTFVVKD
FT                   RWCAENPFDEWVMPEYVDEHASVPVLATAFTTVPALKSEK"
FT   CDS_pept        join(complement(680407..680870),complement(679907..680326),
FT                   complement(679487..679832))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076754" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823060"
FT                   /orf_name="Pc22g02960"
FT                   /product="Pc22g02960 protein"
FT                   /protein_id="CAP97584.1"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniParc:UPI0001832335"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPS3"
FT                   /transl_table=1
FT                   /translation="MPADYQSTARALSLSPSSPDPISSSPGSDAQPPWSRAGRRNPGRS
FT                   SAQATSYRDQIIQRGTELYVRMNNIWEEMTLWKKVGTVFAALFVGASGIAFMVLTGKLF
FT                   IWLGPVAEKWETSWLAAFILWLCVFFVSFPPLVGWSTFGTVAGFIFGVWKGWLIYASAT
FT                   IIGSTVSFYVSRTILSGFVKRLMEHDKRFAALALTLKYDGLKLLCMIRLCPLPYSICNG
FT                   AVSTFPTVQPLMYGLATAIISPKLLVPAFIGSRIRLLSEKGEEMSAGSKFVNICSIIFT
FT                   VGIGIFTGWYIYQRTLARAKELEAQERADIRGSLQADHAAHRPHRGFSEDPDVNKASLT
FT                   LARDEEERIGFTDLDDDNVDLVLGDDSDSDQPGPWKNSRRSYHDEFTDNDSDGFAGEEE
FT                   AYGLHTHVQK"
FT   CDS_pept        join(681831..682759,682820..683545,683599..684163)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192559" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976277"
FT                   /orf_name="Pc22g02970"
FT                   /product="Pc22g02970 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP97585.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR013899"
FT                   /db_xref="UniParc:UPI0001832336"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPS4"
FT                   /transl_table=1
FT                   /translation="MVSDELLEQCLQILQDQALDEEEQVEKVEDFLRANTSLTGTPLEN
FT                   AVLDILWRHRNRNLPDASPPVRHTVIRRSSPAPWQMARSSTPLSPHSTLGTSPGSTSWM
FT                   QNSRGPFSRPPLSSTVSPFTSPRPSPRLALAQPIPHSPNLNAYEFSDQSQISDFYGDLG
FT                   GDNNVDWLVADDANSTTSSTGGVSTPGALSATAVEFVPDMSPHDILRTVLGDKRSNDEI
FT                   EAALEANSYDLGATIASLSHDIESEAISKQHDDGRVLVGKSMTMEQVRPVTPLGSSRSP
FT                   VVCKYWLSTGQCLRADCRFSHDLTTHVCKYWVMGNCLAGDGCPFSHDPSALIGNLSVTD
FT                   GSRPASPSPFQVDSGSDAFPPLQAADNGDQWANQYTGRYPAHLSAYQASKYAPPGLLPG
FT                   MGKRNGSATHLGRPNSRPSSRHQNRELNPAAPSVDDPDAFPTLAAVNAKNAGKKHHGKR
FT                   GGHSNRETSLSKESVPSSLADVVRMTPSPAPGKTKSGSRNKETKGRENSAAAQSIPPPQ
FT                   NIPWLETGSRANQQYIKYRTEAIRHGTVRNKFLQSAAQAWNRNDARAAKALSLRGQAEN
FT                   DAMRRCHREAARQLYEERNQHLSHKGLDESSEELYVDLHGLHPEEAIEYLEKILLKHAR
FT                   EGLRVVYAITGTGHHSKNGKDKIGKAVKAWLNEWRYLFREFSVPGERGGYVGGILGIDP
FT                   TSYDKTVAKELASELVGANAGGEPSILTMGKIQLLKREEIETQDQ"
FT   CDS_pept        join(complement(685654..685693),complement(685330..685550),
FT                   complement(684546..685244))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000242281" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127367"
FT                   /orf_name="Pc22g02980"
FT                   /product="Pc22g02980 protein"
FT                   /function="citrate (pro-3S)-lyase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /cellular_component="citrate lyase complex"
FT                   /protein_id="CAP97586.1"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0008815"
FT                   /db_xref="GO:0009346"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniParc:UPI0001832337"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPS5"
FT                   /transl_table=1
FT                   /translation="MAARNTLRRSLLYVPGSSQRFLDKSRSLTADCVTYDLEDSVTPHM
FT                   KVAARSLVRRAIDQAAPAGIRERAVRINSVDSGLALGDLTEVLQSPNLTTIVIPKVNSA
FT                   SDLTFVTDVITHTLSQQPPTERIPISLLALVESAKSLTNLSQICAASPLLQGLIFAAED
FT                   FALDLSITRTPSLTEFLFARSAIATAARAAELPSTIDLVCTAYKSENGDGSPPAVLQEE
FT                   CLDGRRLGFNGKQCIHPSQVKIADQIFGPDALETEWAMRVVIADEKAAKAGRGAWTLDG
FT                   KMIDVPVAHKARAIVKKAEACGVDVDALRAEWKHQEPE"
FT   CDS_pept        join(686818..686908,686970..687015,687073..687359,
FT                   687419..687567)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233147" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942487"
FT                   /orf_name="Pc22g02990"
FT                   /product="Pc22g02990 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97587.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR008564"
FT                   /db_xref="UniParc:UPI0001832338"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPS6"
FT                   /transl_table=1
FT                   /translation="MDQGQGGQGDLNWRLSAHPITLLVFLGIRIGALLMYLFGVLFIDD
FT                   FILVFIFTLLLLSADFYYLKNIAGRRLVGLRWWNEVDTSTGDSKWVFESSDPNVRTVTA
FT                   TDKRFFWLSLYVTPALWVGLAILAIVRLVGVIWLSLIVIALILTITNTMAFSRCDKFGQ
FT                   ASTYANSALGGGIVNNIAGGLLGRLFR"
FT   CDS_pept        join(688224..688270,688345..688422,688488..688583,
FT                   688635..688700,688876..689137,689196..689294,
FT                   689358..689565,689623..689773,689826..689902,
FT                   689965..690031,690092..690168,690239..690310,6
FT                   90369..690532)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192570" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976278"
FT                   /orf_name="Pc22g03000"
FT                   /product="Pc22g03000 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP97588.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="UniParc:UPI0001832339"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPS7"
FT                   /transl_table=1
FT                   /translation="MENIHGAHDDGFTCGQCGKPGHMTRQCPNDSVPLGARDSNAGNAY
FT                   GNYNDGNGGGYGEYAGGGGRACYNCGQEGHSKAECPEPRKTGSCFNCGQEGHSKSECTK
FT                   PRVFKGTCRICEKEGHPAVDCPERPPDVCKNCQTEGHKTMECKENRKFDLNLVADMLPH
FT                   EAWAAMKKASDERDLDDFRDALKIYSKAVPHATWADIEEKMRDDDFNIYIIAMNAEVDD
FT                   VMSLIDLQGVLDREYVIGFFFSSKPSRGHLRDRWPADADDNLERMNNAGIPYERKVPKC
FT                   LNCGELGHISRSCKEERADGNDRTEIKCSNCDGVGHRVRDCRQQRRNKHGCRNCGSVEH
FT                   IASECTEPRSAADVECRKCNETGHFAKDCPNVADRGPRTCRNCGSEDHIARDCDQPRDV
FT                   STVTCRNCEKTGHYSRDCDQPKDWSKVQCKNCGEMGHTVVRCRQPKDKDPQDEPAFPPG
FT                   SPQREEPDLLGPEAKGEAFEFKRNNDDLW"
FT   CDS_pept        join(complement(692595..692635),complement(692282..692353),
FT                   complement(692099..692179),complement(691740..691876),
FT                   complement(691371..691466),complement(691193..691272))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823061"
FT                   /orf_name="Pc22g03010"
FT                   /product="Putative uncharacterized protein Pc22g03010 "
FT                   /protein_id="CAP97589.1"
FT                   /db_xref="UniParc:UPI000183233A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW58"
FT                   /transl_table=1
FT                   /translation="MGSEWTKREKRRSKIHQAVGVKKVHLAMRSPSHGISVRYFSDSVS
FT                   VDEYGVYDNCTSHRVSRGFRLGRDDKGFTNFPYKPHGGPTSGPENQFPAPKPAMTSSTI
FT                   NPMSKKGNPAKTYQFKYREKASLGRNPGFDPQYIPVMTVGSLTGARVSSESWHTVTQVG
FT                   VNRLG"
FT   CDS_pept        join(692712..692785,692844..692861,692923..693029,
FT                   693079..693309,693360..694123,694177..694313,6
FT                   94370..694682)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823062"
FT                   /orf_name="Pc22g03020"
FT                   /product="Pc22g03020 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97590.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183233B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW59"
FT                   /transl_table=1
FT                   /translation="MKPYFGLRGTNLNIMIGVIAGLDFLLFGYDQGVMGGLLTLNSFIT
FT                   VFPEIDTTKSSSSTSNNATTQGITIASYNLGCFLGAVLCIWVGNYLGRRKTIFAGSIIM
FT                   VVGATLQACAYSVPHLVVGRIVTGIGNGMNTSTVPTWQSECSKSHHRGKLVMFEGSLIA
FT                   AGITISYWLDLGFSFLDPSSVAWRFPIAFQNVFALVILVFVLPLPESPRWLILKGRELE
FT                   ALQVLSAILDLDESDPYVHSEFSAIKDAVLAASSVSFRDLLTMDENRHFHRVVLAYVNQ
FT                   MFQQISGINLITYYAATIYENSLGMDGLTSRILAACNGTEYFLASLIPIFIIEKVGRRV
FT                   LMLIGAAGMSISMAVLAATTSFEGQSKPGIAAAVFLFVFNTFFAFGWLGMTWLYPAEIV
FT                   PLRIRAPANALATSANWIFNFMVVMITPVAFDSIKYKTYIIFAVINAFIVPVVYFFYPE
FT                   TAYRSLEEMDTIFHKTTSVFNVVSVARNEPHRYGKNGELLINYEDTQEHLRRASYVAEK
FT                   NNKLGSGTGDVEAGKGTHVEHRKHSSSASS"
FT   CDS_pept        join(complement(695394..695983),complement(694933..695329))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976279"
FT                   /orf_name="Pc22g03030"
FT                   /product="Pc22g03030 protein"
FT                   /protein_id="CAP97591.1"
FT                   /db_xref="UniParc:UPI000183233C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW56"
FT                   /transl_table=1
FT                   /translation="MLSPLPSLTALVLSLLLASIATSTSTEDTPQLFTNMTLTTDDIFS
FT                   LFDTPLNTRDLQCRAGYSQCAYNSRRCCPTGGKCCGNGYCADAGETCCTGGGTCRVGYK
FT                   CCAGSTGCAPSDGQCCTGGYYCPAGKTCRIYKGRKVCCPLTGCSGEYDGIGSGGSLTGS
FT                   DTTSTSTSTETETETATTTYVDVDWDYYYTTIYWTYWFYYWTSYAPYTVRTVTSTTTTT
FT                   RTVFSVFASNSAEATSSLRESSSSYSFSTPYEATSLASSSDPVTLRTGSPAPTATSSLD
FT                   STYGIIAGPLNGEGSTGSAPSVSIIGNGIGILAAVLAAAIGGLAFGL"
FT   mat_peptide     join(complement(695394..695905),complement(694936..695329))
FT                   /db_xref="UniProtKB/TrEMBL:B6HW56 "
FT   sig_peptide     complement(695906..695983)
FT                   /db_xref="UniProtKB/TrEMBL:B6HW56 "
FT   CDS_pept        join(697003..697098,697382..697618)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942488"
FT                   /orf_name="Pc22g03040"
FT                   /product="Putative uncharacterized protein Pc22g03040 "
FT                   /protein_id="CAP97592.1"
FT                   /db_xref="UniParc:UPI000183233D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW57"
FT                   /transl_table=1
FT                   /translation="MKLSSSFLARNVMATLHGCVRVRLINCDVYTIAGHFITPPSDVRL
FT                   SDAPVFLGITTGVPIRQRHVRWPADFNSDGDIEPPRWPMGEPVVLWTLGCHSSPCMPDY
FT                   YVYTGG"
FT   CDS_pept        join(complement(698516..698607),complement(698279..698402),
FT                   complement(698132..698229),complement(697686..698010))
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(699540..699694,699746..700057,700118..700712,
FT                   700795..701369,701477..701492)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192581" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942489"
FT                   /orf_name="Pc22g03060"
FT                   /product="Pc22g03060 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP97594.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183233E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPQ9"
FT                   /transl_table=1
FT                   /translation="MSTEHQHASVGIDKQPVSEDISEQPEAPQSQKSSDDIDSEDHSVA
FT                   NIERIYRKLDRRIISAFWILYFLCSAIRSNVGLAQTMNTDTGHDLGSVLNLTRHQISTG
FT                   LALFYVCYVIFDLPSNLIMTRLSPHVWMSRIVISVGLIGSCLAAMKAAWSFYLLRLLLG
FT                   IVTAGMWPGMTYYLTLFYPPSRIGKRIGQYFTASQVSAAVVGLVSAGFQKMDGAHGLVG
FT                   FQWMFLVYGVITVALGFALLWWLPDRPTPPGEPAPKRARLLRWVPATAPALKGADAVVH
FT                   YHDLKRVYHSNAWTLRDLLAVFLDWRLYPLLVMYFGVVGVGIGVQLYANLIIKAIDPTL
FT                   SDVSLSLLTAPIWIMDLIAILLVTPLSDRFHRHRAIFFSIPVLLQILGLLLTTYAGTDA
FT                   NPWPRYGGLLIVGFGLGPTVPITMTWTTEIFQPRHGEVGVAAASAVVSGLGNLGSILTT
FT                   YALYSGWKSDYEAPGREKYRKSNLVMIGILAGSILSAALMEVLLRFVDGRYRGDGVDGA
FT                   VDGAARREVRQRGLHGLGAGVRRWLRLGRTKRE"
FT   CDS_pept        join(complement(703741..703743),complement(703639..703677),
FT                   complement(703469..703561),complement(702744..703248),
FT                   complement(702266..702689),complement(702164..702221))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000061500" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127368"
FT                   /orf_name="Pc22g03070"
FT                   /product="Pc22g03070 protein"
FT                   /function="ATP binding"
FT                   /function="glutamate-ammonia ligase activity"
FT                   /biological_process="glutamine biosynthetic process "
FT                   /protein_id="CAP97595.1"
FT                   /db_xref="GO:0004356"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006542"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniParc:UPI000183233F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPR0"
FT                   /transl_table=1
FT                   /translation="MASESATVISNTGNLMKYMNLDQRGRIQAEYVWIDANGGTRSKTK
FT                   TLFKPVTSVDELPEWNFDGSSTSQAPGDNSDVYLRPVAYYPDPFRQGDNILVLCETWDA
FT                   DGSPNKYNYRHEANRLMETNAHEGFWFGLEQEYTLLGTDGWPYGWPRGGFPGAQGPYYC
FT                   GVGTGKVYCRDIVEAHYRACLYAGINISGINAEVMPSQWEYQVGPCPGIDMGDHLWMSR
FT                   FLLHRVAEEFGVRISFEPKPIKGEWNGAGLHSNVSTNATRAEGGMKAIEAAMKKFEARH
FT                   VEHIAVYGEGNEERLTGRHETGNIDKFSYGVADRGGSIRIPRQVAKDNKGYFEDRRPAS
FT                   NADPYQITGIIVETIAPIPSASTWESDQSGLTV"
FT   CDS_pept        join(complement(705526..705557),complement(705262..705411),
FT                   complement(705103..705151),complement(704838..704997),
FT                   complement(704456..704595))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823063"
FT                   /orf_name="Pc22g03080"
FT                   /product="Putative uncharacterized protein Pc22g03080 "
FT                   /protein_id="CAP97596.1"
FT                   /db_xref="UniParc:UPI0001832340"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPR1"
FT                   /transl_table=1
FT                   /translation="MAGVGVVLAKRQWSWDGVFAEFVRTLYYRGIADVLYTGPARVIKY
FT                   MCGYPVRPAAGTDIQSSEGQISGTAEYLAVRVFLMHLRDLQLICARPKGPGVGLLRSVT
FT                   NVSPTIYGVLSMDIYTFEGNMCSMSGARSLDWFGWRERFGRHGKDAEVKVRRRATLYGS
FT                   TECGEYNRVLVRI"
FT   CDS_pept        join(complement(709042..710655),complement(708334..708995),
FT                   complement(708189..708216),complement(707987..708031))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192597" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942490"
FT                   /orf_name="Pc22g03090"
FT                   /product="Pc22g03090 protein"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAP97597.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="InterPro:IPR019680"
FT                   /db_xref="UniParc:UPI0001832341"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPQ5"
FT                   /transl_table=1
FT                   /translation="MATPSAKPGATPTHLSSPHPSSAPLSRSLAHKSPSMRTPTGSGPA
FT                   HAHQTSVSSHQYATPLAATSGVDDTVNFSSPSALLALGGYTGISPSPAVHDGLVGAGMN
FT                   ESDIQNLGMQGIKLGVARDNDEEQRHRVEEVVQLLRARVSGRGVSRESVERLSRLEGFE
FT                   SIWQDDNLNIAGNFVDLEIDFYAGQDVVKDVSLRYATPEYTEGVRREEATAVLKRTLAQ
FT                   SPEDAECGKWRSLQEFHENLQWLAKLDKLSQEVNCFEALENLEENFRRIWAEESKDGKH
FT                   GGEYQHLCAGVIGRPTMHKGSRIGLGLEYWVEQAKVLDAKQSLPSSDAMEIDAQHDEGS
FT                   KDELDGQGRSWTVMIECEEGYPSLRISKEWVGSEVFTAGESTELLPSTGAAGSVNWIDP
FT                   PQTTRLTHGNHDPMALDSSMLESSPPNRRFVGKLEPALDVPILAASEIYRQLGMQLPQE
FT                   FKMITYDALLVSESSSLTSPVSSPQIGRRKRRMPVHAFDSEGKQYTKQHNYTFQSFESI
FT                   TGCTIRDLPFSHPRQLADILPILRQYAVLANLIRKTFHLPKDQANATESSNATPQKPRA
FT                   PPVQTPDLFAGQDGPIILNNDDPNEERLNLLLGQSSSDNSKNDSGVGISTPSSGGKSPN
FT                   RVSVDDVKVDVTLRIQLGQGPALMLLITDQRNYESPEAPRSVQTPRQIAICFEVGLNGQ
FT                   ISVVDTAGLVDSEQGGDTEMQGMDNLDPGLQDVQKKIAKVLEVSQDLSILVEWVLRWMQ
FT                   QRAGNGCTLVAMYTVSQANTGSHKVTSDI"
FT   CDS_pept        join(712985..713020,713102..713392)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127369"
FT                   /orf_name="Pc22g03100"
FT                   /product="Putative uncharacterized protein Pc22g03100 "
FT                   /protein_id="CAP97598.1"
FT                   /db_xref="UniParc:UPI0001832342"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPQ6"
FT                   /transl_table=1
FT                   /translation="MGVRPWFFQRSKLCKNNAEHHDLNLGNFLSCDNGQVVVTDLEDVK
FT                   FRDRKQAWEYSVNLGSMSFLMSGFRDVRYPRRAPSTVLYSMPCTVDSDDWSGLECPVPE
FT                   LRQL"
FT   CDS_pept        join(714331..714426,714480..714880,714947..715026,
FT                   715078..715108,715167..715230)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192608" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942491"
FT                   /orf_name="Pc22g03110"
FT                   /product="Pc22g03110 protein"
FT                   /protein_id="CAP97599.1"
FT                   /db_xref="UniParc:UPI0001832406"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPQ7"
FT                   /transl_table=1
FT                   /translation="MFAARAFGRQARVLPKWTQFRCVSTLEGSPYIYVFPNEQPSGTHV
FT                   LSLLPSEPVNPDLAIGLATQLPPTTDTFKENPKFLNIVQDVLSEYAHEDPDAKSQAQVM
FT                   VSVAGANLNSGGVLLTGRRGKRRGDDSSSGASGQGGAGSGGRGGWIHISDGRRPPDYGR
FT                   ISWPEDMFGSLEVDANGQFVGDNGNYQPSGTYRILTRDGIFGLSPFLREKLVRKLRELE
FT                   K"
FT   CDS_pept        join(complement(716879..716905),complement(716297..716828),
FT                   complement(715580..716220))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823064"
FT                   /orf_name="Pc22g03120"
FT                   /product="Pc22g03120 protein"
FT                   /protein_id="CAP97600.1"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="UniParc:UPI0001832407"
FT                   /db_xref="UniProtKB/TrEMBL:B6HPQ8"
FT                   /transl_table=1
FT                   /translation="MCGRYALGVRLAYIRDRLQEQGMQVDEAPDDDAVRETYNFAPGNF
FT                   GAVYRADITDKGSYDAQQDVDSEHQKQDSEEAKDDVNPDTEPVDNAAIKYKLQSMKWGL
FT                   IPFWTKRQPDYGSMMRTINCRDDSLAKESGMWTTMKRRKRCVVVCQGFYEWLKKGPGGK
FT                   EKVPHFIRRKDGELMCFAGLWDCGSDEKLYTYTVITTSSNPYLKFLHERMPVILEPGSE
FT                   AMNKWLDPRQKTWSKELQSILKPYEGELECYPVPKEVGKVGNNSPNFIVPVDSKENKSN
FT                   IANFFANAKTQEKLDPSPKKEPVSPKVKTDQAEHRATEVSEWTEDNAPKPVPAGKREHT
FT                   PEAPADAEESKKRNVSTDPTEPSPQKKKLRSATYNSPMKKSGGTKAADGSQRITSFFNK
FT                   "
FT   CDS_pept        717209..718666
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976280"
FT                   /orf_name="Pc22g03130"
FT                   /product="Pc22g03130 protein"
FT                   /function="binding"
FT                   /protein_id="CAP97601.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0001832408"
FT                   /db_xref="UniProtKB/TrEMBL:B6HQX4"
FT                   /transl_table=1
FT                   /translation="MFRAASRRTSAHAAKLLQPQPKSLARSIYINSTTRPTLQSRFNNG
FT                   KPLTSPYISGTRHLTIMQKISRKYREASKGIWRKNPILMPLAIISVVGGAFIFAYISYV
FT                   EVTRVGPQYHKFPPPVADALRTAVYYTEIDLNPAKAMKAYREALHIAFEMGIHPYSDEI
FT                   LGIKLQVAMMLEKAGLVKPAIDVLERTKNETLAWVEEVTVGNAAAAADKVKEAQTQVQK
FT                   TPANVKVDTEAIQETEEDLKAMAQYEARQRDRALKKVVGIAMKLGELYSSDYIQDEKKA
FT                   EAAQVAAVEICLKEMHRRQRLGLPVGSSSSGEGSDGEAWLNLTEIATALAELAATYTAK
FT                   ERYELAMPLYMRALDLIRAAEGTSISCKQVVLLNDVATALVGQVQLPPKSQPQQPVTAE
FT                   QTVEAAQKWAEKAIEVAAHIQPPIRDEECDITCVVATYNLGELAELQKKPEVAKKRYTE
FT                   AKALADGIGYEEGSMMANEALKRLGKK"
FT   CDS_pept        join(complement(720496..720575),complement(720295..720421),
FT                   complement(719844..720161),complement(719168..719593))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000091643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942492"
FT                   /orf_name="Pc22g03140"
FT                   /product="Pc22g03140 protein"
FT                   /protein_id="CAP97602.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0001832409"
FT                   /db_xref="UniProtKB/TrEMBL:B6HQX5"
FT                   /transl_table=1
FT                   /translation="MAEQLVLRGTLEGHNGWVTSLATSLENPNMLLSASRDKTLIIWNL
FT                   TRDEQAYGYPKRSLEGHSHIVSDCVISSDGAYALSASWDKSLRLWELSTGNTTRTFVGH
FT                   TNDVLSVSFSADNRQIVSGSRDRSIKLWNTLGDCKFTITDKGHTEWVSCVRFSPNPQNP
FT                   VIVSAGWDKLVKVWELASCRLQTDHIGHTGYINTVTISPDGSLCASGGKDGTTMLWDLN
FT                   ESKHLYSLSAGDEIHALVFSPNRYWLCAATSSSITIFDLEKKSKVDELKPEFVEKGKKS
FT                   RDPECISLAWSADGQTLFAGYTDNKIRAWGVMSRA"
FT   CDS_pept        join(complement(721572..722022),complement(721031..721463),
FT                   complement(720914..720962))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976281"
FT                   /gene_name="emi5"
FT                   /gene_synonym="sdh5"
FT                   /orf_name="Pc22g03150"
FT                   /product="Succinate dehydrogenase assembly factor 2,
FT                   mitochondrial"
FT                   /biological_process="mitochondrial electron transport,
FT                   succinate to ubiquinone"
FT                   /biological_process="protein-FAD linkage"
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAP97603.1"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006121"
FT                   /db_xref="GO:0018293"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="UniParc:UPI000183240A"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HRA4"
FT                   /transl_table=1
FT                   /translation="MSAPRILHRVARPVPSSISTITRLNRQFGTTALRLKDGSDEASPE
FT                   VKAHRANQANKAPNQFVPNTTSTMTKDFVNVGQKPAPPEMLNSANPNYRPSDPYPGRIE
FT                   HFTGGRQDNGAQKPELGVGEMEGITFKVEPLKRVGEELATKRARLLYQSRKRGILESDL
FT                   LLSTFADVYLGKMNYDQLVEYDSFLDENDWDIYYWATQDSPEEISPSTPKEDTITETWK
FT                   ESGAKSGEWAQTIGAFRAAYRPVPSRWQNSEVLALLREHVRDKSATGFEKAKNKKTGGG
FT                   GGLGRMPDVQVFNSGHIVHRRHVLRMLYI"
FT   CDS_pept        join(complement(723448..723660),complement(723202..723328),
FT                   complement(722810..723110),complement(722729..722747))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160227" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127370"
FT                   /orf_name="Pc22g03160"
FT                   /product="Pc22g03160 protein"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97604.1"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="UniParc:UPI000183240B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRA5"
FT                   /transl_table=1
FT                   /translation="MGTSPITLRTILGFLFVFAQLASALKFDLVATSGGGKNERCIRNF
FT                   VSKDQLVVVTAIVGGSKGDGQKVNIHIKDAMGNDYGRPKDVVGETRQLFTSPADTAFDV
FT                   CFENQLVGHNTIQNPSRPIELDVDIGADARDWNSIQSQEKLKPVETDLRRIEEMVADIV
FT                   TEMEYLRAREQRLRDTNESTNERVKWFAFGTMGMLIGLGAWQVVYLRAYFRSKHLI"
FT   mat_peptide     join(complement(723448..723588),complement(723202..723328),
FT                   complement(722810..723110),complement(722732..722747))
FT                   /db_xref="UniProtKB/TrEMBL:B6HRA5 "
FT   sig_peptide     complement(723589..723660)
FT                   /db_xref="UniProtKB/TrEMBL:B6HRA5 "
FT   CDS_pept        join(complement(726302..728026),complement(724298..726193))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127371"
FT                   /orf_name="Pc22g03170"
FT                   /product="Pc22g03170 protein"
FT                   /protein_id="CAP97605.1"
FT                   /db_xref="UniParc:UPI000183240C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRA6"
FT                   /transl_table=1
FT                   /translation="MQSIKVPDFLDTGAASRSRSPSVVSTDSQFSRVNLMSPPSVTPSP
FT                   AFISPSAASEIISADQEFNAADFVAEDEETGAGATALVTPAALSLLNGFLDNLLFNILA
FT                   SSKSTQLACIRPAMAEVLKPRLAKEVVASAEEELSEYMGGADDEQTEFRGGQEPGGDFD
FT                   LVRSWKLTRLRCMVYTRLGDMEEDDEDEFIAQDRLGETDGAPRRFTSHVDNITPAASIF
FT                   LTSIIEYIGERALVIAGETSRSRLSAQLNNGGDELNGSGERKRIDRLVVEDLDMEKLAL
FT                   NATLGRLWRTWRQRRRGTTLSRTLSRESFRPRGYSLANSRKSSIVTIEEPVTPKEPLPV
FT                   ANSPPFDPATVPLPMSDYDVQEIEVPGYIGDLDGEVQTMQAVIAHKVRPRSLMVFSSPS
FT                   LVPKSPGSVNSSPVSASAIEPGKSFRHVRTRSLPNEAATLNSAEEEPESPTDHPSPTAS
FT                   EKKQLETMYEDDESAEYVDAAETTTPGIAVTTEHEKTPAEASENARMSILHEEEEDTPP
FT                   VSETVASLRAIAQDEDAMTDQSNSARVSIVSLGDRPNQKDPEVIEGTGLCEKPKLTSTP
FT                   LTQGVETTPAPPAPPIEAVTSSIDHDATDDLNNMATTATPPAQPSEAHTETAKSSKSLP
FT                   VDITRPTSSSGNSQRSKTRPRPAPLEVTASNRGSPASASASAVERAAVQRMSRPSTSTA
FT                   SSIITKTRRSGSFGSARENTRPVTAGSTTSHVSSKLKGLMGRPLGESGSPRMRSSSETS
FT                   RASGSVDSVDDDIADLDKLINSDETIHYTLTPRSVREMTLPDMPSRSVPRSETAGVSDL
FT                   AEFLNTTAPPDEEKHRPQASVSSKATGEMTPISHTRSIESPKHIPLTTRLTNMSSTSRS
FT                   SKVGQARDARISPSESTRDFAEFMRSTGPASGPNESKTSISAESTRPIRPPSTLSTASR
FT                   GNRPKLQARSAETGGSQTSDLIDFIREGPPMPAGAHRIPRTVAPFRNTIDSDDLHLDNT
FT                   TSNSFVSTVNGSTPNKSLTSLGSRSGLLDSNRTKATASGSATDFDEPQPVRKQRRAPDP
FT                   YAIDDDDDDALLEELLEKEQNPKPKREEESLMDFLRNAPPPPSSEQTPQPFAISAPASN
FT                   GLSGASGMKARLLRTSQNSLRTQNAPTKVQSNYSAKVGQERNTGTMPSISNRQTDTGDL
FT                   ADFLRNTGPTPAPNRSSPMGSKAKDGGFSRFFARRKKVEA"
FT   CDS_pept        complement(732647..733792)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192663" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823065"
FT                   /orf_name="Pc22g03180"
FT                   /product="Pc22g03180 protein"
FT                   /protein_id="CAP97606.1"
FT                   /db_xref="UniParc:UPI000183240D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRA7"
FT                   /transl_table=1
FT                   /translation="MDKPITEQMSTSTLHRGSWGSVSSTFSNLEMSFSHDSCYGSDEVS
FT                   VTSNGCNPAQSDASTSTTKPTLRPFLKSILKNSTITFDTDEESDSESGYSSDGIDSEYD
FT                   ALSDESDEEDDGDDSDFSVWDETHGDVPETHEDHTESFDDAFISFEENSVRFDPQVKYI
FT                   DSVEVSDDEGLDQQMTCHEMMMLARDSKGTQTLLDQLDKMDIAESDENEDRHPEFIRRP
FT                   TNQPEEFSRDAVDLDCSLFVAYMNGIHGIATPKYETYLRVQVDHIRLGKDTEFVDPEGA
FT                   PSLYLDLVSNHVTGTFCNLLAEDELNELIRLRAEEQTGNPNGTDSSVLDLAHHQALLNK
FT                   IEQFLLDRLASGRVDIGPDELSFFAGGIAQELGTKTLPVQV"
FT   CDS_pept        join(733812..733929,734114..734269,734354..734543,
FT                   734599..734710)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942493"
FT                   /orf_name="Pc22g03190"
FT                   /product="Putative uncharacterized protein Pc22g03190 "
FT                   /protein_id="CAP97607.1"
FT                   /db_xref="UniParc:UPI000183240E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRA8"
FT                   /transl_table=1
FT                   /translation="MDGFVDLPNCLKYRDLRGLWDRNRALLGRRVLWKNEVGKGYFLAS
FT                   LVCGTKQSRLVVVVVRNELVSVTDNTDAKGFVDMHVGYKKVARRSRGKKAYRRRRLRQE
FT                   ETIGYESRKEKSGPRFAGCDGGAKSGLSHVDFGVKATIYNADEESARAQTGVKWPEGKE
FT                   EKEKRRVPYLLGGRKGRPNFSSSDSAGT"
FT   CDS_pept        join(complement(735258..735477),complement(735049..735097),
FT                   complement(734833..734971))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976282"
FT                   /orf_name="Pc22g03200"
FT                   /product="Putative uncharacterized protein Pc22g03200 "
FT                   /protein_id="CAP97608.1"
FT                   /db_xref="UniParc:UPI000183240F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRA9"
FT                   /transl_table=1
FT                   /translation="MGWWSTGCVDMSCFLWHPCYVWVELRHHKHSAANTQPMNIDGGRD
FT                   FTKNSGRTQNLVELKLQGALDHLDRPATSIADGLFNNGYMDICKVKIVIKTLGVTLKKQ
FT                   FPAERCSVLCTPYSDAPEVILSKADIAHSAL"
FT   CDS_pept        join(735717..735886,736097..736421,736508..736525)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942494"
FT                   /orf_name="Pc22g03210"
FT                   /product="Putative uncharacterized protein Pc22g03210 "
FT                   /protein_id="CAP97609.1"
FT                   /db_xref="UniParc:UPI0001832410"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRB0"
FT                   /transl_table=1
FT                   /translation="MGSKQTLPNKGPGRRSPAGQGFLNFRASCAYMLSSQENLSFSNIS
FT                   KFFCALSGGKRGYHDAYTATLKVSTLEPDRRSSFCPSCLASPCSLDNPERLGERSDPFP
FT                   FLSALTPYKLCRSLIQGSGSTCLRPPQTRFTSSFDDCSTASGLVKEGYIPVGGYPEQTL
FT                   FGVGGAG"
FT   CDS_pept        736910..738472
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942495"
FT                   /gene_name="wetA"
FT                   /orf_name="Pc22g03220"
FT                   /product="Regulatory protein wetA "
FT                   /biological_process="conidium formation"
FT                   /biological_process="multicellular organismal development "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="sporulation resulting in formation of
FT                   a cellular spore"
FT                   /biological_process="transcription"
FT                   /protein_id="CAP97610.1"
FT                   /db_xref="EMBL:CAA56364.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0007275"
FT                   /db_xref="GO:0030435"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="GO:0048315"
FT                   /db_xref="UniParc:UPI0001832411"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01870"
FT                   /transl_table=1
FT                   /translation="MFAQPYDHSFNDLFNQYVNMETSAVDGKDSALSDFDQLFPLDSLS
FT                   SDCGDLPPTVSTPKRHQSPQPWSNEWSLQDDGAAADHFAFHDTVHPSAISDVNLNNFEV
FT                   PSRPTASHGLSTSPSTPPATPRRKPTQSALITPKSIRHRSPNERRSHLRKQSFSPSLMR
FT                   SSNLSKARMAYPEAWAQRLQNFSLHGSEDRLPLSPPPSDVLIQHENMPTEQIMNQHGDS
FT                   AERPSQYDARLYQQSPSVSMPSPSIAMSARQQQHYIAQPSSSSLTNSSPSSADDIFSSS
FT                   HSSDPHSLSSWQSDPLHASSLSFTPDLQGQDSQWWSPMPSRVAQQQAAYLTSPTPVRTM
FT                   QSVGSQNDMMQGGLMIQFNPSYDMSADHSFSSSNMLPATPQKFDTSFNTSQVHNVSRSP
FT                   SLSPKAGTSPRDTRNGSISKPTHRRTHSRKLSGQSMNAPKPAKASGSSSRGSNKSVSVS
FT                   FVNFTAHDSKKILTGVAPSGSSKTKARREQEARDRRRKLSEAALRAVRSAGGDVEALEA
FT                   VLC"
FT   CDS_pept        join(complement(739797..739927),complement(739571..739725),
FT                   complement(739350..739436),complement(739220..739297),
FT                   complement(738964..739166),complement(738845..738889))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670308"
FT                   /orf_name="Pc22g03230"
FT                   /product="Putative uncharacterized protein Pc22g03230 "
FT                   /protein_id="CAP97611.1"
FT                   /db_xref="UniParc:UPI0001832412"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRB2"
FT                   /transl_table=1
FT                   /translation="MEQGNGQCRARNAIRQVTQPTAKSDANGNASGDGDAIKMQDRTQK
FT                   RNGNQERPGNSKCVAANKNNRMSQGQQMKAEMQAKYLILVRWQVKEGCVAGEANADAYI
FT                   ATYVCNESEICRERGVVHSRECILTKAVCMYRGERRKKEEEEIARAGHRYVGLGMEDSV
FT                   WRTQYGGLSMEDSVWRTQYGGLSMEDSVWRTQYGGLSMEDSVWRTQYRGLSIEESEDFQ
FT                   YRGLNLGDSG"
FT   CDS_pept        join(740263..740468,740521..741569,741629..743289)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823066"
FT                   /orf_name="Pc22g03240"
FT                   /product="Pc22g03240 protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP97612.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR003100"
FT                   /db_xref="InterPro:IPR003165"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014811"
FT                   /db_xref="UniParc:UPI0001832413"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRB3"
FT                   /transl_table=1
FT                   /translation="MSGRGYGDLPIRGGRGGGDRGGSRGRGDGGSSSRGSDRGYSGDRG
FT                   RGSDRGSDRGGGRGGRGGSEPPSGMLTDPFEAPSARIQALEDKFVTESAKASPESNSLA
FT                   RRPGYGTQGRPTVLRANFFPMEFKPNIKFHSYRLKIKPEAKKGQQKFILESMFRQYPLF
FT                   NQGIGVATDGATEIVTTERLPEDRVPFHCSMGDGGGTSKAYTGPWEATLTFENAYSPAE
FT                   ILAYLEDVNHREEVPNEAPSLRVLNILMSAYAYRDPGVVIIGKSRNKFFRIDRGKQSMD
FT                   INGGLEAIRGYYSSVRLGAGRIFLNLNVSHGAFFRPCLLTQIIDDFAVVHGKDTGLLNR
FT                   VLKGLKVHVLHLNSRKNGSGENEKPVKTILGVATLKDGCKGHHPPKVSHIAASAKNVEF
FT                   WMGDEKKGQYVTVAEYFKRQYNMPLRREGQMPVLNVGTLDRPVYLPAELCEALPGQPCT
FT                   AELGLIQRQNMIKFSCRRPPQNYDSIMTEGLNLMGISGGHTKAVGIKPGKEMITVPARI
FT                   LNPPNLLYGGRKTTNPRNGSWNLVNTKFAQCASISKWTVLWVRKRGMKQPDTPIPNIDG
FT                   FYRKMRDHGLTLPPFDKPHHEVMLGLDDRENRSLLKDKFKDLANKSYPFLVVVLPTTEG
FT                   KNFDYVKYAGDLKTGILTHCILYDKVLRSNEQYWSNNAMKVNLKMGGCNQLLQPANARF
FT                   IGAGKSTMVVGLDVTHPSSADPEVFPSVASIVASIDYRMGQWPGEVRAQMRRQEHVVHL
FT                   KDMMLGRLHLWQKNNSGNLPQNILVYRDGVSEGQYNMVLMEELPKIQAAAKAVYRGPMP
FT                   NITIVVCGKRHNVRFYPTNAKDQDRTSNPLNGCVVDRGVTRPMYWDFYLQAQAPLQGSA
FT                   RPAHYIVIHDEIFTNSKANPDRKPVDVLQEVTHNICYMMGRATRSISYSTPAFLADKFC
FT                   DRGRKYLLAIYHDNNQQVHSDKFEGDNLNISRHCSNNMVYI"
FT   CDS_pept        join(complement(744860..744922),complement(744196..744600))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942496"
FT                   /orf_name="Pc22g03250"
FT                   /product="Pc22g03250 protein"
FT                   /protein_id="CAP97613.1"
FT                   /db_xref="UniParc:UPI0001832414"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRB4"
FT                   /transl_table=1
FT                   /translation="MVNSLWFKWKKLRLPWRKSFLTVEAQLTSYFNTAQWHQWLRHVRQ
FT                   HPPSIQEQQQDLIRQAQIKQLARLADERWASKASYLDKPKTQQQPPATQIDEATLSQPA
FT                   NAAPAQKAPASATTPETAPKTQNEEDPWAKAKNTNPGEEWQPEAWSPSSKR"
FT   CDS_pept        join(745281..745447,745521..747203,747288..747321)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942497"
FT                   /orf_name="Pc22g03260"
FT                   /product="Pc22g03260 protein"
FT                   /protein_id="CAP97614.1"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR003096"
FT                   /db_xref="UniParc:UPI00018324D2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRB5"
FT                   /transl_table=1
FT                   /translation="MASVTSLDKDLRNMRLSRYTPQAAAEVRDWIEEVLHEKLPSPDLL
FT                   EGLKDGVALCKLVNLAVSPGVKYKQLSAPFVQMENISHFLRACQLPPLNLPPHDVFLTV
FT                   DLYEGKDPAQVLQCLAAFSRRANALAPNKFPRTVGPQSKRGVISPNATGSSNGAYSPRS
FT                   ARSSSNVGDARATLPSRTDSPAKPAGSYSTWAKKGDEQDTTPAWNIHQYGYMGGASQGN
FT                   QGIAFGARRQITTPAPAVPSLAEKEKRRREEDERIRQQNAEREEAERAHQRQIAEEEAR
FT                   AKAEEERRWEEETARVREQERLRVEEEKKRWDDEKRQWEAEEQRRMAEEKEAEERFEQE
FT                   RQQRRSVHDIRLNGQFLSQYQTSNSQVGDVAGASPAEETAQSRRIKELERELQQAKERE
FT                   RKYQTERQEAQSGKTGDQAQTRNQSRPRPVPPKPSYDLSSLEQERRLLRTEWQNTQDMP
FT                   STSEAEESNPTEEQAPAPPARPLPMPKPTSFSATPALPPRDLPASPRPLPDPVAYNANR
FT                   GHESRVDSFLSSNPAPASPAPATHRFQDYTSTSEVDAENSRRAASQQKTKAGGWASKSL
FT                   LEREMERERARQEEWAENQKQTAAAAERGSKDSSQGSGPGQRQIIGPRPPR"
FT   CDS_pept        join(complement(749592..749727),complement(747865..749504))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192742" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976283"
FT                   /orf_name="Pc22g03270"
FT                   /product="Pc22g03270 protein"
FT                   /protein_id="CAP97615.1"
FT                   /db_xref="UniParc:UPI00018324D3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRB6"
FT                   /transl_table=1
FT                   /translation="MYLFSWLFTNPPLAMATVDEVPYRSPVPLQWELARQTEIFLEDSL
FT                   WPQAYSLLFNVLASGTISSTKAVIPLPQHLAVAATMLVHPRTTTRAESEYEKEAPKAAL
FT                   RFLRLTNSLVGPTDATFNIAFGFTQFGSSRQGRRRAESPMLVEHDNPDTRPLNTKFSQA
FT                   ASVWHCAEDFWHAVGWAFNCSVLHPARWERWQIWLQFMCNVLEDDWKEREKKYQEAKQN
FT                   QTDTSVLPGKPERSEREASQGAEPIKEENYTGKKPKVKTVKVTDDLGIFRESLIFRYIA
FT                   SNTTAGRNRRIMRAIFANGKSNLGEFKEVFKDELRIPVADQELHNTKKRAGDINLDKND
FT                   YGDYQNNSDEDFEADQSSTSVSPPAKGSNAKPRRSKRTRRGTRNAMDEATDPIKMAKNK
FT                   TPSQENSNLAPLGGYTSLALRQQLLSILSSVSEKLPRHFMPLDDLYDLFVENIRDLSLP
FT                   IFQQFISPSNLPHLLPEAHSTLCELLLFVLRESSAPSSDDNYLTQAKLEKCFLPYAAAT
FT                   PSVGNNAKVSILLEALMTLLHKNKMLSVTPSLAEAVQSGIARREQASRDRNSVEWAYLK
FT                   ESGFRMKFMVEHILP"
FT   mat_peptide     join(complement(749592..749679),complement(747868..749504))
FT                   /db_xref="UniProtKB/TrEMBL:B6HRB6 "
FT   sig_peptide     complement(749680..749727)
FT                   /db_xref="UniProtKB/TrEMBL:B6HRB6 "
FT   CDS_pept        join(complement(751896..751941),complement(751361..751777),
FT                   complement(750912..751270),complement(750804..750854))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192740" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976284"
FT                   /orf_name="Pc22g03280"
FT                   /product="Pc22g03280 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97616.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007203"
FT                   /db_xref="UniParc:UPI00018324D4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRB7"
FT                   /transl_table=1
FT                   /translation="MYSSSPFGLDSAHAYLKKDSLKPKRKRRQSESSSAPRDHKPIRPA
FT                   NSSLGRATSSPRSFSFFSPSLPTYSFCLLETVKLASDNSKVSSLLAPRGISFPPDVDTG
FT                   PQRLSPSMTSKQGRRRRSSSLIYQEPAESIEHTSDQAALPNLNANWVNAKGAWTIHFVC
FT                   IAALKIFYDIIPGVSQETSWTLTNISYMFGSFLMFHWVRGIPFEFNAGAYDNLNMWEQI
FT                   DNGDQYTPAKKFLLCVPIVLFLLSTHYTHFDLTHFTINFLATLGVVIPKLPFSHRLRIG
FT                   LFSDIPEES"
FT   CDS_pept        join(753209..753332,753421..754670,754730..755422)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976285"
FT                   /orf_name="Pc22g03290"
FT                   /product="Pc22g03290 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP97617.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="UniParc:UPI00018324D5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRB8"
FT                   /transl_table=1
FT                   /translation="MKPYTHVESDPGSKSSLPAVYITSRACREHVDIDQQTVGFKASTR
FT                   SASASVLIYLGKSKRKRQPIVLFLGIYYNRSIKKLIGTQIKGLYGLSPHRSLPYTSQVQ
FT                   ELREWSIQSTVKYSGDPNSIVDPCRLLIRSLVQYFCPNCTTSMANSSDEEADSRTALVG
FT                   APRTRSNPRSTSRSASHDSTRPAKRQRRNRNKKDSDLADFVPKGVAFSATSLPVDDPDS
FT                   TSSSGSSSASSEDSDSDANSTTVANPHAGNTAPAISWNQGRKAAVRTTLGKRSAPTNEK
FT                   PGQFEAVNDKFWRSRSASVSANGDDKPSTNNQSQNDDELEDGEIDSKSDTDDSDSLGSE
FT                   ADDSILLNIGEKMGMDGANDYDPATLAHQHGSNTGDSNLKGASTQSGPGSKEEAFRLFS
FT                   SKYPNAPVALVDLSKTDLELIAKYVYFDRSIHDIDLKLPISCLECQREGHMADICPAKE
FT                   CEHCGAWNQHQSSTCPDWRRCQRCRERGHDEPQCSAKLRSFAYEVPCSYCGSEHLENEC
FT                   DYLWKFPIRDLHSNQVTVSICCANCCSAKHLMGDCPANNLREPCTTSSSFTLKGIDPHM
FT                   ITNLNTVLPPRETRPPSGSRSRGRDREWSRPPSPDDDDMMSRVSRGRGRPVPAPRGNTR
FT                   GSIKFASGVGAKRANPPLPRGPPPPRGGGRGRGPQRGGGFSRGPRGGGRGRGW"
FT   CDS_pept        join(complement(756800..756918),complement(756337..756369),
FT                   complement(756056..756262),complement(755587..755941))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127372"
FT                   /orf_name="Pc22g03300"
FT                   /product="Pc22g03300 protein"
FT                   /function="phosphoglycolate phosphatase activity "
FT                   /protein_id="CAP97618.1"
FT                   /db_xref="GO:0008967"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00018324D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRB9"
FT                   /transl_table=1
FT                   /translation="MSAIACKYLRPRKFAPLGSTGTSTAPLLKGIVFDVDGTLCLPQHH
FT                   MFSEMREALGIDRSIDILQHIRGLPTEERATAVSKVQAVERRAMADQQPQPGLVRLMDY
FT                   LKSRGLRRALCTRNFEAPVQNLIDNHLDGHIFLPIVTRDTPNLLPKPDPAGILHIASEW
FT                   GLANGENLIMVGDSIDDMTAGHMAGAATVLLLNERNVHLQEHPHTDLCIKRLDDLIGIL
FT                   EEGFVGTREDDEHGA"
FT   CDS_pept        757258..758184
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823067"
FT                   /orf_name="Pc22g03310"
FT                   /product="Putative uncharacterized protein Pc22g03310 "
FT                   /protein_id="CAP97619.1"
FT                   /db_xref="UniParc:UPI00018324D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC0"
FT                   /transl_table=1
FT                   /translation="MDQKLFAVFPISLLKTIHLIGSLFWLQLLYAASYLAQLFWGTQRE
FT                   YPPFKKAIDRTETSIINALLGTVPLSAYSSATATERQWYLSSGNGALNYENNIHATSQP
FT                   TSNLLTTSPWPEEGHQDSDSSSDHETPTPRPGTEHTRENSPIYQTVRKLRSNTRGSISK
FT                   IANSARSIFRQPLTVLPRDMDSFPSDEERTEPHLVPVPVHASQPQLVQNVSFPVPMSVS
FT                   ARVADHFSDPGPATAIKVQQPVSFGATIDGGIDSETVQMNRSSKYYSVESYPGKFPVSD
FT                   ALDYSSLATAYAVRGKGTTSVRPFSDY"
FT   sig_peptide     757258..757350
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC0 "
FT   mat_peptide     757351..758181
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC0 "
FT   CDS_pept        complement(758678..759364)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225437" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976286"
FT                   /orf_name="Pc22g03320"
FT                   /product="Pc22g03320 protein"
FT                   /function="carboxy-lyase activity"
FT                   /protein_id="CAP97620.1"
FT                   /db_xref="GO:0016831"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="UniParc:UPI00018324D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC1"
FT                   /transl_table=1
FT                   /translation="MLSLLSGTHTPSSSRHSPGGSPTETTMPITDHAPQQTRRRRIVVA
FT                   MTGATGAILGIKALIALRHLNVETHLVMSKWAEATIKYETDYHPSNVKALADHVHNIND
FT                   MAAPISSGSFKADGMIVVPCSMKTLAAIHSGFCDDLISRTADVMLKERRRLVLVARETP
FT                   LSDIHLRNMLEVSRAGAVIFPPVPAYYIRAASVDDLVDQSVGRMLDLFDLDTGDFERWE
FT                   GWQVEK"
FT   CDS_pept        join(complement(761433..761920),complement(761128..761384),
FT                   complement(760851..761082),complement(760001..760792),
FT                   complement(759843..759954))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234627" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942498"
FT                   /orf_name="Pc22g03330"
FT                   /product="Pc22g03330 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97621.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018324D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC2"
FT                   /transl_table=1
FT                   /translation="MSTVSQGEADRVLQLKSREREAHACYPCRKRKVKCDGCQPCRTCQ
FT                   KRKHPEICTYSLSHSRCRSASRHSVARSASPRSPAVASNQQARPDDSSKNYVYSGDNSV
FT                   ASILRMRASDVNESVAREVGSVLGLQNTFSNYTFMNSKTPLEKWQSLLTVMPQRSEVLK
FT                   FFHFYRVTAYPFNPILADIDRFESDLCTYLNAHASGELRDPEKITDRWATDKSIGHISL
FT                   LLATLAAGAHYSDIGCSERFELSTDFARRSFHALRLANFLFRPSLDIIQALLILGNTLQ
FT                   NMGQSDAAWALLGTTIRLAQTMGLHTERSTVHWPDHVRTKAKNLWSTIIWQDSLLCLCY
FT                   DRPPIVSVTGWSFANSFFERQDLSFAEVMHLLCRIGLDIMRPENLSTAESDRALEGLQR
FT                   LDYAHQRGLPYLRSRENCTTMQQHLEHLALRMHTSFCVSVLCRPAMKQSTPQPFLHQTS
FT                   ILRDRAKGSLIDASRAFLDFQALSTVPLRSWSMVHTVLSSTLLLCIWEETRNDPECRNL
FT                   QQKVIDVFSSSNSRISDDGASLSESDSQWLSDRHIRALVTLRSALEREQETSATETENW
FT                   AGIPPNTLPQFGPGPVGPLDMTNPFDVSPVTYLDSIMNRKHRFPSFDDKS"
FT   CDS_pept        join(762197..762258,762286..762325,762425..762449,
FT                   762498..762703)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127373"
FT                   /orf_name="Pc22g03340"
FT                   /product="Pc22g03340 protein"
FT                   /protein_id="CAP97622.1"
FT                   /db_xref="UniParc:UPI00018324DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC3"
FT                   /transl_table=1
FT                   /translation="MGIKLHKTKISMDGSMAPGDLKIPRRTKDNNTLDSAITGSRPDKR
FT                   KRAHTFESDLLKYISLKDLSDSVYYRGIELFYPKDPQSKRDVSLCYHIVSSATYSYLRR
FT                   WPGCWV"
FT   CDS_pept        complement(764025..764594)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111516" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942499"
FT                   /orf_name="Pc22g03350"
FT                   /product="Pc22g03350 protein"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97623.1"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="UniParc:UPI00018324DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC4"
FT                   /transl_table=1
FT                   /translation="MRYSRYFRCFASSLLPVLWGIAHLFMLWKGACTISGSKYPIMVVS
FT                   SESMEPAFRRGDLILLWNQQEHIRAGDIPVVWFPGRPLPMVHRAIKVSYKITNRSEPAR
FT                   YFRLASNRVDHMLIWYRQLILTKGDNNEVDDVLLYPKGRSSIYRQEIVGLVIGYIPHVG
FT                   RLILALKERSEMLLIAVVLVVAGILL"
FT   mat_peptide     complement(764028..764495)
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC4 "
FT   sig_peptide     complement(764496..764594)
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC4 "
FT   CDS_pept        join(765157..765472,765535..765695)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217055" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942500"
FT                   /orf_name="Pc22g03360"
FT                   /product="Putative uncharacterized protein Pc22g03360 "
FT                   /protein_id="CAP97624.1"
FT                   /db_xref="UniParc:UPI00018324DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC5"
FT                   /transl_table=1
FT                   /translation="MHAKVVLAGAALTAVSMIPSCPAPIVGGLIAGAFGAELAGNLIYI
FT                   GLNDNLKRSPVDSSVKARIAIGYKSRRALDYPGVSDESVQQCKDSNSGKTDVKVTQTEA
FT                   HSYRIENVTPECMNLAALFTEDSPPVPCGSACLQYSNLSESDNNALQGYIQELL"
FT   sig_peptide     765157..765225
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC5 "
FT   mat_peptide     join(765226..765472,765535..765692)
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC5 "
FT   CDS_pept        766501..767775
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217051" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823068"
FT                   /orf_name="Pc22g03370"
FT                   /product="Pc22g03370 protein"
FT                   /protein_id="CAP97625.1"
FT                   /db_xref="UniParc:UPI00018324DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC6"
FT                   /transl_table=1
FT                   /translation="MPLGSLQIPWNRKRRRLEHTIRAPYQPIGRVFLLVTSTPFNLTMS
FT                   TLLIPPAFFGLSALVFLVAIQLPLEYRVRLSPLLFGSAYASLSASHYLDALPSVNTLWG
FT                   LLTCIWILHAISILFIDKITIPRGAPPWTAAYKIWMNPRRQLDWDSIISRKQNTNSTSI
FT                   APFIIKRLFKAGTCCVLQFCIIGPSVYLNFSFTSHDFGRVQEIFIRRLIWSDYGPSITP
FT                   REIQTRILLSVYWIWLTYLMLDVCHILLSVFFVIFRVDTPEEWQPLFGSVGEAYGVRRF
FT                   WAKFWHQLTTPCCASSGRLVTRLLGFKPASSFEKCFIAFWTFFLSAIYHFVADWMAGEP
FT                   CRPMNDLFFFLINFLVVTVEIFVASVWTRVSNVEIGRGKYSNASKRQKFAGFIWLLLFF
FT                   FWSVPKWQYSKLQAMVERLEYSTQD"
FT   CDS_pept        join(768709..768939,769223..770338)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217353" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942501"
FT                   /orf_name="Pc22g03380"
FT                   /product="Pc22g03380 protein"
FT                   /protein_id="CAP97626.1"
FT                   /db_xref="UniParc:UPI00018324DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC7"
FT                   /transl_table=1
FT                   /translation="MIFLSLPREIQVMVISRVSSIGGLAALSRSCRSIHHLCDMKTRER
FT                   FYQIHVEPKDYSINKTFDLLMDILRNPKLGSYTNSHGEIHGTFIAQALAAILISVSPNL
FT                   ESLEMTQPFSVFSGFYRGGERPQEDDVHFPLDRLLRRANANPASIAYLQNLRKVYMIVN
FT                   DRHSDDRFYMAIDFLECVTLFDRLPSIESISTDALCDDENGEARVVLEPRSSNVSRIHI
FT                   HHSALPTIFLVSLIQSCKVLREFHYTIGGRCVLGGWTTPFNARTFIKSICPHKDTLEVL
FT                   DIDAERNMRYFHPSYFEENRVDQEIDKEQRALESDDDDNDERQMIRHLSSNSGSLKEFR
FT                   SLKRLSVGIGFLVYFAMGVRGNDEPRQPCLLPEALPESLEYLCIRGYEKGKCKKWDTHI
FT                   DALVASFVLGSSGIKEITGIEETIPNSEDVEDPDGDKDLLWIPRYDVDY"
FT   CDS_pept        join(complement(771454..772419),complement(770869..771405))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217444" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670309"
FT                   /orf_name="Pc22g03390"
FT                   /product="Pc22g03390 protein"
FT                   /protein_id="CAP97627.1"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="UniParc:UPI00018324DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC8"
FT                   /transl_table=1
FT                   /translation="MANTEPHLCFRSFVEALKADNDLVEIDTPVDPNLEAAAITRLVCE
FT                   TDDKAPLFNNLIGAENGLFRILGAPGSLRKSPKDRYGRLARHLALPPTASMRDILDKML
FT                   SASTMAPIPPNIVSTGPCKENFLQESQIDLTKLPAPQIHQADGGKYIQTYGMHIVQSPD
FT                   GSWTNWSIARAMVSDDKHLTGLVIEPQHIWQIHQMWKKEGRDVPWALAFGVPPAAIMAS
FT                   SMPIPDGVTEAGYVGAMTGSALDLVKCDTNSLYVPATSEIVFEGTLSITDKGPEGPFGE
FT                   MHGYVFPGDTHLWPKYKVNRITYRNNPIMPMSSCGRLTDETHTMIGSLAAAEIRKVCQQ
FT                   AGLPVTDAFAPFESQVTWVALRIDTAKLREMKTTPKEFSKKVGDLVFNCKPGYTIHRLV
FT                   LCGDDIDVYNGKDVMWAFSTRCRPNLDEIFYEDVRGFPLIPYMSHGNGSPVQGGKVVSD
FT                   ALLPCEYTTGRDWVAADFENSYPEELKQKVLANWTKMGFREE"
FT   CDS_pept        join(772906..772959,773006..773635)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000260254" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942502"
FT                   /orf_name="Pc22g03400"
FT                   /product="Pc22g03400 protein"
FT                   /function="FMN binding"
FT                   /protein_id="CAP97628.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI00018324E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRC9"
FT                   /transl_table=1
FT                   /translation="MFYQPGVTEHNLPHDPFKACVVPRPIGWISTKNKEGQANLAPYSQ
FT                   FNNLTFDPPYVMFSSNQTVNGTRKDTVVNAEQTGRFVWNLATWDLRQAVNISAEQVPYG
FT                   VDEFERAKVTKEPATLMDVPMVRESPVKFECEYHSTVRLPGNPPMGTVDVVIGRVIAVH
FT                   IKDEVLTDGILDIKKTKPVARCGYYQYTVVTETFDMVIPGMSEDVLYGLEGSAKRNREA
FT                   ESRNT"
FT   CDS_pept        join(complement(774479..774568),complement(774257..774390),
FT                   complement(774063..774177),complement(773841..773918))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942503"
FT                   /orf_name="Pc22g03410"
FT                   /product="Putative uncharacterized protein Pc22g03410 "
FT                   /protein_id="CAP97629.1"
FT                   /db_xref="UniParc:UPI00018324E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRD0"
FT                   /transl_table=1
FT                   /translation="MSRGIYKLIPDPDSSGSSDQASPKILEMLLNKGSKVPFTGRAVDQ
FT                   PSKAGPSQDLSWPSSVTNESTVLALPSTKLPYRSSDEYGHLSTSPIRISSEYQRSRQSR
FT                   RKLSQDMLQREQEKRSSAMELEQDEWWVQTELHK"
FT   CDS_pept        join(complement(775240..779913),complement(775026..775172))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192764" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670310"
FT                   /orf_name="Pc22g03420"
FT                   /product="Pc22g03420 protein"
FT                   /protein_id="CAP97630.1"
FT                   /db_xref="UniParc:UPI00018325B7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRD1"
FT                   /transl_table=1
FT                   /translation="MGVNTRRPILPAPTESIIDTTGDSATGTDLATDISRRTDKTSYSI
FT                   PDDGSPITVSTRRQRDRDEKLSRSQHDSHTSLLIEYFEGGKGSSGIVSRPSVRVRVTPS
FT                   SARKSRDKKDHFQITESSGSGTRKPSYTHRISLPSPSSKQKQLDTGATDDHSLGSNSGE
FT                   EEGHHSSRREPVEIEFVNRGQDSEMSSLSQDTRYINTASEVSSMPPDSMINASSAGPRR
FT                   KRSQSMERGSPTEDKGLLKTPHRQRSRSLSHERIAHRVAEKLTGSPQEASGSKHKSKGS
FT                   KDYLEAETKPSRRRKHRYAEEDIISPESSLLSTSAVSSNHKSDQYSVRSGASKSSINNP
FT                   KLLETVEDAIRRLILPELKELKKDQKVMTNKNKFDRDMATSYSSGTSSRDELGRRLSKH
FT                   ASAPDVMKPKVVLNKDSKDEGIVLSPEAVPRNGERKSSKSSEASDMAVRWANRPEYTEQ
FT                   DKIRRQKSKGLREAHAAGRVGSALTAASLKHHDSNSSLGKQERRRNSGSRKSASRKSTE
FT                   SMNYNETELVFQKHNVAPMPMHSEIDSELTRNSLLSERTASPTPEKQASYFDVARGSPR
FT                   QTMSPASRTPTRNSIDSRYELGMRHGNQSHHNISVHSASERDLHQQSQSPGTDGGNWAI
FT                   AAAAAANLLDAAQPGHRETENDYHHDTGRGLSPIQSIASDHTHTHYNDYSAHGEQHVDG
FT                   KHEIEPQLSIDSLSSAPSTNLARSTRQGTSSHSQSGIFKQHSHESPGLGYEHSRQGSQD
FT                   NGFYGYDQESRRSGDDGDSDVDFMEKVKEGHPVTTGIAANPQFMHPIAVESAVASLMDP
FT                   SVLESQVTSSNRSQTDLAPRSGSRSPEKPGSEVYRGSPLKQRQDAFNADETSFPRRMGA
FT                   TSPPQSVTQSFEDMDDSAMMAAHAPRGMESPRGDDESQESESEINTNPSIIQGPIGGVA
FT                   QADNWGYDSRSPPADHYYDTQIGGSKGLNAEQQIGLDAEYYQTAQNIFGGDDYSAHSGD
FT                   NQPRQLFGTPPGAKDEGYVSAANPMSPSIGTPKQASRGLAGVDAAGMGSFDSPAGADDP
FT                   FASGHERHFSGYSHGVGSPLYDSATGRGIERIQSQDIVALMDHLTVRDAQRNARDTEIL
FT                   VTLVRSAAEMRTSFEQMKKFIADQDDLIMDTSDRGHERTHRALGGPRPLPPSASRNRQL
FT                   NTADEDDKRKSIFKRALKGLSLKSGGDLAKIEGMLEQLLGEVEAMRYGQDGFSPHRMGS
FT                   MEPSGYETPGQNGVSAETSRSPYGSSSSRPANGQRRDSDQRVSTVHEVDEDLELDDRDQ
FT                   FLTSHLPVRDAPRHERSGSLPLDTPPRKPVATTARSTETTPKARKHKSSSSSIFPKISR
FT                   WSKSTATSMGDGIRNSIQPSRKERPTSDESRSGSDLAPHGPYKGDYYDPQGDDRIRSTY
FT                   TLNDEQDENRPPSPLVPSQVSEPPKYRGHRGSLELQHPQPRQGPTARYQSRLETEAQTY
FT                   AGPVSPAGSDQWESNPSLSANNPPQNRNSGVSGVSGATRLSPISDAGYSETSSRANRTP
FT                   GPPRPPKIKDAGPLIPERQPKVADDEEAAYSGDRVVSRNSAIYSPPTRKPTGPRPLTSA
FT                   GSYSPGNIKRTRYRGSPAQIDYEDEQY"
FT   CDS_pept        join(complement(783216..783786),complement(782415..783136),
FT                   complement(781843..782358))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942504"
FT                   /orf_name="Pc22g03430"
FT                   /product="Pc22g03430 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP97631.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00018325B8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRD2"
FT                   /transl_table=1
FT                   /translation="MPGPVDTAKSINKRKRKHGSKAESDVAKPVEAKSSPAVTPKKSAA
FT                   STPKASAEKATKKRKVSPSPSAEEESADEAEAVEDVEEVDAEEGDDAEDTAAVNGTDLP
FT                   TMEDVRLPQTEGRLQKFTELNLSEKTMQGINDMGFTTMTEIQQRTVPPLLAGRDVLGAA
FT                   KTGSGKTLAFLLPAIEMLHALRFKPRNGTGVLVVSPTRELALQIFGVARELMAHHSQTY
FT                   GIVIGGANRRAEAEKLMKGVNLLVATPGRLLDHLQNTQGFVFKNLKTLVIDEADRILEV
FT                   GFEDEIRQIVKILPSEERQTMLFSATQTTKVEDLARISLRPGPLYINVDHSKEHSTVAG
FT                   LEQGYVVCEADKRFLLLFSFLKRNLKKKIIVFFSSCSCVKYHAELLNYIDLPVLELHGK
FT                   QKQQKRTNTFFEFCNAKQGTLICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTA
FT                   RGKEGKGRSLMFLQPSEVGFLKHLKDARVPVVEFEFPASKIVNVQSQLEKLIGQNYYLN
FT                   KSAKDGYRSYLQAYASHSLRTVFDVNKLDLVKIAKGFGFNAPPRIDIQLGSSLSRDKKQ
FT                   EQQGRRTYGSQPKHGAGLKFKRKHND"
FT   CDS_pept        787285..789525
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168830" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942505"
FT                   /orf_name="Pc22g03440"
FT                   /product="Pc22g03440 protein"
FT                   /protein_id="CAP97632.1"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="UniParc:UPI00018325B9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRD3"
FT                   /transl_table=1
FT                   /translation="MRLISLLTCFVAFLAPLASAVKLLESNALTVCMESSNFTATYFSV
FT                   TFYPGNNSLMVGFDGVSYIEGKVVAEMTLTAYGYEAYKNTLNPCSIAGMGMCPMSAGPM
FT                   DLGPLSLDLPEGTSDKIPGIAYTVPDLDANVRIVIKTLETNEKIACVEASLSNGKTVNQ
FT                   AGVSWTTAVISGLGLAASAITSGLGHSNTAAHVAANALSLFGFMQSQAMIGMTSVHMPP
FT                   IVEAWTQNFQWSMGIIRVGFIQKIATWYQRATGGTPSTIMSQLEDTSVEVLKRRKRDLV
FT                   DPAMNLLKRATGPIIKRATGMVKRAEGGQKLLVIRGIERVGFRAHIEQTNIFLTGLIFF
FT                   AVFTCIVIIIVTAFKGITELLVKHGKMKSERFQDFRNGWKVVLRGILFRLTLIGLPQMS
FT                   VLCLWEFTQRDSPAEVVLAAVMILSMLVSLGWASQKVIRLAKRSVTMHKNPAYILYSDP
FT                   SCLNKWGFLYVQYRATAYYFVVPFLIYTLIKGMFIGLSQPAPVVQTVALVILELAMLVA
FT                   VCILRPWMDKKTNVFNISIAAVNFLNSIFLLVFSDVFDPPGMMIGVMGVIFFVYNAVFA
FT                   LVLLILVLIASVYAVVSKNPDTRYQPMRDDRGSFIKSQTQLTTELDALGATARGDVKPG
FT                   QYNNNPFDDDTASISSGNGATVGRQMESTYPPHGSAAQAPRSPVDPSVPLFPSNVSGHH
FT                   NPPPGYDQFGRSPSPAGRSFDNNSPVGQSALATHYRAQNNASPWQRGAGYDH"
FT   sig_peptide     787285..787344
FT                   /db_xref="UniProtKB/TrEMBL:B6HRD3 "
FT   mat_peptide     787345..789522
FT                   /db_xref="UniProtKB/TrEMBL:B6HRD3 "
FT   CDS_pept        join(complement(791391..791404),complement(791106..791206),
FT                   complement(790909..791031),complement(790362..790681))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127374"
FT                   /orf_name="Pc22g03450"
FT                   /product="Pc22g03450 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97633.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR013085"
FT                   /db_xref="UniParc:UPI00018325BA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRD4"
FT                   /transl_table=1
FT                   /translation="MPKYNDYCDVYLTHDSMSVRKAHNSGRNHLRNVVDYYQQIGQEKA
FT                   QSVIDSITSSYAAEGQQAPNMMPPGAFPPPFGFPAPGAHGLPFPPPFPNAAGTPPTGGF
FT                   PPPLPNMPQGANLPIPPPGGFPNFPIPPPGAPGFPPMPAQPGMAPGGPSPIPTGPRGME
FT                   GYPPPPGGGPPGGPPGGMDQRW"
FT   CDS_pept        join(complement(793279..793519),complement(792218..793224))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168609" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127375"
FT                   /orf_name="Pc22g03460"
FT                   /product="Pc22g03460 protein"
FT                   /protein_id="CAP97634.1"
FT                   /db_xref="UniParc:UPI00018325BB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRQ4"
FT                   /transl_table=1
FT                   /translation="MPLPGKRGQGLWRGRGTGRWRAPVSRWPAPPLGNVIVTIQYDEIE
FT                   GLGPDEDDTASRIKNSQYLTSYNWLGGEKSRIIVPGEPPKWTPLPDGPTLRQDSAEYYR
FT                   DRNAAKYPAHPMEPMVKAILTDKPEFPLTSVDIVGCNNTLGNLLGFVLGQDRPFRMLVE
FT                   VLGSTVFFIRRENSPTEIYPNNGYGHTFPEAYTTWNAGVGGSQSHQRVMEYEFAGMQCL
FT                   VRFEADGFLPDLVPDTEGTEGQPVTQDESADPGEALLSIEEISISGVSSATTETALKQL
FT                   EIARQGQRIPQCAIFDLKTRARSKRNRNTLRQELPRLWLTQTPNFILAHHTAGQFQNIR
FT                   VQNVQDDVKEWEEAQQPALSRFASLLQMIMAFARGGENGNFEIEHKEGTQVLNLRKQGG
FT                   VVNGVLSPAVASKWDM"
FT   CDS_pept        join(794050..794181,794436..794852)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        795506..796228
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976287"
FT                   /orf_name="Pc22g03480"
FT                   /product="Pc22g03480 protein"
FT                   /protein_id="CAP97636.1"
FT                   /db_xref="UniParc:UPI00018325BC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRQ5"
FT                   /transl_table=1
FT                   /translation="MATTIPTTEINKLAAGAKILMLGTEMLVFLSAGDLMASPITPSGT
FT                   PQISVPLNELPDHLSTRTFVFEDPKALEAYFCNTVSARPKATKFRLVPMHQFINNPLPT
FT                   LSMDGSSGEGWTRHSPDQPPEVREFFKAMPFPYPSLEFVSIDQITYPEGREFSTLNSDW
FT                   RAACRAVPKGHKVEEITFDLAGSMKLNSSYVSRLVQLVSTILAVKAAGPFRCRLRDDEP
FT                   YQYKDRVTGALANNGVSG"
FT   CDS_pept        799041..799529
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192786" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942506"
FT                   /orf_name="Pc22g03490"
FT                   /product="Pc22g03490 protein"
FT                   /protein_id="CAP97637.1"
FT                   /db_xref="InterPro:IPR022024"
FT                   /db_xref="UniParc:UPI00018325BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRQ6"
FT                   /transl_table=1
FT                   /translation="MSTSNYRLVEPHPSVPNAGRPAVYTGRGGCGNIVNLKNTKTTDSR
FT                   SATGPASLARLDSRVPTAFISGRGGAGNVHSSSERAIFSFDEELERDLRQAAPVYHVGR
FT                   GGAGNTMYRDDYSTSSLSRKYSAASTATNSSSGSVADRARDMARRGLEKGWGKLKGTA"
FT   CDS_pept        join(complement(801694..802461),complement(801316..801630),
FT                   complement(801200..801262))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233340" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976288"
FT                   /orf_name="Pc22g03500"
FT                   /product="Pc22g03500 protein"
FT                   /protein_id="CAP97638.1"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniParc:UPI00018325BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRQ7"
FT                   /transl_table=1
FT                   /translation="MAEATLHNVPIVIDNGSGTIRAGFAGEEIPSCYFPSFVGRPKHPR
FT                   VMAGGLEGDSFIGSRAQELRGLLKIRYPLEHGIVTNWEDMESIWHYVYENELKTLPEEH
FT                   PVLLTEPPLNPRANRDIAAQLMFEAFNVPALYMSIQAVLSLYASGRTTGVVLDSGDGVS
FT                   HAVPVFEGFAIPNSIRRIDVAGRDVTEQMQLLLRKAGHVLHTSAEKEVVRMIKEKVCYV
FT                   SLDPKREEKEWMNSYHKSDAKAMDYALPDGHKIKIGQERYRAPEILFDPELIGLEYPGV
FT                   HQIVQDAITRTDLDLRKSLYLNIVLSGGSTLCKNFPDRLMREIKKLAVEDMKIRISAPA
FT                   ERKYTTWIGGSILAGLSTFRKMWVSADEWHEDPEVIHKRFA"
FT   CDS_pept        join(complement(803425..803719),complement(803222..803360),
FT                   complement(803059..803166))
FT                   /pseudo
FT                   /gene_family="HOG000192807" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(803997..804558,804616..805211)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823069"
FT                   /orf_name="Pc22g03520"
FT                   /product="Pc22g03520 protein"
FT                   /protein_id="CAP97640.1"
FT                   /db_xref="InterPro:IPR019349"
FT                   /db_xref="UniParc:UPI00018325BF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRQ8"
FT                   /transl_table=1
FT                   /translation="MASAARLLTRPAGNLARRGLMAPSARYFSASPLNRVQDDPVIPPP
FT                   PKELRPEDFPPMPEYSVDLLTKEQRSMYDMMSPEERAAFDEENTRMVAEFNDPRKRAAA
FT                   FEELEQSILKIDKEEDLRFEEIRPRRPGFWAEDEPDELVNILEDGDEEINDDEITSMAH
FT                   AEMELHREMREYARITAWDMPMLSKLAKPFTLPPQTHILRFRYTTYMGEQHPAEPKVVV
FT                   ELASQDLTPKYLTEAQRQTFLKLAGTRYNPQTDIIRMSSEKFGSRAQNKRYLADVVNSM
FT                   IKEAKEGDSFADIPLDLRHHKQKTRLQFPESWNMTEARRNQLAARRRERLAAEETRAAL
FT                   VDGNSIVSDAIKALPSLNPALQAKAADERERVAVKVGARKKVARR"
FT   CDS_pept        join(complement(807377..807811),complement(807251..807347),
FT                   complement(806106..807193))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670311"
FT                   /orf_name="Pc22g03530"
FT                   /product="Pc22g03530 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP97641.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI00018325C0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRQ9"
FT                   /transl_table=1
FT                   /translation="MATPGRPQFFCTRPDGTLTPLVAVDELPTNVTIRGVSRTLNAGET
FT                   QGMTSCGLANRRPEPWSVDGVTRSSERDGDKKESVPDMHSLLLQVLTNKNVPDHMRASA
FT                   QAILFQGVEGSNRLAGQGTPTNGLSPTAPSFYAKGHHGNKHCKFLTLSTQAPSSKKEYC
FT                   SYWIRHGECDYSQQGCLYKHEMPDEKHLIEKLGLRDIPRWYREKHNVKSLLHPNQNRPQ
FT                   LAIADQPPMRALPSPASPTNEGGASKMPTTHANSKLDKSPPRGPANRGGHSSFGSYNQH
FT                   RGGRTGAAHGHHGNTWKGTHRGGRNRNMASIRQGISSDSERSSEWSPGMESAPATYEYG
FT                   SHGFGGNQVCTPTPPAAVPASVPITVSAIGHVSAPMAAHQSLLDDGNFHRNAYWKLNEL
FT                   TECNEDMFEDASNKPVDAHHHVQPHAIYQHSSNPSSDGGVMLPREPAVAYDSNFGAFTR
FT                   VDMPSRKVSESSGSHATVQMNYGPSTPRIGDLQVTENVPLNSADTRVTWGPIGGPILKR
FT                   TSPPAEHIAHLFGPYSNNQHGN"
FT   CDS_pept        join(complement(811291..811495),complement(810420..811216),
FT                   complement(809362..810369))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127376"
FT                   /orf_name="Pc22g03540"
FT                   /product="Pc22g03540 protein"
FT                   /protein_id="CAP97642.1"
FT                   /db_xref="UniParc:UPI00018325C1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRR0"
FT                   /transl_table=1
FT                   /translation="MDPPKEHHQRMHRLEHVFAEMKQDPTATPQVMSKTTQEFEESDIS
FT                   KSILQPRTADALVKMPDDDDDEQAKESFIKTDKPDLDLAPGLEDQKTATGVDQKPCSED
FT                   IDMPLAPKIDPTDPPTKVEKSDPDLAADLEDQKAAIGVKEDPSCEDTEMPLAPTINPTG
FT                   PLIKVEKPDRDLAAIPEDQKAATVVDQKPSREDSDMPLAPAIEPAELSIKDEKPDPERN
FT                   AAARTKQEPSYEDTEMPLPLKIDPNELTASFDHSDSKCSLTPFDSQDLLKETRTPSSPE
FT                   SSDTKPQGQLCLVCFKQWEKQLESGERLVDCQIAHGSSTNCDQCLLKHSGCETLPYYLT
FT                   RDLLQLKRKVDNALMVGEASEEKKRFYDAYQNVSGEVHRPSVRSSAPCVQLNLQNTDRE
FT                   DSYSRRYYRKNAGKIKAKNRKYQRKNADKIRAKRREYERKNADRIKARLREWRRKNADK
FT                   IKARKREWRRKNADKIKANNREYYRENADRIKANNREYQRENADRIKARNREYQRENAD
FT                   RIKARNREYQRENADRIKARNREYQRKNADRISASIQEWRRKNADRVSASKREWHRKNA
FT                   DRVNARQRERRRKNAGKTKPRIQERERKMKDNQLIQKSDDQVKQEDRVKQEDRLKQEDR
FT                   LKQEDRLKQEDRLKQEDRLKQEDRLKQEDQLSNS"
FT   CDS_pept        join(complement(816587..816805),complement(812823..816519),
FT                   complement(812181..812629))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192830" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823070"
FT                   /orf_name="Pc22g03550"
FT                   /product="Pc22g03550 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP97643.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniParc:UPI0001832696"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRR1"
FT                   /transl_table=1
FT                   /translation="MAPQGSEDALQPVQQVTGNSEEPTKSFEILVPVVNNPEDYEYLPG
FT                   HFEVHRILAVDMHEPKLIVRLKSGERQTMTLNKLKSLKNGREALREFNRDSQSPDPLAM
FT                   DHRPISHIYSGVDGPADYDSDMDWGIARRRQRRGPSIRYDHFFRSEDEDNGDHQSDDGD
FT                   SSSVHVEDSDESSDDDEDDPPTRRRHLRRGVKKGKRRAREWSEESSASDTGKVKRTSSR
FT                   LRKTRRRNMKERLEDDEYSEAEPEKPKQQKFSGAKEQFRELPDDNEFRLCHSQSCAQCG
FT                   YEDHDLEKGPLIFCQGCTVSYHQVCLGDRSSRKHLATKVGDGDFILQCSRCLGIKHQEH
FT                   DMRPHLGHCAVCREEGPMSQPLRETLSSQVEQQLREANDGVDPITHVDMARVNNVDNVL
FT                   IRCLGGNHSCKRAFHIQHLPNTEGKDRADIDPDDWQCNECSESPPGSNPIHVIVAWRPK
FT                   NFEVEVVPQLVEMIPEIDKEYLIKWHGMSYFRVTWLTGDWVSSKAPASQMKAFLKSDRS
FT                   TKPIMTTVEAVPEDNLRVDIIFDVEYHTEPESKEDRARPEMVKRAYVKFKGLPYEDSVW
FT                   EDPPSQTDAARWEDFQIALVDRVLREDIHPLRPKDLRSNLQVVRENEFDESLMLDSQPE
FT                   LVTGGELMEYQLDGVNWLLYMFFKQKNAILADDMGLGKTIQVLTLFSALIERLQCFPFL
FT                   VVVPNATVPNWRREIKSWSPEVRVVTYYGSAFSREIAQDYEMFHENGTLCCHVVIASYE
FT                   SMCDDGAKRVLASINWAGLVVDEGQRLKNDKTQLYERLRRMKFGFKLLLTGTPLQNNIR
FT                   ELFNLVQFIDPTYNAEKLEAQYAGTLDKDAIRELHDMIRPCLLRRTKAEVLPFLPPMVQ
FT                   IIIPISMSVVQKKLYRSILKKNPQLIKAICKKQTGALKKAERHNLNNILIQLRKCLCHP
FT                   YIYNRDIEEQTIDPQLSHHRLVEASGKLRLLNLMLPQLRARGHRVLIFSQFLENLDIVE
FT                   DFLAGLELKYRRLDGRMSSREKQKSIDEFNAPDSPFFAFLLSTRSGGVGINLATADTVI
FT                   IMDPDFNPKQDMQALSRAHRIGQKNTVLVFHLVVRASVEEKIMQKGKSKMALDHVLIDR
FT                   IEADQDEEDLESILKHGAQALFNDDDSADISYDFHSIDKLLDRSQAEQAEQVASEGSSN
FT                   QNEQALFNFARVWQKDRGSLEEVEEVEDTPVDVTAWEKILQEREREALEEANRQAEGLG
FT                   RGKRKRGAPRYGNTVVEGLDDDEIPSPDRPGPSKMRKAAADNDYEFQEPDAGEETDSGS
FT                   EAGVVPMGTVYDGGEAEGEMGARAFRRVDSPPPAAPMGTDGAQDGFPSCVACQQRHVPG
FT                   RCPLRLAGVEFCGLCGLAHWGGRRACPHLQSRLQVARIMEALEKSAEDPALVLEAKRYL
FT                   QGILKSVARTAQEKRKKALHSAQAEPQIRLNSPSVGGVSHATFIDLTESAGS"
FT   CDS_pept        817353..819146
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192841" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976289"
FT                   /orf_name="Pc22g03560"
FT                   /product="Pc22g03560 protein"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAP97644.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="UniParc:UPI0001832697"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRR2"
FT                   /transl_table=1
FT                   /translation="MLSTISRKGLSGFSRVTRTSHSTALTIRHASLNSAIGEGIRRDNR
FT                   RGNSLSKREGQYEGQYGARQYERSSTSGFNDRQTNGPRQYGKQKYERSDQSHFSDRRIY
FT                   GARQHEDRKPQRPGLKPTVNRNYGQGEREYGAKKTWPSDSAGRKDYDRRQSPLNDNFSS
FT                   TRQSQKEEKFEFDEDEFIRSGDFRGLPREHQSRFQSRFQSRTQDGPFTQSGRGRPSKDE
FT                   PREKEPARPRAHRVTHSMPERVKDNVKVPDTIPYTTPASEFIYGTGAVEAALRCSRRQL
FT                   YKLYIYQSTEEELTAAKVTIRKLALSKNVAVKMAFAGWDRLMDKMSAGRPHNGCILEAS
FT                   PLPKLPVRSLQAVPSISEEYFRTELAPQTREEAAVNGTDDRIQIHHPSPPPHGTEQRHR
FT                   YPIVLLLDGVVDTGNMGAIIRSSYFLGVDAIVLAGRNSAPLSPITIKSSAGAAENMPIL
FT                   HVKNEVDFIQRSQQNGWRFYAADAPLPGSVQLDHIPADGDQSGAKLPITTAPSVIMMGS
FT                   EATGLSSHIKSHANAIISIPGARQSSILGVESDPARIDSLNVSVAAALLMEKFLRTPIT
FT                   VGEIVKKEKNVEKNMGKEKMW"
FT   CDS_pept        join(821038..821181,821245..822114,822169..822285,
FT                   822343..822378)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942507"
FT                   /orf_name="Pc22g03570"
FT                   /product="Pc22g03570 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97645.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001832698"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRR3"
FT                   /transl_table=1
FT                   /translation="MIPEKQIPTTAFVVEKPGAPFVLQNVILDEVRANEVLVEMKYTGL
FT                   CHTDIVVQQGAIPVGDYPAVLGHEGAGIVRRIGSAVKDKSLQEGDLVFLSFSSCHEESC
FT                   SPCSKGRNGFCDQMTSINFAGARGLTAAESPISFPGGSPIRGQFFGQSSMSKLAVVDER
FT                   SVVKSPPGSGVTVEDMAVLAPLGCGYLTGAGTVFNVLKPTSKSRLAVIGMGAVGVAAML
FT                   AARSSGVETVIAVDIVDAKLELAKSLGASHTLNTKSVSDLTQGLLDILPDGVDCILDTT
FT                   GVVPLLEAAVKALGHEGTLAIVGVARAGSSLNIDPLKLMMGCQRVVGVIEGCANPAVIV
FT                   PQLIDLYKRGKFPVDKLAKIYAPSDFEQAMADLHSGSVIKPVIQWADL"
FT   CDS_pept        join(complement(823646..823987),complement(822667..823584))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167484" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942508"
FT                   /orf_name="Pc22g03580"
FT                   /product="Pc22g03580 protein"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP97646.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI0001832699"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRR4"
FT                   /transl_table=1
FT                   /translation="MTRIKLIANPHYQKSGTKSYLYAMRKYRFTPTKDGPYFLGTTMVQ
FT                   TGRQFTNKPVGGRARLQQVLQKKDAVSDEVGQVGVHDVQNDSMYLAEIGIGTPAQTLNL
FT                   DFDTGSADLWVWSTELSSKILSANKNHRVFDPTKSSTFEEKDGSTWQIKYGDGSFASGT
FT                   VGNDNVTIGGLVVKGQAVGIADILSEQFAQGAGDGLLGLAFSNINTVKPEAVAMPVENM
FT                   ISQADIPKSAELFTAKLGSWRDTDEPDKGESFYTFGYVDQDTVKAAESEIYYTPVDNSQ
FT                   GFWMFDSTSATVNGKSIARAGNKAIADTGTTLALVDDETCQAVYDAIPGAKYDNASQGW
FT                   IFPSNTPADKLPVVSFAVGEKQFVVQKEDLGFAEAKSGYVYGGIQSRGTMTMDILGDTF
FT                   LKAIYAVSDMLFFGVHSCTN"
FT   CDS_pept        join(complement(827968..828078),complement(827816..827842),
FT                   complement(827611..827751),complement(824618..827551),
FT                   complement(824535..824565),complement(824414..824472))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942509"
FT                   /orf_name="Pc22g03590"
FT                   /product="Pc22g03590 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="nucleosome binding"
FT                   /biological_process="ATP-dependent chromatin remodeling "
FT                   /cellular_component="chromatin remodeling complex "
FT                   /protein_id="CAP97647.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016585"
FT                   /db_xref="GO:0031491"
FT                   /db_xref="GO:0043044"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR015194"
FT                   /db_xref="InterPro:IPR015195"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI000183269A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRR5"
FT                   /transl_table=1
FT                   /translation="MAPALASDPVSQADTPMTDTNDDTVPSVPVDSADAQMSRQDTPDY
FT                   TDSDTNPNTTESSVAGDAAADGRRRRSEANHLRKSILGKKHGRLDNTKEDDSIRRFRYL
FT                   LGLTDLFRHFIDTNPNPRIKEIMAEIDRQNAEADEKARKGSKRSGGAGGERRRRTEQEE
FT                   DAELLQDEKQGGDSTTIFRESPAFIHGELRDYQVAGVNWLVSLHENGISGILADEMGLG
FT                   KTLQTISFLGYLRYIRDINGPHLVVVPKSTLDNWKREFAKWTPDIDVLVLQGNKEERQQ
FT                   LINERLVEEEFDVCITSYEMILREKSHLKKFAWEYIIIDEAHRIKNEESSLSQIIRLFN
FT                   SRNRLLITGTPLQNNLHELWALLNFLLPDVFGDSEAFDQWFSNQDSDQDAVVQQLHRVL
FT                   RPFLLRRVKSDVEKSLLPKKELNLYVPMSEMQRRWYQKILEKDIDAVNGAAGKRESKTR
FT                   LLNIVMQLRKCCNHPYLFEGAEPGPPYTTDEHLVFNSGKMVILDKLLKRMQADGSRVLI
FT                   FSQMSRVLDILEDYCCFRDYNYCRIDGTTAHEDRIAAIDDYNKPGSDKFVFLLTTRAGG
FT                   LGINLTSADIVVLFDSDWNPQADLQAMDRAHRIGQTKQVKVFRFITEKAIEEKVLERAA
FT                   QKLRLDQLVIQQGRSGQQASKASSKEDLLGMIQHGAADVFTKGVDATEMAEDEDIETIL
FT                   RKGEERTAELNKKYEALGIDDLQKFSSESAYEWNGKDFTERKKDIGISWINPAKRERKE
FT                   QFYSIDKYYRQALATGGRTADTKPKVPRAPKQITVHDWQFFPPGLHELQEKETAYFHKE
FT                   IGYKAQLPEGPEEELSEREAERDLEQQEIDNAVPLTEEEQAEKARMSEEGFGTWNRRDF
FT                   QQFINGSAKFGRTDYKGIATEVDSKEPDEIKEYAEVFWRRYTEIQDYPKYLRVIDQGEE
FT                   KVRKIDHQRKMLRKKLEMYRVPLQQLKINYTVSTTNKKVYTEDEDRFLLIMLDKYGVEG
FT                   EDLYENIREEIRDSPLFRFDFFMLSRTPVEIGRRCTTLLNTVAKEFEPSEGKGRGRDRD
FT                   EEEEMEEAPPAKKKAKNGAAVSLPAKQAKTTKGESQEVMWIEGPRVCTFPVC"
FT   CDS_pept        828747..829532
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192863" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942510"
FT                   /orf_name="Pc22g03600"
FT                   /product="Pc22g03600 protein"
FT                   /protein_id="CAP97648.1"
FT                   /db_xref="UniParc:UPI000183269B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRR6"
FT                   /transl_table=1
FT                   /translation="MDSMRSLNTSLPSSTPRPQPPEQLLQQFKAAALSVTNLYKNAVCE
FT                   QAQARSLGYQEAIEDLLHFLDRENLGLGDGEGWKVRQWATEKCDGTGSQSSDEDAEVDK
FT                   RDRSATPATARKEKPTPEPIARQPPTSAPVPASKPESTTPSTQLHETPSFATPAVFTFS
FT                   AGPTYPQCQELDMDVQSSDNSSATMQDGAPVSVSVMPRNRPHHRHNNHPRSNARPSPRE
FT                   SPASIGSKRKFTFPDFFDLSGLNNGRDASGGGGKRGRFT"
FT   CDS_pept        join(complement(830212..830290),complement(829957..830138))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076768" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942511"
FT                   /orf_name="Pc22g03610"
FT                   /product="Pc22g03610 protein"
FT                   /protein_id="CAP97649.1"
FT                   /db_xref="UniParc:UPI000183269C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRR7"
FT                   /transl_table=1
FT                   /translation="MDTQPKNAKQALAEDKYDDCLSCRITGSAAFIGLGVYSYYTGMTN
FT                   LRKQEKAIMKGPTRYKMGSRKLGIASISATLVGMGLWRAFN"
FT   CDS_pept        join(830472..830515,830568..830987,831050..831917,
FT                   832164..832460)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192874" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127377"
FT                   /orf_name="Pc22g03620"
FT                   /product="Pc22g03620 protein"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAP97650.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI000183269D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRR8"
FT                   /transl_table=1
FT                   /translation="MSGEIDAVYVYDEQNAPLIEHVYRSRPPSASAILPLYLAHAEPRP
FT                   SLLYIPSASPPVTVFSTVESNLLFLAISEVDTEPLLALEFLHRVIDVLEDFVGAPLLST
FT                   KVQANYNVVAQLLNEMCDGGTVCNTEPNALQEVVEVPGWMGKLLGGIGVPGTSTPALGS
FT                   TNPLKQSLAAASVSQGPAIPWRRPGVRHTSNELYVDIIESLSVTMAPSGRLLSALVSGT
FT                   IAFTAKISGVPDLLLSLSAPGGQHVLGRKIELPVFHPCVRLARWKERPGELSFIPPDGR
FT                   FILAGYEVDLLPIDPDLDEPPSHMEKLFLPAIVDIRKSLGPSGSDFEVRLTLNTNFPGQ
FT                   SSSSRPGATRSGSGASTPSFLGGGGSGSSGPALEEVVVSVPISKSVRHITDMQASRGDA
FT                   QFLPATGLLEWRIPTGKDAGTLTGTATLRCSVSGYPSADDDLEDSTPTPPPQSQSQYNA
FT                   HLPAFFAPSSTSRPTRRTKAQVNASLMPNSASVSFSVRGWLPSGIKVDSLNIDQRRSRG
FT                   LGESVKPYKGVKYLCVSNRGVERRC"
FT   CDS_pept        join(complement(835148..835287),complement(834865..835095),
FT                   complement(833994..834793),complement(833555..833922))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000271515" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942512"
FT                   /orf_name="Pc22g03630"
FT                   /product="Aldehyde dehydrogenase"
FT                   /function="aldehyde dehydrogenase [NAD(P)+] activity "
FT                   /biological_process="cellular aldehyde metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97651.1"
FT                   /db_xref="GO:0004030"
FT                   /db_xref="GO:0006081"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000183269E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRR9"
FT                   /transl_table=1
FT                   /translation="MVDLPEFKATSLDEIPSRVSTARKAFYEHKTRDLEFRLVQLRKLY
FT                   WAIKDNEEAIMEACAQDLNKPRFETNLGESGWLLNDIVFTTRNLRKWAKDEKASDIDLA
FT                   FKFMNPKIRKDPLGTVLVIGAFNFPFQLTLGPAIGAIAAGNTVVIKPSENAPRSAAVMQ
FT                   KIIEASVDPSCYTIIQGGIPETQALLAERWDKIFFTGGATVGRIIAKAAAQHMTPVVLE
FT                   LGGINPAIVSKNANPRLVARRMLWGKLLNAGQVCTSQNYLLVDKSLVSEVVQEFKNAYK
FT                   EFYPQGAKGSPDYARIVNETSFARLKSMLDNTKGKILMGGTMDEKELFIEPTVVQVDSV
FT                   DDSLCSQESFGPFIPILPVENLDEAISLANGVQSTPLGLYPFGNKADVEKIVSCTRSGG
FT                   VSCNDAALHIPTLPFGGVGESGYGAYRGRSSFDVWVHRRPITSSPSWLESILAIRYPPY
FT                   AGKISKFNAASALRPDFDRNGKKLSCGWLRCIFTLGGGSAKAGAARATALAASK"
FT   CDS_pept        complement(836240..838561)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187420" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942513"
FT                   /orf_name="Pc22g03640"
FT                   /product="Pc22g03640 protein"
FT                   /protein_id="CAP97652.1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000183269F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRS0"
FT                   /transl_table=1
FT                   /translation="MPIMDREISDLLRRVEEAEKRATEANKHAAEANKREAEAQRQLTE
FT                   ERLQTRNTTLPEFLDACHVHLFLGLAIQEDPYSSTRGDPANAENKYRPNKIREWTGFPQ
FT                   EQAAIWADLMDVDFVTQRHFVALLVLKEFGKDVRERMLSSELDLGYFERFTVESRVTSI
FT                   IRQLYASPQIRQVFHLKGDVAFENHANTLTAGQSMAEKMESMSLEPKQPRRSDRLVARQ
FT                   SQPDATSQESGKQKQPRPRADQFCVYNVHNRKPKESLPAFIVEYKPPHKLTLAHIMAGL
FT                   SDMEVDQVVRYQKDETPEDICRRVVAAVITQAFSYMITAGLEFGYACTGEAFIFLRVPR
FT                   DDPFTVYYYLSVPREDVGDTTGWTGNPSDDNRLHLTAVGQVLAFTLRALQTPPRGIEWS
FT                   NWATARLEKWKMIHDDLLDEISNLEVPSSEYKPPRTSTSFGRLSPVKTRSKSTAATFAS
FT                   CTPLEALSLSESDDSPDGPNSHTPSRGPRGPRTDSSALPPSSAATKSRGGRGDSSSKGK
FT                   SRQYCTQQCLLGLVTGGKLDQKCPNVLDHGVDRHPISRATLIRLLDRQFFGHDPDPDVE
FT                   MGCESLHIHGTRGALFKVTLLSHGYTFVGKGVPIEFIEHVQHEERMYSRLRPLQGVHVP
FT                   VVLGGLDLRSSIFYDGIAEIVHFMLMGYAGRTLAMITQIEPDRLIRLAEVSLHAIHELG
FT                   VLHSDPIAGNMVYNEDSGRVMFIDFERAQFERRRHPLGSLSPNKKGKQATDACGKNGKD
FT                   PNKRDNFELETRRMRHALLW"
FT   gap             839421..839520
FT                   /estimated_length="unknown"
FT   CDS_pept        join(841190..841211,841295..841365,841420..841491,
FT                   841554..841790)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976290"
FT                   /orf_name="Pc22g03650"
FT                   /product="Pc22g03650 protein"
FT                   /biological_process="transport"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP97653.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="UniParc:UPI00018326A0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRS1"
FT                   /transl_table=1
FT                   /translation="MDVQAVSHDFVQDYNNKFNNPDARSSMDSLYHPESMLIWDGIQHQ
FT                   GTHEIISALTGPNMRTVKTHITSVDATPSANHGVLVVVTGNLTVSDMSQIDDGPGKPLT
FT                   YSATFSLQPIPELKGGFFIHSQIFRAVRS"
FT   CDS_pept        join(complement(843788..843991),complement(843567..843722),
FT                   complement(842615..843510),complement(842187..842547))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000238475" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823071"
FT                   /orf_name="Pc22g03660"
FT                   /product="Isocitrate lyase"
FT                   /function="isocitrate lyase activity"
FT                   /biological_process="carboxylic acid metabolic process "
FT                   /protein_id="CAP97654.1"
FT                   /db_xref="GO:0004451"
FT                   /db_xref="GO:0019752"
FT                   /db_xref="InterPro:IPR000918"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="UniParc:UPI0001832779"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRS2"
FT                   /transl_table=1
FT                   /translation="MGLHEDEDRQYAAEVQAVQSWWKDSRWRYTKRPFTAEQIVAKRGN
FT                   LKIDYPSNVQAKKLWGIVESNFQNKQASFTYGCLEPTMITQMCKFLDTIYVSGWQSSST
FT                   ASSTDEPSPDLADYPMDTVPRKVNQLFMAQLFHDRKQREERVTTPAGQRGNVANVDYLR
FT                   PIIADADTGHGGLTAVMKLTKLFVERGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHIN
FT                   RLVAIRAQADIMGSDLLAIARTDSEAATLITSTIDHRDHAFIVGSTNSSLQPLNDLMVA
FT                   AEQAGKNGAQLQEIEDQWISQAGLKLFSEAVIDTINSGSHANKKSLIDQYLSASKGKSN
FT                   TESRAIAKNLTGVDIYWNWDSPRTREGYYRYKGGTQCAVNRAIAYAPFADLIWMESKLP
FT                   DYNQAKEFADGVHAVWPEQKLAYNLSPSFNWKKAMPRNEQETYIKRLGELGYAWQFITL
FT                   AGLHTTALISHQFAKAYSQNGMRAYGELVQEPEMEQGVDVVTHQKWSGANYVDNMLKMV
FT                   SGGVSSTAAMGKGVTEDQFKN"
FT   CDS_pept        join(complement(848335..848463),complement(848188..848260),
FT                   complement(848005..848126),complement(846208..847949),
FT                   complement(846017..846146))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192885" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823072"
FT                   /orf_name="Pc22g03670"
FT                   /product="Pc22g03670 protein"
FT                   /function="alpha,alpha-trehalase activity"
FT                   /function="calcium ion binding"
FT                   /biological_process="trehalose catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP97655.1"
FT                   /db_xref="GO:0004555"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005993"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011120"
FT                   /db_xref="InterPro:IPR018232"
FT                   /db_xref="UniParc:UPI000183277A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRS3"
FT                   /transl_table=1
FT                   /translation="MSSSDGHTRSGSSSTDPFSNPDVYYGKDDNIKKFKSRRRAFSVGL
FT                   NDYSREDVNQFFGTLPSRRGSHDEASGQPRKFLIEVEETLATLLKQEDTDQNMQITIED
FT                   LGPKVISVGTAASSGHKRVDVRGTYMLSNLLQELTIAKDYGRKHIILDEARLSENPVAR
FT                   LSRLIKNSFWNALTRRIDGSNIEVAGRDPKDWTADPRPRIYIPPGAQTQFEYYEQIAKD
FT                   HPELRLDVQMLPAAITPDYVMGLNDKPGLLALAMEKKPNDSTGETDLVGVPFVVPGGRF
FT                   NELYGWDSYMESLGLLVSDRVDLAKGMVINFCFEIKHYGKILNANRSYYLTRSQPPFLT
FT                   DMALRVYERIKTEPDSKEFLRNSVLAAIKEYNSVWVTAPRLDPESGLSRYRPEGWGVPP
FT                   ETEPSHFVHILTPYAQKHGMTFEEFVRAYNARTIVEPKLDEYFMHDRAVRESGHDTSYR
FT                   LEGVCGNLATVDLNSLLYKYEVDIARIIRVHFNDKLPIPAEFRTPQTQDIETESSAVWD
FT                   RRARKRKQRMDQLLWDQEKGMYFDYDTVKKERQGYETATTFWAMWAGLASPGQAAIMME
FT                   KALPRFEAFGGLVSGTEESRGAVGLDRPNRQWDYPYGWAPQQMLAWTAFLRYGYQEDAE
FT                   RLAYKWVYMITKAFVDFNGVVVEKYDVTRPIDPHRVDAEYGNQGVDFKGAPREGFGWVN
FT                   ASYVYGLEILNAHMRRSLGTITPYETYHKAVVAQDAY"
FT   CDS_pept        join(complement(850078..850107),complement(849793..850027),
FT                   complement(849430..849733),complement(849145..849364))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15942514"
FT                   /orf_name="Pc22g03680"
FT                   /product="Pc22g03680 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97656.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000183277B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRS4"
FT                   /transl_table=1
FT                   /translation="MDSTSLFNVKGKVVLVTGGAKGIGRMISEGYVTNGATVYISSRDA
FT                   KACEQAAKELNALGKGKAHAIPANFYKLEDVKKLAEELGKREDKLHVLVNNSGSNWGAP
FT                   YDEYPSEAFTRVLTLNLHRVFDLTQLVTPLLEKAATPEDPSRIINIGSIDGLRVPSLET
FT                   FAYSSSKAGLHHLSRVLANHLGKRNVTSNTLACGPFESKMMAATLKSFGDTIKAGVPLG
FT                   RIGTPQDVAGACLFLSSRAGSFVNGATITLDGGSAVSAKL"
FT   CDS_pept        850431..851399
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192906" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942515"
FT                   /orf_name="Pc22g03690"
FT                   /product="Pc22g03690 protein"
FT                   /protein_id="CAP97657.1"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="UniParc:UPI000183277C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRS5"
FT                   /transl_table=1
FT                   /translation="MEELLSKHRKEQKDLQGRITQKKKSATKKTRKGVNDECEQLQRDL
FT                   SEKQQAEIAKLNGDPTENLEGLSLEDDQPADDEDLKQDKPAEEPQQAEPTAQSTPEPSS
FT                   ASQPKKPNRQKARLARRAAEQAAQSAAAAEEATTQTNYRGDEQEVMDAVFKKLGLKEIE
FT                   VTPDGHCLYSAVAKQLDESGLGLRPDPSRIILQPATQSRIDTVASPQHDGYRAVRAVTA
FT                   DFIMEHKEDFEAFMEEPLESYTRKIKLTAEWGGQLELQAIARAYGVEINVVQKDGRMEK
FT                   IESGDNDSFDEDEKRKRIIWLAYYRHTYGLGEHYNALVKKS"
FT   CDS_pept        join(complement(852046..852531),complement(851521..851877))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192907" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127378"
FT                   /orf_name="Pc22g03700"
FT                   /product="Pc22g03700 protein"
FT                   /function="thiopurine S-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP97658.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008119"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="UniParc:UPI000183277D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRS6"
FT                   /transl_table=1
FT                   /translation="MQTNIDSKGVQAHLSQYKGDKYVDGWAALWDKGDNLPWDRGFPNP
FT                   ALGDTLVKQRPTIGAPLATDAQGQSYRRKALVPGCGRGVDVLLLASFGFDAYGLEYSAA
FT                   AIEACKKEETDNASWYRVRDQTVGTGKVTWVQGDFFDDAWLQKIGVPLNGFDIIYDYTF
FT                   FCALDPSMRPKWALRQTQLLSPSPAGNLICLEFPRHKDPQSGGPPYSSSSEAYMAHLSH
FT                   PGEEVPYDNGVVKHEPLRAPSKDGLERVAYWKPERTHEIGQGENGVIHDRVSIWRRRN"
FT   CDS_pept        join(853681..854041,854106..855112,855185..855484)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159806" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670312"
FT                   /orf_name="Pc22g03710"
FT                   /product="Pc22g03710 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP97659.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183277E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRS7"
FT                   /transl_table=1
FT                   /translation="MHEKPEPDDIVASSDTGEHPAIITEPKPEVDDNHSLSGTSSNTVD
FT                   EEHDPENPPRLERQLTELGPPVKVARLKRRGLFGQLALVSEVENPKTYTRGMKWFITFV
FT                   VALAGATAPMGSAIFLPSLSQVTKELNTTTTITNLSIALYMLAMSIFPLWWSSFSERLG
FT                   RRTIYLTSFALFVVFNCLCAISDSIAMLVVMRMLSGGASASVQAVGAGTIADLWEPRER
FT                   GRAMGIFYLGPLCGPLFAPIIGGVLAQRWGWRSTMWFLSAFGAVTLIFILFALPETLTV
FT                   QKPVLAELEDEDPAISRPLSRVSSQQVVRSTAKWLKTMKMVFIDPLKIILYLRFLPVLL
FT                   TVYYASVAFGSLYVLNISVEHTFAEAPYNFSTIIVGLLYIPNSLGYMVTSIFGGKWMDS
FT                   IMQREAKKANRYDEKGRLELRPEDRMRENAWLGAFLYPAALIWYGWTAEKGVFWLVPMI
FT                   ANFFFGMGSMLIFSMVTTMLTEFMPKKSSEGVALNNFMRNIFSCVGSVVTAPIINGIGN
FT                   GWLFTILGLVSFASSSVIFLMRVNGPKWRKTLDAEMRT"
FT   CDS_pept        join(858637..858886,858976..859419,859468..862895)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976291"
FT                   /orf_name="Pc22g03720"
FT                   /product="Pc22g03720 protein"
FT                   /protein_id="CAP97660.1"
FT                   /db_xref="UniParc:UPI000183277F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRS8"
FT                   /transl_table=1
FT                   /translation="MTYKYADLPQFSYASVQRQYSTFDYETKSFQFYPVTYSTTDLTEG
FT                   QNQDNKEPTTDEPEKDPASEDPPAAEPSGDDSPPTETTDSAEAAPEAKDEGKDEPAPDA
FT                   ENPDEASKEAAVEDAKPAEDAKPDDGAAPEGEAKPEGEAKPEEEAKPEEEVKPEEEAKP
FT                   EEEAKPEEDPKPEGDPKPEDESKPEGGAAPDDSAEPKEESKPEEDAKPEGKEDAPAGEG
FT                   AKEGDNGNNDEDFPDFDLDVDPEAVAAEKEAAAKAAAEDALENGEDALKADEAPAEEPA
FT                   APEPPAEEPKPEEKPAGKKKKKGKKGKAAKATEEPAPEPEPAAEPEPEPAAEPEPAAEP
FT                   EPAAEPEPAAEPEPAAEPEPAAEPEPAAEPEPAAEPEPAAEPEPAAEPEPTPEPAAEAA
FT                   AEPEPEPAVESTPEPAAETAPVPEAEPEKPADNPPDTPTPEEPAAPEPPAEEPKPEEKP
FT                   AGKKKKKGKKGKTAKAAESEPAPEPAAEPTPEPPAETAAEPVPETTPEPEPATEAAPEP
FT                   EASPAAEEKVPEKTVKEQEPEATPVEETPAAEPEAAAEDKVEAVEPEPVEETPKEAPVE
FT                   ESTPVEPAPEPATEPAPEPAAEPAPEPAAEPAPEPAAEPAAEPAPEPAVEPAAEPAPES
FT                   AAEAPAEPTPEPAAEPAPEPASEPAAEPAPEPATEPAPEPAAEPAPEPAPEPAAEPAPE
FT                   PAAEPAPEPAAEPAPEPAAEPAPEPAAEPAPEPAAEPAPEPAPEPAAEPAPEPAPEPAA
FT                   EPAPEPAAEPAPEPAAEPAPEPAPEPAAEPAPEPAAESAPEPAAEPAPEPAAEPIPEPA
FT                   AEPAPEPAAEPVPEAPEAPRAEEEAATEDAPAATDHVEEPPTPEPAAEAPAPAPVEEAP
FT                   AAETPTEAVAEPEVVPDEAPKEITEETPADQPTPEEPAPVEAVPAETPAAEESPAPPVV
FT                   PEEAPAETPEVDAAAVPAETPTPGEAQPETPPEEPTHEPEAARALPAEDPPAEPVAITA
FT                   SDEVAPDELVPPPADPQPEVEMIDAGPLGESAEAAAARHSRRRRKRSSPIEGERRHSKT
FT                   SSEGRRDQLQRQKSERGILTNRWAKALEEARRQHDEKTQLERKQRALAEERARSGIPAP
FT                   EKLKRSKSSSKEKVREKERAMEPEMDVEVIESRSKRRTSDTPSSQPLERARSTRTSSSK
FT                   QVSTPIPTPKPRAFLRYMTEGKSDTNGPLLRLNATKASPPIERPRRSSTSHSSGSRHGR
FT                   AEHEERQSDGRSSGSRSRREEELPRIERTERAERSERVERTESRRLRRSSTAEHGRSRE
FT                   ERKEREKVREREREKVRERERERERVREHEREREIEGDMEREREKRPEGSSRRSRETRE
FT                   ARHHRRHRREESPPREESKLKSLWRAIAAH"
FT   CDS_pept        join(complement(864534..864727),complement(864150..864468),
FT                   complement(863372..864091))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192931" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943532"
FT                   /orf_name="Pc22g03730"
FT                   /product="Pc22g03730 protein"
FT                   /protein_id="CAP97661.1"
FT                   /db_xref="UniParc:UPI0001832780"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRS9"
FT                   /transl_table=1
FT                   /translation="MVVFVDLDDAFADGSAHLEKPFPLMDPIASDPAELPTSPSSLNKT
FT                   TDEIVNANRNGFSAALSCYPIVKEIARAIDLNTLYALSSTCRQFHVNLAPFRHQLVKET
FT                   LRCENEYIETLAEMLDSGSVLPDSVKSVIRLLSRPSGEQTRMTRGKVSKCARDMVGECR
FT                   RCAKVVCRNCTIKPPSQPALKNRIRRLCRPCGKAPLSSHLSYTTSDPQAPDRWDENSVA
FT                   AVAFARSPCNCEEAVWLCTQCGMALRSNDTTYRRVWTWRTRYSTYLGGGLGTGIGEGCQ
FT                   GVKCGRGESCLAAQEIELEVDCEADEGSGSGSDTSRTASPAPPSFGHEGAGVPTDSHDD
FT                   EEPGYFRQEVIGLGGVVKHKSKKRVNVGACVVEYEDERETGNYLEREEKGLYRGWCGWC
FT                   SRVIPAKIEQT"
FT   CDS_pept        join(865480..865644,865709..865727,865794..866143,
FT                   866204..867481)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943533"
FT                   /orf_name="Pc22g03740"
FT                   /product="Pc22g03740 protein"
FT                   /function="gamma-glutamyltransferase activity"
FT                   /protein_id="CAP97662.1"
FT                   /db_xref="GO:0003840"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="UniParc:UPI0001832781"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRT0"
FT                   /transl_table=1
FT                   /translation="MPLNAKAVYARSNADYVPFPSRRSTVHSTKGIVSCTQPLAAAAGH
FT                   KILSQGGNAADAAVAVAAGLNMTEPGSTGIGGDMFCLFYNAKTKKVHALNGSGRYPGNA
FT                   SLEKIRKDLGLAPGEPGKMPMLNALSVTTPGAAAGWVDTVEKFGSGKLSLEQILQPAIE
FT                   LGEEGFPVSELSSRLWNGSEQNIRNASPNFREMLKVDPSAKDGVRPPLPGEIMKNPTLA
FT                   KTFRAIASEGKKGFYQGRIAESIVKVVQDQGGYLSLEDLAYHAEIGTQEVDAISLKFTG
FT                   QDIVSKCTPGTDGEANQGVELWEHPPNGQGIVALMALGIMEELEKSGKIPKFTEAQHNS
FT                   AEYLHAVIESLRIAFADAAWWVTDPDVERVPSQGLLDPAYLAERAKLFTPERAADIMDH
FT                   GSPAHNHCDTVYFAVTDGEGNGISFINSNYEGFGTAIIPAGCGFTLQNRGANFSLQEGH
FT                   PDVLAPNKRPYHTIIPALITNVADGSLHSVYGVMGGFMQPQGHVQVLLNMLAFGYHPQA
FT                   ALDSPRFCLAAPTDESTDRTVLVEEGISDAAVEGLRRLGHKIEVLTGWKRAMFGRGQII
FT                   RSYHDDGKLVYAAGSDLRGDGMAFPLL"
FT   CDS_pept        join(complement(870597..870737),complement(870411..870544),
FT                   complement(869825..870356),complement(869663..869773))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192942" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943534"
FT                   /orf_name="Pc22g03750"
FT                   /product="Pc22g03750 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP97663.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001832782"
FT                   /db_xref="UniProtKB/TrEMBL:B6HRT1"
FT                   /transl_table=1
FT                   /translation="MGRKNNIRPSSPADANVPVTYTPTTRRISKAKKGKRVHACQYPAC
FT                   GKVFTRAEHRRRHELNHNPEASYRCSTQGCKKAFHRADLLVRHMERHELESQSEQSSWA
FT                   SNKQNPIVNESGVPRCMSMDHGMPLTATSHTHSMSIGSLVAPGIHPDLANNDCSLMWSG
FT                   VDLPLQPRPAFHSQLPESVDDSPFYSSPADTCPSPLSDATFSLPSHSSSISSASVSVLD
FT                   QYPKSILNGEVTSSPLQMHTPLRWDADAGVPSSHLVPMSMGENMIQPPVQCHYPSPSWS
FT                   SADCLPYEDQVHSMHQFQPVSWGM"
FT   CDS_pept        join(871947..871979,872202..872280,872781..872936,
FT                   873037..873139,873566..873604,873720..873845,
FT                   874099..874166,874482..874535,874692..874756,
FT                   875152..875227,875459..875603,875738..875833,
FT                   875913..875925,875970..876074,877639..877722,
FT                   878127..878186,878303..878368,878460..878522)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943535"
FT                   /orf_name="Pc22g03760"
FT                   /product="Putative uncharacterized protein Pc22g03760 "
FT                   /protein_id="CAP97664.1"
FT                   /db_xref="UniParc:UPI0001832783"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS63"
FT                   /transl_table=1
FT                   /translation="MGRISGRTGDPGETDTPNSGHRPQKVSVRPGETIRWNDKSRALGG
FT                   WLWGGSGIGSRTIHHLQSAILRVLPQILRIHDENLDLDCKAFLQDTHNASTLVYTSQDR
FT                   VWSMTDRLVRLGSESGLSLGAGLDDVDADLDIDTDVDGKTDKPCAYNSNGCMKSMKKCI
FT                   GVRVVINIQRVRELDWCPRSTWAHPRVDPGLFEYTPSKGWLSIEEGGGKVADKADGDNP
FT                   LSVWALPAKALNLSNIAQSVHSGYTVIPALRILRYDLLDLPRFQGPSLVMSEPFVFPAG
FT                   SPALTKANHPAQVDTAYLQGSLKRLTEFTEYGDSNLPMLPVPGVLPHTDSDRKLPLKKK
FT                   RKARESRKNFGVYANGVNPLHAKVTFQIAPSIRPCHVPTFCKADFEPEDDRVTIVRLGG
FT                   LEIGMASWVLVALQTVLIVAGLALHGAMWLLSPAQAVPTWTSWLATIGAGHLAVVIHVV
FT                   LLFWVWWYNQRGRPNWFA"
FT   CDS_pept        join(878895..879043,879087..879180,879266..879487,
FT                   879616..879741)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670570"
FT                   /orf_name="Pc22g03770"
FT                   /product="Putative uncharacterized protein Pc22g03770 "
FT                   /protein_id="CAP97665.1"
FT                   /db_xref="UniParc:UPI0001832784"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS64"
FT                   /transl_table=1
FT                   /translation="MPPKRGEAANGPQTPAKTAECTDNTPNTPAASHGVHAKLLEYTDP
FT                   AETGRTSGSTLKITCIRDADSSVVKRCCHAHDKCKLGPRFELHALLEWVMEFWINEESE
FT                   FGQTDDASLVHDIEKVHAAAVAVRDLSAGVDRLIKFHGSAHNLVGELGGSAFRLRLVPV
FT                   AMVLRTPSASNSSIVLANTVVLISILTLVCLGI"
FT   CDS_pept        join(complement(881726..882062),complement(881169..881662),
FT                   complement(881095..881115))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192953" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823339"
FT                   /orf_name="Pc22g03780"
FT                   /product="Pc22g03780 protein"
FT                   /protein_id="CAP97666.1"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="UniParc:UPI0001832785"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS65"
FT                   /transl_table=1
FT                   /translation="MLFHTQGALVVSGVLMAATSAVATDFKVLPRGSPLGTLQGCYSSI
FT                   PGYGKSTSWTYQSSGWCLDHCAKDSDYAAFALTGGSDCVCGNTLPPASAKVSNDKCSKS
FT                   CSGWPDDMCGGPGFYSVYTTGLEDDVPTYSDSESTTTKSSTDSKTTTKTDGSASTTSST
FT                   SGETTETVTPEASAKASDEDMKAEAAKSKNTAAIAAGVVVGVVGFAALCGAAFFWWRSK
FT                   KNKAGAAGGATGGYGRTSGPPSMSDSRFDGDYMAQRRQSNGSIDDDHDFSRRILQVTNP
FT                   DR"
FT   mat_peptide     join(complement(881726..881993),complement(881169..881662),
FT                   complement(881098..881115))
FT                   /db_xref="UniProtKB/TrEMBL:B6HS65 "
FT   sig_peptide     complement(881994..882062)
FT                   /db_xref="UniProtKB/TrEMBL:B6HS65 "
FT   CDS_pept        join(882064..882203,882311..882477,882572..882670,
FT                   882767..882778,882823..882905)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943536"
FT                   /orf_name="Pc22g03790"
FT                   /product="Putative uncharacterized protein Pc22g03790 "
FT                   /protein_id="CAP97667.1"
FT                   /db_xref="UniParc:UPI0001832786"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS66"
FT                   /transl_table=1
FT                   /translation="MCWESREVEYRKQRGKKTPLDSVAGVIDEGLGTACVTLKNFSLNV
FT                   CRSERKVIVVLTGTRVCGRVEVYPSTIRERVSDRELRSSSADDPQIKGVNERRNRVVGV
FT                   VFPRGGMRYLKYGGEALVHPSTGYFPRRSFTGTRPDTAADGVLGHAASLLWAPSGDDET
FT                   LIV"
FT   CDS_pept        join(complement(885761..885795),complement(885548..885621),
FT                   complement(885093..885508))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943537"
FT                   /orf_name="Pc22g03800"
FT                   /product="Putative uncharacterized protein Pc22g03800 "
FT                   /protein_id="CAP97668.1"
FT                   /db_xref="UniParc:UPI0001832857"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS67"
FT                   /transl_table=1
FT                   /translation="MAPRIWCGWLLQHSHSLSCQRGLRHKQSLSAWNESEATSKPATVR
FT                   TKPITTAAMTITTLEPPRCPTCYEHGIRQIVNGNNPNGNAGRPYYICDLCDRFICFDDQ
FT                   RGISPANPRCRCGRYTRRQIAGTEKEVPHGIHYVCARGWCSFYSEEVDQDGVQRRVPAR
FT                   LVGTCSGYSYI"
FT   mat_peptide     join(complement(885548..885608),complement(885096..885508))
FT                   /db_xref="UniProtKB/TrEMBL:B6HS67 "
FT   sig_peptide     join(complement(885761..885795),complement(885609..885621))
FT                   /db_xref="UniProtKB/TrEMBL:B6HS67 "
FT   CDS_pept        join(complement(887393..887441),complement(887281..887338),
FT                   complement(887187..887224),complement(886881..887062),
FT                   complement(886455..886823))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229371" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943538"
FT                   /orf_name="Pc22g03810"
FT                   /product="Pc22g03810 protein"
FT                   /function="CDP-diacylglycerol-serine O-
FT                   phosphatidyltransferase activity"
FT                   /biological_process="CDP-diacylglycerol metabolic process "
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP97669.1"
FT                   /db_xref="GO:0003882"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046341"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="InterPro:IPR016271"
FT                   /db_xref="UniParc:UPI0001832858"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS68"
FT                   /transl_table=1
FT                   /translation="MASSDSSSGVPPSSDGGQEKQKMLLSSDHGHFSMVKALHLADLIT
FT                   EMNVMSVFSSMRYCLGDPTEYGAIWAALAFMPFGLFFDFMDGKVARWRKKSSLMGQELD
FT                   SLADLISFGLAPAAAAFALGIRTSLDHVFLSFFVLCGLTRLARFNVTVAVLPKDKTGKS
FT                   KYFEGTPIPTTLSIAAIMAYWVSQSWTHENIPLGLFAEGTIFEFHPVVLMFVLHGCMMV
FT                   SKTIHIPKP"
FT   CDS_pept        join(complement(888760..888778),complement(888712..888732),
FT                   complement(888596..888643),complement(888439..888539),
FT                   complement(888229..888374),complement(887923..888175))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943539"
FT                   /orf_name="Pc22g03820"
FT                   /product="Pc22g03820 protein"
FT                   /function="pseudouridine synthase activity"
FT                   /function="snoRNA binding"
FT                   /cellular_component="box H/ACA snoRNP complex"
FT                   /protein_id="CAP97670.1"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0030515"
FT                   /db_xref="GO:0031429"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR021154"
FT                   /db_xref="UniParc:UPI0001832859"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS69"
FT                   /transl_table=1
FT                   /translation="MSFRGRGFGGGRGGRGGFQQSFGPPAQVLELGSVMHSCEGEMVCE
FT                   SVNPKIPYFNAPIYLENKTQIGKVDEILGPINQVYFTVKPQDGIVATSFKAGDKVYIGG
FT                   DKLLPLEKFLPKPKPPPGAAKPKRAGGAAARGRGGFGAPRGRGGRGGAPRGRGGFGGGR
FT                   GGGGFSRGGGGGGFSRGRGAPRGGGGFRGRGY"
FT   CDS_pept        join(889000..889568,889630..889894,889954..891345)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000003878" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943540"
FT                   /orf_name="Pc22g03830"
FT                   /product="Pc22g03830 protein"
FT                   /function="ATP binding"
FT                   /function="threonine-tRNA ligase activity"
FT                   /biological_process="threonyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP97671.1"
FT                   /db_xref="GO:0004829"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006435"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniParc:UPI000183285A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS70"
FT                   /transl_table=1
FT                   /translation="MASEPPQELPVRPAAEAQAKNASEAATAPPKDANAKSKQAPSPDT
FT                   LPEFIIERNKLFEELWQQYLEETRTRPHPEINVTLDIGDGNPPSSVPAKAFETTPGSFL
FT                   RDVPKDLSANIVIAKVNGELWDLNRPLEKDCSVLLVPFSNPEARETFFHSSAHVLGLAS
FT                   ECEYGCLLSHGPPTPQGFFYDMAMPDGRVVREADWKALDIRASRSFKEKQSFDRLEVSK
FT                   ENLKKMFAYSKYKLHYIDKLVTGESSTVYRNGTLVDLCRGPHIQNTGKIKAFKIMQNSS
FT                   AYFLGDQSNDSLQRIRGVAFPDKKLMAEHLKFLEEAEKRNHLRIGKEQELFFFDEASPG
FT                   CPFLLPNGTKIFNQLQSLLRSEYRKRGYQEVQTPNMYDVGVWKTSGHWAHYKDDMFKLD
FT                   VEKREWALKPMNCPGHFILFGHRERSYRELPMRIADFGVLHRNEASGALSGLTRCRKFQ
FT                   QDDCHVVLASHQIMSEVEGLFDFLQSIYGLFGFTFKLKLSTRPEKYMGALETWDHAEDQ
FT                   LKKALTKFKGDDWTINEGDGAFYGPKIDITIADAIQREFQCATIQLDYQAPINFKMEYM
FT                   TKEQSQAEQPKEGETKGDELAPGRARPVVIHRAIIGSFERFLGILIEHFGGKWPFWISP
FT                   RQILIVPVMPAVNDYAEELQKILQGDKLSVDIDISGNTMQKKIRTGQLAQYNFIFVVGA
FT                   SERETRSVNVRNRDDPATQKQGVMVPLEEVRIKLKALRKERRLENAL"
FT   CDS_pept        join(893121..894425,894479..894752,894854..896001)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943541"
FT                   /orf_name="Pc22g03840"
FT                   /product="Pc22g03840 protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP97672.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000183285B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS71"
FT                   /transl_table=1
FT                   /translation="MPKGRKSFPCPRAKSVGCKKKFSSRRYAITHAQRVHDNIAWPCPR
FT                   AEELDCDKTFGSKSDAKEHAKREHDQTKSPCPLAEEEGCTLQFCNKQSAEKHAENIHGD
FT                   QGTRPKFPCPQAEAANCKKKFASISSANKHARQVHDQVKWPCPMAEEKGCRMEFSTKGA
FT                   ASVHAERAHGPKRESKGFPCPRADEVNCKRRFTTKQNANRHADQAHKKTKWPCPSAEEV
FT                   GCTLQFTDQHNAKRHAKSAHGDNYKPTRKEFPCPRAQDEKCVKLFSSPDSARTHSKMAH
FT                   GKAESDETFIAAWPMISPPSPLRDVDGNIIPGWDKLPNPFFLEDRRTWACPHPGCTTTY
FT                   LTNVGVKYHYLAIHLNARWPCASAKTLGCNRMFSSIYDAKKHADEHFPRCKWICTYDRC
FT                   LAQMQGRKMSRVTALTHYNAHLRRGQFQKGEYKLEKVFAAVSDGNTEAEDNHIELQNSE
FT                   DEEDGDGDRESSSQDGHDDDHDDDDDHDEVDNPDTEPGIILPDDIGPSTELAATWLDGL
FT                   HRKQDSLRKGPGRVLDGQVLGTQVCPKSTVISLETGVLYKTRIGTKYHIGLKTRCAPCN
FT                   GRFMFDEFLRKNLLEKNPDQTICCHESCVGSLWESSKLCMKHFLEWTPELLEEDIDAMN
FT                   DLRELAHRATSERWHPQTILTARAITMRKCGEANVPASQIVTIDLETNMHSREVLQVGI
FT                   VDSKGAVVLDCLTRYSEGVTAPSVSSSSGPATWRQRQWESKVRHYTTVNGTLDAKGVVR
FT                   KLRANGIDKDTIFVAWATWPLDLNYLRLWLEDEKFEDILPGDENVCMLMSEFRANFKSM
FT                   LGTTCYRGRAFPLSLPVLFVVFFGNTHDLAGRNHHALYDAQQTALLMTLFEDLCRHPHE
FT                   RVFFKGCGATNMGSRKRQISIEESLASMSIPKRVRHH"
FT   CDS_pept        join(complement(897777..898275),complement(896913..897696))
FT                   /pseudo
FT                   /gene_family="HOG000171132" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(898613..898726,898836..899401)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(900706..900818,900901..901033,901088..901154,
FT                   901207..901521,901578..902218)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943542"
FT                   /orf_name="Pc22g03870"
FT                   /product="Pc22g03870 protein"
FT                   /function="ATP binding"
FT                   /function="MAP kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP97675.1"
FT                   /db_xref="GO:0004707"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008351"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000183285C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS72"
FT                   /transl_table=1
FT                   /translation="MADLQGRKVFKVFNQDFIVSEQYNVTKELGQGAYGIVCAATNIQT
FT                   GEGVAVKKVTNVFSKKILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYE
FT                   ELMECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCEL
FT                   KICDFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAEL
FT                   LGGRPFFKGRDYVDQLNQILHYLGTPNEETLARIGSPRAQEYVRNLPFMPKVAFKQLFP
FT                   QANPDALDLLDRMLAFDPSSRISVEEALEHPYLHIWHDASDEPNCPTTFDFHFEVVDEV
FT                   PEMRKMILDEVIRFRATVRQQSQAHAAQQQQIAQQTNIPIPDNHQGPWKTEDPRPQEAT
FT                   AGGGYNPNDLESSLQRGMDVHHR"
FT   CDS_pept        join(903840..903867,903945..904324)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823340"
FT                   /orf_name="Pc22g03880"
FT                   /product="Putative uncharacterized protein Pc22g03880 "
FT                   /protein_id="CAP97676.1"
FT                   /db_xref="UniParc:UPI000183285D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS73"
FT                   /transl_table=1
FT                   /translation="MEDVTPSATYSDESKALEKREEEAYEAAKVIRKEMSFQSNNKLHA
FT                   SKHTTAAVDDTTVAYSQPSGCGGGCLTTRFAHYEVRQAPIAKPDMAYETWRCASTVVGL
FT                   TTQQKLLVACLDTSCVMAIIDADLPTVTPVS"
FT   CDS_pept        join(complement(905526..906582),complement(904961..905346))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823341"
FT                   /orf_name="Pc22g03890"
FT                   /product="Pc22g03890 protein"
FT                   /function="copper ion binding"
FT                   /function="nitrite reductase (NO-forming) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97677.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0050421"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001287"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI000183285E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS74"
FT                   /transl_table=1
FT                   /translation="MDTTTGEEASGLDTTLVPRGNETAQSHSQPYVAPGQGLIDSSKLP
FT                   IEEAVLTEAPSVPPPITRNHPVLLQVPLTTSTKTKQLTSQHKYEQWNFNGIVPGPFIRA
FT                   RVGDVVELSLTNRDKAGNPHNIDCHAFIGPGGGSALTTAEEGQTKTARFRLHYPGLYLY
FT                   HCAAAPVPVHIANGMYGLMYVEPATGDLPPADREYYVMQSEFYHEPPEIEDNGKPSSIV
FT                   EFSYPNALREEPSVVVFNGHEAALTRDKPLKASVGEKVRIFFGNAGPNLTSSFHVIGSA
FT                   FEKVYRDGDVVSPPGQFVQTVSVPPGGSTVVDMKMLVPGTYTLVDHAIFRLEKGGVGYL
FT                   NVTGEPRPDIYHIQKPKLASGLYVSDRPFLWFKTDDTNFSSLQHTSATHFSSLSFEQHP
FT                   VPTIAGGKCAMTLTSPSSIKYLAKAKWLCLTAYRRTTAMCNLGPTGENTSTFRTPRLPL
FT                   YATWKSAFFEVTLIFPVGRNEE"
FT   CDS_pept        join(complement(910439..910589),complement(910073..910308),
FT                   complement(908563..910018),complement(908246..908478))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192964" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976545"
FT                   /orf_name="Pc22g03900"
FT                   /product="Pc22g03900 protein"
FT                   /protein_id="CAP97678.1"
FT                   /db_xref="UniParc:UPI000183285F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS75"
FT                   /transl_table=1
FT                   /translation="MSTIPQGPVEARSLSSVTTIASNPPAYPRNPTHEKHEPLSLYIVR
FT                   VPGSKDIFLSPLKPPTKSSVSAEAINASLYYLHVATPDDDTLLQEVEEEREEEAQLRKE
FT                   RLAKAGVDDPAQREFARLNNVRRKPDATAPPALPLRPTPALQDEIASPALPPRPIPMPQ
FT                   DDAAQDATAPPALPPRPVPMPQVTAENVSFSGTPVANMQPPLTNNTSGGVSVESGGKSG
FT                   VSRRPLPPLPPGEESWTNSAAGEDPSKRTSRWSAFTEQLQNRGENWRGKYEAKYEAFAA
FT                   GRHSLDSNGPQLRPRSSHNRTGSPLGSPGQSPNRHRNEHDDPRSNAGFHITLIRRDPTS
FT                   GTQWNVATISTPRMDRNAVDIEISTPGYNRFAGSNEMPSLSSLAANLPTGIGRLPNSAI
FT                   VQSLAAEQPKEQPTGPRKFHRQLCVSKPFDDSVATDSSNGHNPDGPSSSKLKSGYYVFT
FT                   SPWNGTCTFTNSVNGRSLKCKHMIPTPGGFIPPNGEAEAPPAVTVAELRFNTPFQAANL
FT                   HSHAHHAIHKPHPNHLSPFTQSQIQTPSLSRPNDNPNDNNPSPEGGPLHPSSSNNSFAA
FT                   AKRNSLSQFLNPNAYARPRAHTGPGSTPPHPASPPADSRSQPHSHRSTSNSSGGDLDYD
FT                   SDEDRLDLSLARENAGGGLRGKSAKLGKLVIEDEGIKMLDLVVAACMAVWWRGYYY"
FT   CDS_pept        911069..912007
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217097" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127632"
FT                   /orf_name="Pc22g03910"
FT                   /product="Putative uncharacterized protein Pc22g03910 "
FT                   /protein_id="CAP97679.1"
FT                   /db_xref="InterPro:IPR022085"
FT                   /db_xref="UniParc:UPI0001832860"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS76"
FT                   /transl_table=1
FT                   /translation="MTTIFDIPGSNSPNAFSTPIQALLTLSKHSSTPAPDETATNIVNS
FT                   VASSSDPAHALWELWDAFFTAVATSSTSHEPLLALLDALHAQPPTQLSIRARAKAERQR
FT                   NSYIGADGNLHWQTLPQFSAQWRDVHDVLEAWRDWDGVRDSGAGGSWTVSTVGSSGGEY
FT                   FLRFCVFSAALLKSTKGKDKAYPIWVFYACRDVLERERPQFCPPKAHRMSSEQVWALDV
FT                   RVAAIWMRDGGPALWEADYEGLRQHWAAALDEKTELWPREEGLTRERWLFWGNRLRALS
FT                   TEGTLDKETVAVVIEAAEVVSLLVGGSNLGY"
FT   CDS_pept        join(complement(913477..913500),complement(912908..913393),
FT                   complement(912266..912844))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192975" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943543"
FT                   /orf_name="Pc22g03920"
FT                   /product="Pc22g03920 protein"
FT                   /protein_id="CAP97680.1"
FT                   /db_xref="InterPro:IPR019325"
FT                   /db_xref="UniParc:UPI0001832861"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS77"
FT                   /transl_table=1
FT                   /translation="MSSQRYSRVNAQDEEEGLHSYPLNARPEHNTSSPSSYRSGSRSSS
FT                   PSSRRLLHTDPQHNDDEQTLADAFGDEDESDDDNEPDDRQRLMRADPDFRAPPDNGPSA
FT                   TASSSESRGDSPERTQSGTFRRPTMLPTFTAPASGGSRQIASSNDGVFANLAAKPERGE
FT                   KNDDLPPSYEEAAADATPPYWETTIVAPGISSDEVYVDGLPVGSVFSFVWNAMISMSFQ
FT                   LVGFLLTYLLHTTHAAKNGSRAGLGLTLVQYGFYMKGGNESSGSDGGGSEYVPPPDPNS
FT                   HNFDPNSVGEGGGNGGNGTMSGITTSEWISYILMIVGWFILIRAVSDFLRARRHEQLVL
FT                   QSPDRGLGVPVIAEGERSETVV"
FT   CDS_pept        join(913765..913779,913875..914219)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192986" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670571"
FT                   /orf_name="Pc22g03930"
FT                   /product="Pc22g03930 protein"
FT                   /protein_id="CAP97681.1"
FT                   /db_xref="UniParc:UPI0001832862"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS78"
FT                   /transl_table=1
FT                   /translation="MSKAPTLNPRSLQSRLNHILKHWPSDAVRPASVSVQNYIQSRLQP
FT                   ADKSSPAISESSTNALESLLNNRYARKYPMPEKLRRPASNPDHYDNVVREFAEAPNRDW
FT                   LGRLRKRLAGIIRLT"
FT   CDS_pept        join(complement(916172..916234),complement(914916..916095),
FT                   complement(914547..914860))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000221244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976546"
FT                   /orf_name="Pc22g03940"
FT                   /product="Pc22g03940 protein"
FT                   /function="CoA-transferase activity"
FT                   /biological_process="ketone body catabolic process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAP97682.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0008410"
FT                   /db_xref="GO:0046952"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="UniParc:UPI0001832863"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS79"
FT                   /transl_table=1
FT                   /translation="MPSQVATCLRLARQFSANPVQHQRFMARAFSSSVRRSEINKVYPS
FT                   AEVAVKDMKSNSTLLAGGFGLSGVPDSLINAVLANPSITGLTVASNNAGVDGAGLGLLL
FT                   KSKQIKKMIASYVGENKTFERMYLTGEIELELSPQGTLAERCRSGGAGIPAFYTPAAFG
FT                   TVVQTGAVPLRHNADGTVAKYSEARDTKVFDGKSYVMEEAIKGDYAFVKAWKADKLGNC
FT                   QFRYAAANFNGAMGRNAKMTIVEAEHIVEPGEIEPAAIHLPGIYVKRVIQSTTPKNIEK
FT                   FTFAKEEGADTSALGKGETANKRERIVRRAAKEFKNGMYANLGIGMPMLAPSFVDPSVE
FT                   VTLQSENGILGLGPYPKQGQEDPDLINAGKETVTLKPGASCFGSDESFGMIRSGRIDLT
FT                   ILGAMQVSAKGDLANWMLPGKIKGFGGAMDLVSNPSATKVVVTMEHTDKKGNPKIVKNC
FT                   EFPLTGPACVSRIITDLCVFDVDFTHGLTLIEIADGVTVEEVQAKTEAPFKVADDLKPM
FT                   L"
FT   CDS_pept        join(complement(921542..921563),complement(920705..921462),
FT                   complement(920426..920630),complement(920326..920371),
FT                   complement(919875..920269),complement(919727..919815),
FT                   complement(919129..919666),complement(918416..919067),
FT                   complement(917944..918364),complement(917686..917881),
FT                   complement(917094..917626))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216594" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943544"
FT                   /orf_name="Pc22g03950"
FT                   /product="Pc22g03950 protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAP97683.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI0001832864"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS80"
FT                   /transl_table=1
FT                   /translation="MASVQKAGKTAPRLIHDVQLYDAAHEPDTGRNLLSVTPPIYPEGY
FT                   NGPPGFISPEACRHNYVLKEDQTFMSEPEHRRRPGTSSKVSAICAKCRYHLQVVVNYTS
FT                   HISTFSQKQGKHLHHLVYQSGRQKNGLALPEVTPKGQVAETYHYQCSYISCSAMVSLRI
FT                   LSPILSPESIRLLTDKDLLRKRAEEATATYPESMEGMGDPQPINVLDNLRLYITNALRN
FT                   PQRSKPISSVNKRFMHSFGVEGAASKELLEFLEFMYNKDTGWHPPKPTTNAEKPYQDTM
FT                   RLFLDDLLHELLVLIHLRSVSERKGFQIPNLPSSAIPTISCALEAQDYPEAMRYKEFEM
FT                   PHAPFYEDLGVMEDMSSSAVVEAYDRQVLTDPGRTPMYLSALKAIGFLRGGQDKEFIDV
FT                   AVQAAYEQGKYAVDDVVNAYQYFNLHFDDPNLTEDSIIGKFYAFVSSTTQDTEARQQLW
FT                   RIGDSRGSSRIKAASEDRVSTVEQANVFLGVENQTPDDFVMTMYTAKVNDNPLTKELAK
FT                   RAVALIAESRKSVALNHFINTGEMIAGEMDIGDAYRLLQIPDRTVDDGAIIAAYTICVD
FT                   ENPGDAEKYNQALTIIAKQLDSSTLRNMAGISNEPDRSMQDWPVGLQNIGNTCYLNSLL
FT                   QFYFSVRPFRELVLDYERFQMDLNDEESLAKKQVGSRKVTKKEVERSQRFLSELRTLFR
FT                   SMISSSEISVTPGQELARLTLISPSNEAAIRRRSTITATRPEILGDINGAPILGPLGPP
FT                   QTLLGGQMEPVSSSSQVDPAPIQNSTVSDDGSDATLVSDNSMNDAPGLFVEDKENNPPD
FT                   LDQLSDQAEAGSPQDMNIDTDDTASANVPPALPPRNVPQVDREKQLKEEVEIGAQQDVT
FT                   EVINNVLFQSQCAIQPREIGDDGEQLDQVKDLFYGQTRSYISTEKGTRSKNERWCDIKV
FT                   DVAHGSRNIYDAIDGAFDIQKISVDNSVAEQFASISQLPPVLQIQVQRVQFDPVKKCSF
FT                   KSTNHLGLLETIYMDRYMDTKNPDIVDRRNQCWEWKASLKRLEARREELLRTKEGAGVD
FT                   VATLFRRVKTALQDLDSIENDTETGTGTELESDSMDAVASTELLDKLECLANKAETDLQ
FT                   AVDREIKDTQTMISSQFADFHQLPYRLYAVFVHHGSVSFGHYYIYIFDFDKNIWRKYND
FT                   EYVTEVQNVDEIFKNDSTNNPPTPYFLVYVNDSMKDRLANPVCRVISDNMSELPDLEQA
FT                   TTMEGVQPTSPAPDVNMEPPSYEEASAINGTPGTENTKSDMENTAWPRPRPATDSEQYW
FT                   "
FT   CDS_pept        join(922053..922236,922295..922414,922480..922674,
FT                   922730..922824)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216595" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127633"
FT                   /orf_name="Pc22g03960"
FT                   /product="Pc22g03960 protein"
FT                   /function="protein transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP97684.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="UniParc:UPI0001832937"
FT                   /db_xref="UniProtKB/TrEMBL:B6HS81"
FT                   /transl_table=1
FT                   /translation="MAHHGEDHSYHPKDAISAAMKATALTGSVGLFAAAVQNTLTKQNV
FT                   GTLGVFVRGGGTITTFAAMGGTYEFIKTASANLREKEDHYNVALGGFFSGAILGLRVRT
FT                   LPAVLGYGIALSSAMTAFEYTGGTLFGYQKDTSVDEFDRRTALRKAFQTPGEQTISEVG
FT                   EGRGIYGPGYEERRRERLKANYGIEVPTSPVPAS"
FT   CDS_pept        join(925518..926040,926101..926588,926642..926979,
FT                   927034..928150)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943545"
FT                   /orf_name="Pc22g03970"
FT                   /product="Pc22g03970 protein"
FT                   /protein_id="CAP97685.1"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI0001832938"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSL1"
FT                   /transl_table=1
FT                   /translation="MAMAARPQTPSQDAYMVPHPNDPGALSRGYGPRSTLSRPNSFAGT
FT                   SAYYSSGALESSQVPHNPRFKEDFDTASHRSSVFDGPAGVQRSASTMSHVRSPTPSRSG
FT                   TLRKKASLSKKGSLRRNGSRRSMRAGSVRSLSLGDREKYHTEGSDDLSSAFVTPVPTNG
FT                   NPTEVLANRFGAWRKLLKDLILFFKEVQKSYETRAKLFLSASSVVNNQTLPPGLLQSGG
FT                   LADATEILQNFHRQGYTEANKAVEVEVEVISQLTGLRSDLQKKTKEIKSLSGDFKNTVN
FT                   KEIDGTRRSVRNLHEALGLVDTDASATSGKGDPFILRLHVEKQVEKQIEEENYLHRAFL
FT                   NLENSGRELEGIVVSEIQKAYNAYASILRREANEALDTVEKLQAGPISMPQDHEWNQFV
FT                   ADTDELVDPRIPLRDVESITYLGKGHPAAAEVRAGMLERKSKYLKSYTPGWYVLSPTHL
FT                   HEFKSADRVAWQTPVMSLYLPEQKLGSHSQEDSSSHKFMLKGRQTGAMHRGHSWVFRAE
FT                   SHETMMSWYEDIEGLSNMTGEARNAFVRQHVRSVSGRSMNNEVMEDDEADRTPYSAGSA
FT                   VMAQDRPTSSRQAGGAFPSDVQLDRNLQGTLSPSSGDSSAGRDMLGATGSFPDGSSAVD
FT                   DNLRPVASREGDSSYQSYGSNEGANEKTRPKVTQHDSYYGDWIGPSVIVAKQRQSQQLE
FT                   NSNQDDREIRSDGDQASLAAIAGVGIADRRDHSAPAQIDRRESVSTAPTNTNATEFTNN
FT                   TNPTSVDDQELELPKTQTHGLGNGSINQGPESDSAAKIPSDLLRSNTDNTVALDMKMPG
FT                   RYPRTNVAA"
FT   CDS_pept        join(complement(929073..929148),complement(928876..928910),
FT                   complement(928556..928840))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670572"
FT                   /orf_name="Pc22g03980"
FT                   /product="Putative uncharacterized protein Pc22g03980 "
FT                   /protein_id="CAP97686.1"
FT                   /db_xref="UniParc:UPI0001832939"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSL2"
FT                   /transl_table=1
FT                   /translation="MIPGSMERGGKKIECSTKKKGGEMRNLNCIHLYIAIMIYIPSFIP
FT                   KAKDNNPNYDLCTALMYIYVRRRSSRADHTEPYRSYRASQQPARQHTVGICTHDWLHSV
FT                   FQLLNCHGLYPFEDYVNSMFHLNHIHL"
FT   CDS_pept        join(929919..930297,930431..930527,930595..930688,
FT                   930747..930881,930949..931000,931094..931545,
FT                   931601..931754,931814..931953)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670573"
FT                   /orf_name="Pc22g03990"
FT                   /product="Pc22g03990 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP97687.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000183293A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSL3"
FT                   /transl_table=1
FT                   /translation="MSDHIQRERSRSPRRRSSRSPPRRTRRSYSPRSRSRSRGERDEYR
FT                   RSERRSRSPLSASGAAAGPPGSGSPFGGRSGYPPARFEDRTVAKENMMQTVRDSSQQDR
FT                   RVYVGNLSYDVKWHHLKDFMRQGGRLYVEGLVPSISPDFRGLCRVDGWTLAVLILIVEY
FT                   ATRDQAQNAVNTLSNQSLMGRLVYVREDRESEPRFVGGPPRGDFGPGARGGFGGGFGGP
FT                   PGAGGVRQIYVSNLPFNVGWQDLKDLFRSAAQQGAVIRADVHTDPTGRPKGSGIVAFES
FT                   PDDARNAIAQFNGYDWQGRALEVREDRFAGGGPGFGGRGGFGGGFGGRGGFGGPMGRGG
FT                   FAGRGGFGGGFPGRGGFGGPPGGHGGYPGGFDGAPPVPSGPPNPFTDYATSNGEKSAVI
FT                   YVRNLPWSTCNEDLIDLFSTIGKVERAEIQYEPNGRSRGTGVVQFDTPDTAETAIAKFS
FT                   GYQYGGRPLGITFVKYMNAGPAPEEMMEGQESAVGLTQDQIM"
FT   CDS_pept        join(932882..933421,933547..933879)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216597" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943546"
FT                   /orf_name="Pc22g04000"
FT                   /product="Pc22g04000 protein"
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /protein_id="CAP97688.1"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniParc:UPI000183293B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSL4"
FT                   /transl_table=1
FT                   /translation="MAYLTRTLPKRVFTPSLPQSIRQTRAITITTLQPTPTRPTQTTRT
FT                   SKPRQLPQRTYHSALHARLPDHSYTNSQTAILTSALAHVPAHGFTATALTLGARDAGFL
FT                   DVSVQLLPRAEFDLILFWLASRRGLLRGQVEEGGLFRRIAAEKGKDIHELSVEERVRGL
FT                   ILERLRMNAEVKGVWQDALAQMSLLANIPLSLTELHALASDILTLSGDDAVDATWYTRR
FT                   LAVSAIYASAEVVMTRDPTPDLVETEAFVERRFEDRKVIADKLIGIGQCAGFGWNTAIG
FT                   LGRSWGLKI"
FT   CDS_pept        join(complement(936775..936811),complement(936613..936705),
FT                   complement(936134..936484),complement(935976..936076),
FT                   complement(935764..935920),complement(934260..935713))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216600" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943547"
FT                   /orf_name="Pc22g04010"
FT                   /product="Pc22g04010 protein"
FT                   /protein_id="CAP97689.1"
FT                   /db_xref="InterPro:IPR018556"
FT                   /db_xref="UniParc:UPI000183293C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSL5"
FT                   /transl_table=1
FT                   /translation="MEPEVSETEFWTELQTIVSKPCDSEDQIDDALRAYLNLTTQHKDE
FT                   YLRSETDIARCSYKLFTSSIFATHADYVRRQIFYGLLQDDDPNTLHFIASFILFDGRQN
FT                   EVVLQMLNEEGAFARLLELIQAMRRADLDGDAGLHRLLMDLVYEMSRIQRVKIEDLVLV
FT                   DDDFIRCLFDIIEDLSYDVTDPYHYPVIRVLLVLNEQFMISAHDPVDGRPTGQLTNKVI
FT                   KVLSMYGGMYKTFGENIILLINREAETSLQLLTLKLLYLIFTTPSTYEYFFTNDLHVLV
FT                   DILIRNLLDLPEEASALRHTYLRVLYPLLAHTQLRHPPHYKRDGLRRLLSVLVRGQVSY
FT                   GNDPEHEKIMHFEEVDETTRRLVARCSTVDWLRNAEQTDAAESQDTPTQVTATTIDTVL
FT                   DQGEQHASPVDIGEPLDAPRTLSRASTIASSPDTTSPTRMDSYGSSNAPGSRKHSLAQR
FT                   LGMNLEPASASSLSVQAVAAQHEKPGIITPSRKDGVPAAAPNGETPIIKPPKVKPEPPK
FT                   SRRWRGRRLAVDEEENHSATSSDGNTIPEGVEVSPTTTFTTNTPPPQTHASDRRGSGSG
FT                   STLAPPGSRPRRAVSNPPPALPPPRRSNYSTPSSSHHRPIAGAGRHGQAPLPPKTRRWG
FT                   RGKPQHGQSDSVESGASSVSPSKEPETAENTALPAQQEQSPEGSVVSDPFSPKSPTILV
FT                   SPSETTADKADAPANGAGNDHAPLSVEEAVQNVSLH"
FT   CDS_pept        join(complement(939778..939876),complement(938780..939723),
FT                   complement(937102..938721),complement(937009..937048))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190373" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943548"
FT                   /orf_name="Pc22g04020"
FT                   /product="Pc22g04020 protein"
FT                   /function="calcium ion binding"
FT                   /function="mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP97690.1"
FT                   /db_xref="GO:0004571"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="UniParc:UPI000183293D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSL6"
FT                   /transl_table=1
FT                   /translation="MFRARRYRVLVIFAAAVVFTFFHFARSRDWSYTPDAQKPENPAVA
FT                   AAIEESRNRVLPDPYRGSTSPPQPEKIISPVGPNSGSKDGGRFKDASDIPVKTPIKDDA
FT                   KDSTKGSTKEPVKEPAQVESTDSLAPPTTANTDSSNGEEIDNGGTGRRAAERPEPGIPT
FT                   AKWRKFPERFPVPAEEVIRLPKEQPKAIPKLQAKFKDESSSDKQERLQRLSVIKAEFTH
FT                   AWKGYKEIAMGHDEVKPLSKELEDPFNGWGATLVDSIDTLWIMQLKDEFSEALDVIKNI
FT                   DFKTSLRADIPMFETTIRYLGGLLGAYDISGHRYPVLLEKAEELAEVLIGAFDTPNRMP
FT                   HLYYRWAPEYAARPHRASSRAGLAEIGSLSLEFTRLAQLTKRDKYYDAIARITNELEKI
FT                   QDSTSIPGLWPLRVNAQGCSKYFKNTPNTPPRDNSPTREQHAASTTESGTTMTRKTYAA
FT                   PTDLESYLKLIPRDTDADIERHSQAANDTRVASEPGIQAREQTTLSADQCNGGLRLPNS
FT                   PRDNEYTMGGMADSTYEYLPKEYLLLGGLNEQYLNMYKKAATAARQTLLFQPMVKGGRD
FT                   IRFMASTTPMTPGKVAEVTPTDLRYEGAHLTCFVGGMFAIGAKAFGIDGDLELAGKLTD
FT                   GCVWAYESTQTGVMPERFRLLPCEKGSACEWDQARFDAGVARYSRVDPGAGHSFRNGET
FT                   SYGQRVDLIAHDPQQGSASGSIPLPMPGSLNPHESDVLAKRDRIALEKRAEASSVASIP
FT                   TASPSGTDLQNRDAPRSSSSPASPHIAEVGKDHLPAGMTSIPSPNYYLRPEAIESVFIM
FT                   YRLTGDESWRRKGWQMFEAISKYTRTELGNAAIHDVTAQKPIHKDTMESFWLSETLKYF
FT                   YLLFSDPTVVDLDKYVLNTEAHPFLRPTA"
FT   mat_peptide     join(complement(939778..939795),complement(938780..939723),
FT                   complement(937102..938721),complement(937012..937048))
FT                   /db_xref="UniProtKB/TrEMBL:B6HSL6 "
FT   sig_peptide     complement(939796..939876)
FT                   /db_xref="UniProtKB/TrEMBL:B6HSL6 "
FT   CDS_pept        join(940179..940428,940813..940933,941009..941048)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943549"
FT                   /orf_name="Pc22g04030"
FT                   /product="Putative uncharacterized protein Pc22g04030 "
FT                   /protein_id="CAP97691.1"
FT                   /db_xref="UniParc:UPI000183293E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSL7"
FT                   /transl_table=1
FT                   /translation="MPRKTGVLGSQDIVGIARRHHFRAYEQGWSTPIIGPGFRTLTLDY
FT                   MQPARVCKLAYHQSTLPLAQMKVLPPSQNVFHRAHLTYSSRTTCGTHSDKAPSLSPSMN
FT                   FSKHLAMFIYVYADIAMKSWCWGISVVNISAF"
FT   CDS_pept        join(complement(943477..944204),complement(941299..943417))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034159" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976547"
FT                   /gene_name="atg9"
FT                   /orf_name="Pc22g04040"
FT                   /product="Autophagy-related protein 9 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasmic vesicle membrane "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="pre-autophagosomal structure membrane "
FT                   /protein_id="CAP97692.1"
FT                   /db_xref="EMBL:ABO31080.1"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0030659"
FT                   /db_xref="GO:0034045"
FT                   /db_xref="InterPro:IPR007241"
FT                   /db_xref="UniParc:UPI000159302D"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7KAM0"
FT                   /transl_table=1
FT                   /translation="MMSSNILSRFLPPTGSPSVYETIRQHDAGSEYSDLEERAGLVIED
FT                   QQEQYSDRELEDALADAQDSEIVSPSTALLNQARSVKAPEERASPSGTRRRKSSRPRWM
FT                   AQESPLGYELDDHDEDVPQSLLVEGHHEDLKPRLPPPPQSHNRSDRRRTPSPGPSSRPT
FT                   EARWNERGVHQQPPPSESGHPIGRWFTGQHPGLANVDPKKKAMWRWANVEDLDNFLKDV
FT                   YVYFLGNGIWSILLTRVLNLLTFAFVVGFSTFLTNCIDYPKVRRSKTLNDILVPQCTAN
FT                   MSGSSTFLLWLFSFFWIGKLFQYLLDIRRLKHLHDFYLYLLGVSDAEVQTISWQEVVSR
FT                   LMALRDSNPSTAAAVSAKHRRFLGSQSKQRMDAHDIANRLMRKENYMIALVNKDILDLT
FT                   LPIPFLKNRQLFSRTMEWNLNLCVMDYVFNEQGQLRTLFLKDTHRRALSDGLRRRFIFA
FT                   GVMNIFVAPFIVVYFMMHYFFRYFNEFKKNPGQIGSRQYTPMAEWKFREFNELWHLFER
FT                   RINMSYPFASRYIDQFPKDKTVQVARFVAFISGALASVLALASVIDPELFLGFEITHDR
FT                   TVLFYLGIFGTVWAFARGLAPEETDVFDPEYALLELIDFTHYFPSGWKGRLHSDDVRKE
FT                   FAILYQMKIVIFLEEILSMIFTPFVLWFSLPKCSDRLIDFFREFTVHVDGVGYLCSFAV
FT                   FDFKKGTNVLSQAGPGRRDPGKQDLRTDYFSTKDGKMLASYYGFLDNYGTTHQATSRRP
FT                   FHPPPTLPTLGSPTAGGFGALPDRPDHLQTRLGPTPGAPFGPQSMIGTSKPRQMGGFDH
FT                   RSPAPSILLDPHHQPSTTGFRAAARIAPQQHQRSRLGRSHHPSTDPIDDEEEPLSQDGH
FT                   DSTTRQSGARTGTSSAGAGTSDSNLGDSWRMNPLSNDEDEGDEGENIDAIAGGGGVLGL
FT                   IQQFQKANTEGRRTNVGI"
FT   CDS_pept        join(946866..949683,949751..950718)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216599" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943550"
FT                   /orf_name="Pc22g04050"
FT                   /product="Pc22g04050 protein"
FT                   /function="GTPase activator activity"
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP97693.1"
FT                   /db_xref="GO:0005096"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="UniParc:UPI000183293F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSL9"
FT                   /transl_table=1
FT                   /translation="MDPENPNAFKRSSMHQALYSRPVERRASKKSSSRDRHGMVYPDSF
FT                   RDTSIRTVTPESHSPANHSPLSEPEHLTGASSSPRNTVRPRPNEPERRRDFNKHSSGAG
FT                   EEDPPAEARSQRARSRTTAAEEQRNDITPSTFKARTRVGSINTASPSQPKLPEDPSSSI
FT                   GFPSIETPKYSSQTVPRHRLSKAAGLVAGGAQNQDSFSSPLSGAEATKILQLMKTTCGR
FT                   MHGILSFRTASTTAWTSGYCAINVATGSLIYQAKGEPALAKTLIPDLRGCRVRTLWDPE
FT                   LQCTYLSVHTFTSGLGIQLRPHVNETFDSWLAALLCWQPIRPKGVQNKMTKPQEVVIGD
FT                   RRIPERRRNSESAAQKDATIIKVGKMLLWDKPSASGAMPVSGRRVSTYRQSRALSSSWQ
FT                   KVSCTLQENGFFKLYTESDVALLACVQLSQLSRCAIQQLDPSVLDDEFCIAIYPQYTAH
FT                   PVSDSNLRPIYLALESRVLFEVWFVLLRAFTIPELYGPVSQGEDPDKTPEAETTDPPST
FT                   KDMFRIERFLSLKIVEAKLFRAREEDTPRSRKASRSHGMPVSSSKASDYYTEVLLDGEI
FT                   RGKTAVKYRTMNPFWREDFLFPDLPPVLSQASILVKTLNPTQRDWTLVANGTYAPNQDV
FT                   SAMNMLDEIEISANDIIFGRVDLRLEELEAGVDIEKWWPILDNQDQAIGEMFMRARMEE
FT                   TVVLMSDEYSAMSELLHSFTNGLTINMAQLMSSELNHLAEMLLNIYQVSGSTVEWISAL
FT                   VEDEIDGVHKESTTNRLRYTTRIHSNNSQETSQEREVLVRDMGRTATVEANLLFRGNSL
FT                   LTKALDLHMRRLGKQYLEETIAERLRDIDESDPECEVDPSRVPRHEDLDRNWRNLTALT
FT                   TSVWNSIAGSASRCPPELRRIFRHVRACADDRYGDFLRSVTYSSVSGFLFLRFFCPAIL
FT                   NPKLFGLLKDHPRPRAQRTLTLIAKALQGLANMTTFGNKEPWMEPMNKFLVAHRSEFKD
FT                   FVDSVCAIPADRPVPVVTPSYTTPIQILGRLPPTSREGFPSLPFLIDYARSFANLIRVW
FT                   LDISPERLNELTELDVSLAKFQKEALRLQARTEECLRRAEQAERPNGNLEIKWEALVDS
FT                   MERPVTFYDESSSKPSTPAPETSTSTAPAPSSHRNSIGYFATRPALPRRSTDHVPDAED
FT                   DTPPSSSSATWDQSRIPFSIPRWSDPRDSTGSSKNSSTYSLENSDSSKARRASVTKESS
FT                   SSKYRFFDFVPAPSRRKAKDRDQNQNHSHEDLRNES"
FT   CDS_pept        join(complement(952701..953235),complement(951829..952639),
FT                   complement(951533..951752))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823342"
FT                   /orf_name="Pc22g04060"
FT                   /product="Pc22g04060 protein"
FT                   /protein_id="CAP97694.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI0001832940"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSM0"
FT                   /transl_table=1
FT                   /translation="MPGKSELSEFEQQRLANIAERDALLKKLTLESQSSGLFASPKTPG
FT                   TNGAKPKKRPTPKVKTEEEAVTPRRTSSRLKGIAAESEVAKRKADDEYEAMREADRLKR
FT                   MRRTDSFSQADMFVSGQKLSADSLIGVDVITKGVAKPYERTFGDDEIEKTTDKDLKALR
FT                   EEMNGLQLWESWDPQRIKITPERVYSMAFHPSESKPLIFAGDKLGHLGMLDASQEKPLA
FT                   GEDDDEDDDDPDPVLTTLKPHTRTISAMMVNPSKPTHLYTASYDSSIRSLDLEKMVSSE
FT                   TYAPESTNIDEALSGVDMAPDDPNTLYWTTLQGGFGRYDTRTPRKDSNVSSWELSEKKI
FT                   GGFTLCPSQPNYFATASLDRFLRLWDLRKLSPDDPTPVAEHESRLSVSHAAFNAAGQIA
FT                   TSSYDDTLKIYDVGAKGLSSWKQGHKLGEKDFVPDTVVRHNCQTGRWVTILRPQWQLNP
FT                   QSPIQRFCIGNMNRFVDVYSSSGDQLAQLGGDGITAVPAVAVFHRSKNWVAGGTASGKL
FT                   CLWK"
FT   CDS_pept        953534..954982
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216598" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670574"
FT                   /orf_name="Pc22g04070"
FT                   /product="Pc22g04070 protein"
FT                   /protein_id="CAP97695.1"
FT                   /db_xref="UniParc:UPI0001832A00"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSM1"
FT                   /transl_table=1
FT                   /translation="MATNITQLCFLSKSTSTAPFLYHTRTLTPLSSAARKQFNRRFLRS
FT                   FSIQTNAEANDATENKASAEDDSQNTSEQSIASSSTSEVAPKPRRSYLQKRAASVSQRP
FT                   SLRPSAVKKTTKTAPKITNQEKMVFGGLLEQLGFKHDGETTEASSLKPMSEEKKAEMAE
FT                   LVSVFNNLLKDPRQKKAALKVKEQQKDDYSSHRRQEKSKTEEQVPAENQGPKRIYLRDL
FT                   GYSEPATASAAEVTVSLRRAIEIVVKSESEHIEFALFQAIEDGKGDLGVWEVCKERIFS
FT                   MLRHLDEQSLEEASNPENLSTTDQSEPHTRSSGPLRVPAVVPVAPVVVSLYPKTLLVAF
FT                   RLLNTHFRDSPLIPQFRPTIKGYGRVSAFLGASSGLYDELIHYHWRVCKDLPAVVSILR
FT                   EMNQLGINPSSKSRGMLTGLIIRQGRDVEAHRKSPSEKTFFWDLPSNKEAFHELTRKDG
FT                   WMDQIEARSEEEAWQRQATRAFPR"
FT   CDS_pept        join(complement(956535..956601),complement(956325..956465),
FT                   complement(955258..956204))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943551"
FT                   /orf_name="Pc22g04080"
FT                   /product="Pc22g04080 protein"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP97696.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001832A01"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSM2"
FT                   /transl_table=1
FT                   /translation="MKRLSKALVGLLLACGVCAKAGVEKQSRGDVAQLPFTKEVVVWVN
FT                   EKGERISTETHYVQALTPALHENVRPAHVLSKNNDDMNDHHIPAKGKPKELQHPHAHPK
FT                   PPVPHPYPHKHPHPHPHAHFGISYSPYKADRTCKNQEEVNQDLDRISEYSFVRIYGTDC
FT                   DQTKTVTNAARRHNMRVFAGVYDLTNFPGSLSAFGDAVTGPDGKKDWSIFHTIAVGNEL
FT                   VNAGTNSAGDVVAAVQKARSVLRAQGYKGPVVTVDTFSVLLDHPELCHVSDYCAANCHA
FT                   FFDATQRPEGAGAYALEQARSISARAGGKRTMITESGWPHAGDANGVAIPSAKNQDAAI
FT                   ASLRKSFDYRREDLVLFTAFDDLWKEDNQFTFNAEKFWGIHRGL"
FT   mat_peptide     join(complement(956535..956544),complement(956325..956465),
FT                   complement(955261..956204))
FT                   /db_xref="UniProtKB/TrEMBL:B6HSM2 "
FT   sig_peptide     complement(956545..956601)
FT                   /db_xref="UniProtKB/TrEMBL:B6HSM2 "
FT   CDS_pept        join(complement(959103..959431),complement(958510..959020),
FT                   complement(957953..958444),complement(957707..957889))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216602" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943552"
FT                   /orf_name="Pc22g04090"
FT                   /product="Pc22g04090 protein"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring nitrogenous
FT                   groups"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP97697.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016769"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001832A02"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSM3"
FT                   /transl_table=1
FT                   /translation="MDLQETQRILSIYLHELADLFHRVPGSAILLRYVKSSYQDDPIRS
FT                   AVELFLFLFAVRYLLAPKYSTKPGVVPLTEDEIDDLVDEWTPEPLVGSPTTLEEMEVDK
FT                   RTVIVGPVGPKSKLANGRTVTNLGSFNFYNFNTNESLKEQAIQTLRAYGVGPCGPRGFY
FT                   GTQDVHMKTEDDVAAFIGTAACIMYSQAFSTISSVIPAFSKRGDIIVADKGVSFAIRKG
FT                   IQISRSIVRWYEHNDMEDLERVLAKVTKEQARKPLTRRFIITEGLFESYGDMADLPKII
FT                   ELRLKYKFRLILDETWSFGVLGRTGRGITEHQNVDAAEVDMIVGSLAGPLVAGGGFCAG
FT                   SEEIVHHQRISAAAYTFSAALPALLSTTASATINILQNNPETVSQLRELTKAMRAQLDP
FT                   RSDWVYCTSAPENPILILVIKPEVVAAKRLTPDDQQFLLQDAVDESLANGVLITRLKTL
FT                   EDNFEPKQVVPAALKVCVTTGLTKKEIEKAGTIIRHAITKVMSKRK"
FT   CDS_pept        join(complement(965703..965854),complement(960327..965642),
FT                   complement(959929..960271))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216604" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670575"
FT                   /orf_name="Pc22g04100"
FT                   /product="Pc22g04100 protein"
FT                   /function="1,3-beta-D-glucan synthase activity "
FT                   /biological_process="1,3-beta-D-glucan biosynthetic process"
FT                   /cellular_component="1,3-beta-D-glucan synthase complex "
FT                   /protein_id="CAP97698.1"
FT                   /db_xref="GO:0000148"
FT                   /db_xref="GO:0003843"
FT                   /db_xref="GO:0006075"
FT                   /db_xref="InterPro:IPR003440"
FT                   /db_xref="UniParc:UPI0001832A03"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSM4"
FT                   /transl_table=1
FT                   /translation="MSGYAGGGHYDDGYGQQGQAHHGHGDSYYQDEHAQGYYDNQGYGD
FT                   GYYDQGNGYYGADGGHGDPHGDAGHGYADGGYYEAGHQDHYYGAGDQYYDQGHGEPRGR
FT                   RGHDSEEDSETFSDFTMRSETARAADMDYYGRGDERYNSYSDSQYGGRGGYRPPSSQIS
FT                   YGANRSSGASTPVYGMDYGNALPAGQRSREPYPAWTSDAQIPLSKEEIEDIFLDLVNKF
FT                   GFQRDSMRNMYDHMMTMLDSRASRMTPNQALLSIHADYIGGHNANYRRWYFAAHLDLDD
FT                   AVGFANMKLGKADRKTRKARKAAAKAAKQNPENEEETLEALEGDNSLEAAEYRWKSRMN
FT                   RMSQHDRARQIALYLLIWGEANQVRFLPECICFIFKCADDYYTSPECQARVEPVEEFTY
FT                   LNEIITPLYQYCRDQGYEIMDGKYVRREHDHNKIIGYDDMNQLFWYPEGIERIGFEDKT
FT                   RLVDVPIAERWPKLKDVQWDKAFFKTYKETRSWFHMITNFNRIWVIHLGSFWFFTAYNA
FT                   PTLYTINYQQQVDNKPPTPKYLAAVGFGGALVSFIQILATIFEWMYVPRRWAGAQHLRK
FT                   RFMFLLLMFIINLAPGIVIFSILPMLGMAKKTEDGIGLALGIVHFVIAVLTAAFFAIQP
FT                   LGALFGNYMKKGGRQYVASQTFTASFPRLQGNDMWMSYGLWVCVFGAKLAESYFFLTLS
FT                   FKDPIRILSPMQIHQCTGAQYIGNKLCHRQPQILLGLMAFMDLTLFFLDSYLWYIICNT
FT                   IFSVARSFYLGVSIWSPWRNIFSRLPKRIYSKVLATTDMEIKYKPKVLISQVWNAIIIS
FT                   MYREHLLAIDHVQKLLYHQVPSEQEGKRTLRAPTFFVSQEDQSFKTEFFPQGSEAERRI
FT                   SFFAQSLSTPMPEPLPVDNMPTFTVLIPHYSEKILLSLREIIREDEPYSRVTLLEYLKQ
FT                   LHPHEWDCFVKDTKILADETSQFNGDYEKPEKDVAKSKVDDLPFYCIGFKSAAPEYTLR
FT                   TRIWASLRSQTLYRTVSGFMNYSRAIKLLYRVENPEVVQMFGGNSEKLERELERMARRK
FT                   FRICVSMQRYAKFSKDERENTEFLLRAYPDLQIAYLDEEPPVNEGEEPRLYSALIDGHC
FT                   ELLENNMRKPKFRIQLSGNPILGDGKSDNQNHAIIFYRGEYIQLIDANQDNYLEECLKI
FT                   RSVLAEFEELTTDNVSPYTPGIASPEETPVAILGAREYIFSESVGVLGDVAASKEQTFG
FT                   TLFARTLAQIGGKLHYGHPDFLNATFMTTRGGVSKAQKGLHLNEDIYAGMNAVLRGGRI
FT                   KHCEYYQCGKGRDLGFGSILNFTTKIGTGMGEQMLSREYYYLGTQLPLDRFLSFYYAHP
FT                   GFHLNNMFIMLSVQMFMVVLINLGALKHETIMCRYNSDLPITDPLVPTLCANLIPVLNW
FT                   VDRCVISIFIVFFISFVPLAVQELTERGVWRMATRLAKHFGSFSFMFEVFVCQIYANAV
FT                   HQNLSFGGARYIGTGRGFATARIPFGVLYSRFAGPSIYLGARLLLMLLFSTTTVWTPAL
FT                   IWFWVSLLALCISPFLFNPHQFAWNDFFIDYRDYIRWLSRGNSRSHASSWIGFCRLSRT
FT                   RITGYKRKLLGVPSEKGSGDVPRARITNIFFSEIIAPLLGVAVTLIPYLYINSRTMYSD
FT                   DVKWAANPILRIAIVAFAPVGINAGVAGMFFGMACCMGPVFSMCCKKFGAVLAAIAHAI
FT                   AVIVFLIIFLAMFFLESLSWARTISGMIAAMALQRFIYKVIISLALTREFKNDQSNIAW
FT                   WTGKWYNMGWHSLSQPGREFLCKITELGYFANDFFLGHILLFAMLPALAIPYVDTFHSV
FT                   ILFWLRPSSQIRPPIYSLKQSKLRKRRVVRFAILYFVMLVIFVVIIAAPVVMRNTGQLD
FT                   SVLKGDLWKSLGVSKTNAVGLLQPLDRGLNDTVSWYTGSNIPKGYSSGSIPAASEGTGV
FT                   WSI"
FT   CDS_pept        join(complement(970136..970171),complement(969986..970040),
FT                   complement(969361..969773))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943553"
FT                   /orf_name="Pc22g04110"
FT                   /product="Putative uncharacterized protein Pc22g04110 "
FT                   /protein_id="CAP97699.1"
FT                   /db_xref="UniParc:UPI0001832A04"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSM5"
FT                   /transl_table=1
FT                   /translation="MYSAHPYLKHNKTNKHQLPFCTYKVPIKIPGAWCSNAVRPELLAA
FT                   GNVPGEGAAQPHSEWTNFRSTLIPDGEATLYRVAVVEVGPLELGPILDRGTLIRAIRRY
FT                   ADEDPCPLASQQIVEIACFTRCKNPESDLGSIYCRPESPIESAIAREVMSFVPAFVDRL
FT                   DITS"
FT   CDS_pept        971194..971949
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823343"
FT                   /orf_name="Pc22g04120"
FT                   /product="Pc22g04120 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP97700.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001832A05"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSM6"
FT                   /transl_table=1
FT                   /translation="MHYYDMAETWEFSDGPKLLYTQVIFQDGDKYFSAQLPEQIACPDD
FT                   IPPTTKSRLKEIPVEHIWPPLEDGLLICHDAEKPGVYIKQPRLTGYDGSESLSLYLLQE
FT                   ARICQILMQNEHQNIARYLGCVVKGGRITGLCFQRYVETLADSLNAGRSFNIKSCLQQI
FT                   QAGIDHLHTLNLIHNDLHLGNIMVTNEDADTFAIIDFDSCAIKGHPLPDKRGKMPEGAC
FT                   TAEIENDDLGFKMLQEELHQGIASTRGLG"
FT   CDS_pept        join(972649..973664,973738..974611)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823344"
FT                   /orf_name="Pc22g04130"
FT                   /product="Pc22g04130 protein"
FT                   /protein_id="CAP97701.1"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniParc:UPI0001832A06"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSM7"
FT                   /transl_table=1
FT                   /translation="MAKLNTANPLVKNTPHKEPVARTVGMSHNSPLCRESHFNFRNTAK
FT                   QNMPTKPQKQSRRQANGSSGSFDIFPDSDSGSESESGQHRSTGKQQRQRTLGLARANSL
FT                   LLPTKRRPRPAIRRETEDYDKENDVPEYAMDGYQTPDLTPTRPNASQIPTRSRMDHIAS
FT                   TQLEIDRQEEQEGNYVSFEEDSSDSLDGFIVSDNDEPSFFDTSDSETADTEDEPSPAPS
FT                   PARSPRKRLIRGRRPISEAESNTTADEEPAMEVTKLSPELDRAIEKSKAVDPVPEDCAP
FT                   NLATSSKSRSPVRKAEVPKSQPLHFGLHNSNDLIQHLEDLELGSDDEPTSQTQPEQPHS
FT                   ESEDELPSDPYTSHTNLPPVTPSRAKPHFFLNPSITSVEDSPGMGIPTTIKAQKKAEAA
FT                   RKREIRAQLAEFNQKKIGFAEEFLRHLDNAFNDQISRMTEATGGIKIVWTKNFRNTAGR
FT                   ATVRSERFLKGAVEEPGKRRYYATIELSEKVLDTEDKILCTVTHEYCHLLDIMVTENRA
FT                   KGTAQHGASFKQWGARCVRALEGHPIYGGRVEVTTKHTYEINHKYIWACKVQGCGFKVG
FT                   RHSKSIDPNRQFCGRCRGSLEQIKPVPRAVAPKRPVVKAMVEEKEKEIVVIDP"
FT   CDS_pept        join(975172..975369,975430..976038)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15943554"
FT                   /orf_name="Pc22g04140"
FT                   /product="Pc22g04140 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97702.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001832A07"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSM8"
FT                   /transl_table=1
FT                   /translation="MAFGYKKVLIIGATSGIGRTLADKVVQNGSNLIVTGRRKEKLDEI
FT                   VQKYGSDKVSAKTFDVMQLEQIPQFASDIVSENPDLDCIFVNSGIQRPFDFSKPETVDL
FT                   DIFDQELITNYTSAVRIAKAFLPHLQSQKTAAAIAFTTSQMALVPMMRCPNYGASKAAL
FT                   HHFILALRTQLQGGPGDVKVLEIYPPAVQTELHDAKHQPDLKDGHLIGMPLQEFVDEVW
FT                   GRISDGEDQIAVGSAMDIYNAFETKRQELYRDMTELLSGLLKQFLR"
FT   sig_peptide     975172..975237
FT                   /db_xref="UniProtKB/TrEMBL:B6HSM8 "
FT   mat_peptide     join(975238..975369,975430..976035)
FT                   /db_xref="UniProtKB/TrEMBL:B6HSM8 "
FT   CDS_pept        complement(976118..977167)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217658" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670576"
FT                   /orf_name="Pc22g04150"
FT                   /product="Pc22g04150 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97703.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001832A08"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSM9"
FT                   /transl_table=1
FT                   /translation="MPPDRSNPVTLQRSCQACIKAKRRCDQGWPRCSRCLGKDINCGYV
FT                   NAPLTVQSTRRPSAGRYVGPKRSIANMTPTPQIQTPLRLEIAKEYDPNIVRFLVVGLRN
FT                   LPVKFAEKRKTLFIHPDLYTKGLPTPIREIHNICRLHMQTHQTGRVSVTLLSMLRQNSA
FT                   DLCRRLSHAATFEELLGCSQALVLNQCMLVLREDGNICPYSEAISVMLARVAVKLWQQA
FT                   PIQLPGTFSPRYAWLLAESVRRTIIVCFMLRSAYSLNTRNYSVRTPFIDSLPFDLRTNL
FT                   WDENSERAWQDALTGSGDSMVSLHEWSDGLVAGRVHDVSCFSGLILAACKGQAVSSIPF
FT                   PPVHSYIDG"
FT   CDS_pept        join(978255..978435,978486..978653,978724..978840,
FT                   978899..979314,979376..979508,979562..980056,
FT                   980106..980279,980330..980656,980704..982301)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217721" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823345"
FT                   /orf_name="Pc22g04160"
FT                   /product="Pc22g04160 protein"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on CH-OH group
FT                   of donors"
FT                   /protein_id="CAP97704.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016614"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="UniParc:UPI0001832A09"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSN0"
FT                   /transl_table=1
FT                   /translation="MSYFTDKTDNYPNLSHSFRSMRPEYDVVIIGSGYGAGVAASRMAR
FT                   AGKSVAVLELGWERRSGSFPHTFSQCVKDMSISGSTAKNSFISKWLKCLSGDPTRLFQV
FT                   FLGDGQHSFAAHGLGGSSLINAGVFLKADEGTLHMSPWPSEIRDEPSILDEYYSRAETM
FT                   LQPSTYPENSTPSKLEHLSKESRWLGEKGNFYRVPLTIFFHNGRNSAGVPMQANRQSGH
FT                   ECTGLNDGSKNSVATTYLADAWNWGAEIFCGCEVQFVEKTDGGGYTIYFAWHGSGRSVF
FT                   TDHFKEQLFWVKAKEFCFLGAGALGTTGVLLRSKQHGLHMSPLVGRNLSGNGDLLIFGY
FT                   NGDANINGIAREYSRAPPGTTVTAVIDRRVVDPLKNPLSGYVIQDGCIPETFNPVIQIM
FT                   LTLQTIKSQALCCLWNPRQEARKTLASLKSLLFGPYAHNGALQRTSTYLVMSHDSNEIT
FT                   LTLKDDQLCLRGPAEGRSEHFKWIKKMFKELFARTGARIGFSYPYGRHQEEVTVHLLGG
FT                   ANMSNDGTGHGGVTNHRGEVFSGPNDEVHKGLVCCDASVIPTALGVNPLATISALSERS
FT                   VSLIAERSGLSIDLETENQPLNAYSKPSVSWDCQPHQNSTKEAPQSIGWQFTEIMHGHI
FT                   RIGSEIGSFAVSERVGKGASCSMRMFLTVEICRRGDLQYQGTCTGTISCYALSKATLKI
FT                   VDGTVDFFTPIQENAESSAISYHLKLLSVEGMEYRLEGHKLIDSKIAFSARKTWEATTT
FT                   VNVNITRPDGTNVGAGALHISLLDFKKQMRTFRNTRDFQISLILALMGFLISFMYHISL
FT                   FFFRPFVPMRFPPISREPSDPQQPPSTSCNITASDGVQVHLAIHDPIPIQKTGDPAPNS
FT                   NLSPVLLLPGVTGIGAMHNLYSLPFLRCNMVEYFSQRGHRCYALTPRWGCDPAVAQKST
FT                   VYDCRLDVAAAIGYIRGKERQKPYVIAHCQGSVALCMGLLDGTIQSNHLLGVTANSVFM
FT                   NQVFGYWNSLKGRTTLLIQFYELLAGDYFPIVNSAKSVLFQRLLDVLLRFYPVGHARDL
FT                   CTSTACHRTSFAFGLLWNHKNLDMGLHENVHQFFAGAHTKFMKQVVCMGTRGICTDNGL
FT                   CPLLTAKNLQRLQGLPILFVSGTENQVFNPESTLKDYELLRRRFGERLYRRFLVEGYGH
FT                   LDPIVGKDAADDVYWRIFGHLRWCTKEMENEMGEGQ"
FT   CDS_pept        join(982465..982555,982630..982913)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000228133" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943555"
FT                   /orf_name="Pc22g04170"
FT                   /product="Pc22g04170 protein"
FT                   /function="nucleic acid binding"
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP97705.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="UniParc:UPI0001832A0A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSN1"
FT                   /transl_table=1
FT                   /translation="MVQFCEDCGHLLPVSSAEQIPCELCGKSTKNTILTDVQISSSTNF
FT                   PSRLRTKLLSKTQVVSQKDLGDGPITDMECPQCSNSKATWTEAQLRSADEGSTIFYCCT
FT                   KCRHRYAASKMPQPLAHRLF"
FT   CDS_pept        join(983275..984096,984149..984382)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127634"
FT                   /orf_name="Pc22g04180"
FT                   /product="Pc22g04180 protein"
FT                   /protein_id="CAP97706.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI0001832A0B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSN2"
FT                   /transl_table=1
FT                   /translation="MSLVYITTEPSDRIHVKGITQTQPDWIHPQLIESTDAIKGRQFRV
FT                   SGPIPKGTCLLVDTPYAVIPVVDEPAHNDNLICSNPACNRPAPRHTRTPCPNACIPDVT
FT                   WCGSTCRDADSLRHEFECAWLKRYAGTIRSKWSEYDFGMLWVILRLLAARHCQLQERTA
FT                   VGVAESTGCWKHGWSGIESLCGSEDTWPHDKVRSWSVLVKKYLRSSPALPHGMSADRVL
FT                   HLICQEEANSFGLYPRETGHFPLPKDPVDRGEQFAAAVYPTAAIANHSCLPNVIHKADD
FT                   KGRMVFTASRDIFPGEECCISYFDLTQYTDLASRREHLRKSFRFVCQCERCVSEEPNES
FT                   AEWTAMPMMDV"
FT   CDS_pept        join(complement(985420..985496),complement(984935..985307),
FT                   complement(984638..984871))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216606" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943556"
FT                   /orf_name="Pc22g04190"
FT                   /product="Pc22g04190 protein"
FT                   /protein_id="CAP97707.1"
FT                   /db_xref="InterPro:IPR007681"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR016124"
FT                   /db_xref="UniParc:UPI0001832ACB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSN3"
FT                   /transl_table=1
FT                   /translation="MPQFTEQEFFGGAIRGVVPQGWIDSSTLREVPDHQELWLSPTTLS
FT                   NLIIEINQRVPQAEALSTFAALDHQQPTTAPGSGSAASATTETVDQAAALYHLHDLCDE
FT                   GDTMQVIKSPARVEVQLASSSPSPATIKAYRGVVSFTTPARGGGGRMNGVSSGLPQVSR
FT                   LTCHFLLVRLEAQETDLLVFFNVPHEEFDKNGDPRGLSLEEVVAEETIGALVGRLQVCD
FT                   WGLFV"
FT   CDS_pept        join(complement(986677..986710),complement(986417..986609),
FT                   complement(986315..986363))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943557"
FT                   /orf_name="Pc22g04200"
FT                   /product="Pc22g04200 protein"
FT                   /biological_process="response to stress"
FT                   /protein_id="CAP97708.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="InterPro:IPR007250"
FT                   /db_xref="UniParc:UPI0001832ACC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSN4"
FT                   /transl_table=1
FT                   /translation="MSDAGRKGFTTKAKEKLTPDSTKSTQDKVKETATDTTDRTTRGLK
FT                   TDDSKGVGQEAFDKTQRASDNHGHGGATGSIGDKVKGAPGLWSPQK"
FT   CDS_pept        join(987575..988717,988770..989390)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943558"
FT                   /orf_name="Pc22g04210"
FT                   /product="Pc22g04210 protein"
FT                   /protein_id="CAP97709.1"
FT                   /db_xref="UniParc:UPI0001832ACD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSN5"
FT                   /transl_table=1
FT                   /translation="MTLSDPPVPSNWDFAPVHHLLCSPIEGCTARPSRHNESTITSLGE
FT                   QQAEGDPRYTTNGRLISLQRSNPKLGDFGSLWELFHGAPAPASVSPTLGTTRTAKSELE
FT                   KVQPLLEELLPSSAERPTRKVSFSGIPCIEDSVPISSDASHAINEPDTRVLKDTTTGYT
FT                   SHYSSRPKAHVTGIPVDFEGRSFTILKRGSVHEPLGTTANVTFGIPPTPPETITRALAG
FT                   DPSDTPTARPKSRSRGKDFRKNTRDNPVTSEESAGLDSDTSIVFDHPVREKPVAIPFVP
FT                   FQVGRFETKTRHYDTPPSSFDDNEWILNTDTIRGFASGGTPVRSLLHQSAAERRVTLMS
FT                   RLLGHFPDYAKVVSQVGQPLHHRPKESTTSRPIHVFVDVSNIMVGFHDSVKTSRNIPLS
FT                   ARIRRVHMSFANLALIMERGRQTAKRVLVGSDRLPCVDEAERLGYEVNILERVQKVKAI
FT                   TPRRNNKSRKNTVSNYQGGYSGPETVAGSGERWVEQGVDEILHLKILESLLDTERPATI
FT                   VLATGDAAVAEFSGGFMKMVERGLQRGWNVELVSFSQGTSYAYRKKEFRTRWRDQFKLV
FT                   ELDRYLEELFE"
FT   CDS_pept        complement(989576..990436)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216608" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670577"
FT                   /orf_name="Pc22g04220"
FT                   /product="Pc22g04220 protein"
FT                   /protein_id="CAP97710.1"
FT                   /db_xref="UniParc:UPI0001832ACE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSN6"
FT                   /transl_table=1
FT                   /translation="MDSPLLSPAKARQAAIQAKDWAYVNSWLNRQYAPKPVPKFERNED
FT                   TLRVLLTLAAANDAADEEATLQHCAREEAVEAYKLREEFERKDPHEQQKNQLLDEVEMC
FT                   LDDTGRRDLEDLADSAAALGNTLNPNPGDLGQSIVELTVEEFEAQEQIGKVDTLHRYLQ
FT                   RELARLQTELEELKTDVAYETPSETQSLTSEWTRGTKTLAIKVGEYQDRIASLEKVQPR
FT                   GPTIEELIAEEENVIKMRETVKALQGRVRAFHDLPKDTPGARAKYKELERELGQLKRQR
FT                   DSMAV"
FT   CDS_pept        join(990616..990906,990973..992928)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048549" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943559"
FT                   /orf_name="Pc22g04230"
FT                   /product="Pc22g04230 protein"
FT                   /protein_id="CAP97711.1"
FT                   /db_xref="InterPro:IPR010490"
FT                   /db_xref="UniParc:UPI0001832ACF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSN7"
FT                   /transl_table=1
FT                   /translation="MTSYFPPGGSASNGASTQTASSPLSPPTQRPTALTNRLTTVLSAS
FT                   YADSDIRDSLETLSLRGIHNTEETRRQLRLDVQKEVVDCNAEIVKDFGKVAEQLRRIGT
FT                   VVSTLNQTCEDMRKRINLAKQDTTPVLEEASALMAQKKETETKQQLLEAFSKHFLVPEE
FT                   DLLVLTSAEEPVDERFFDVLARVKQVHHDCEVLLGGENQRLGLEVMELSTRNLNSAYQK
FT                   LYRWIQKEFRSLNLEDPRISSTIRRALRVLAERPSLFHSCLDFFAEARDYVLSDAFHYA
FT                   LTDAVSGANGPGTSDHTVKPIEFSAHDPLRYIGDMLAWVHSTTVSEREALESLFVDDGD
FT                   ELARGIQAGLNSEPWSRIDEDQEVAFDGQKALSDLVNRDLTGVSRSLRQRVELVIQSHE
FT                   DPVTCYKVVNLLSFYRTTFTKLVGAQSHLVDLIQNLEKSTLGHFETLMRDQISALAGDN
FT                   IALTPPDDLSPPQFLLDALEGLELLMKTYETSVGPEDSLPDANENPFTSVLRAAFDPFL
FT                   TLARSSSDELQTTTAQSIYRTNILLAARAAVSPFPFASCTHVPPISAALSTLRSDLLDT
FT                   QHQFLLETSGLQKLLDALEPFSETAEDKTEKPDQKPHLADLASLPAFQPESLITSSQQL
FT                   DDFLPSALMDATDNLKRVQSLSLIQSVTEDAVEAFCRDFEFVEGMIIAADEARGTVNVA
FT                   IGTGDSVSGRSGKSDGKTEASEKDKEEAEEGEDEQWSLRSLFPRTTGEIRVLLS"
FT   CDS_pept        join(complement(995739..995828),complement(993543..995691),
FT                   complement(993232..993452))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216613" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943560"
FT                   /orf_name="Pc22g04240"
FT                   /product="Pc22g04240 protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAP97712.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="UniParc:UPI0001832AD0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HSN8"
FT                   /transl_table=1
FT                   /translation="MMRPRPASSLQKTYDECYLACSTAVYFEGQNNEEEALRSWRSALE
FT                   TIYHHNARRVPSNYTPKSETERALQDSIRALEIQCRERVDLLGALQESRKESAEANGSK
FT                   QAATLVKGKSTPSIPPSSSNPPGWIGDGTIPAVGYTDLSKPAAIPNRPALPTKQSHESP
FT                   PVYDDAGTAALSAAGSPALRVSSNSSGKTKSRGSSPERRKPMLTTLRSSDGKKNGKKVK
FT                   VASKKKESRPAASTAAGLAWGSIYRSASGEKPVSEAALASSRQSAAHDPNFRRDPEPRP
FT                   SSGDEPPRPRIRSSQDHLSGDRIPAAHWREPPRSSPKRSSPRPSAQSPSQLPPRVPRPP
FT                   PDSPKQQNPHAMSMPNPADFAPPRPSIKPKPVALRSSHQPTSHPMQATKSESTSRSLTP
FT                   RLDREKNSSHDKPRTNSAPRPPIIGETARVSPSPASGDDFHRGLDRLAISQGNNDSAVR
FT                   RKATPVKQQETPLSSDQESSDQRTTASDAEDEDEEDDSEIVKIMEKLPRGVDPQSAKQI
FT                   LNDIVVRGDEVHWDDIAGLEAAKKALKEAVVYPFLRPDLFSGLREPARGMLLFGPPGTG
FT                   KTMLARAVATESKSTFFSISASSLTSKWHGESEKLVRALFGLAKALAPSIIFVDEIDSL
FT                   LSARSSGSEHEASRRSKTEFLVQWSDLQRAAAGREQTSREKKEGDASRVLVLAATNMPW
FT                   DIDEAARRRFVRRQYIPLPEHHVREQQIRRLLSHQHHELSDADIQVLVQVTEGFSGSDI
FT                   TALAKDAAMGPLRNLGEALLHTPMDQIRAIIFQDFESSLYSIRPSVSSDGLRKYEDWAR
FT                   EFGERGG"
FT   CDS_pept        join(complement(998080..998117),complement(997791..997860),
FT                   complement(997697..997732),complement(997490..997622),
FT                   complement(997340..997432),complement(997221..997277),
FT                   complement(996724..997168),complement(996602..996650))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000038810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670578"
FT                   /orf_name="Pc22g04250"
FT                   /product="Pc22g04250 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97713.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001832AD1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT06"
FT                   /transl_table=1
FT                   /translation="MAAPDQIPGQEFDYEALPSNYGLGRNMLAGAFAGIAEHSVMYPVD
FT                   LLKTRMQILTPSTGGLYTGLTNAVSTIYRVEGWRTLWKGVSSVIVGAGPAHAVYFGTYE
FT                   IVKEMAGGNVDDGHHPLAAAMSGAAATIASDALMNPFDVMKQRMQVHGSVHKTLAQCAK
FT                   TLYRTEGIQAFYVSYPTTLCMTVPFTATQFVAYESISKVMNPKNEYDPFTHCIAGGLAG
FT                   AFAAGITTPLDVVKTLLQTRGLAESEEVRSARGLFNAAAIIKRQFGWSGFLRGMRPRII
FT                   STMPSTAICWTSYEMAKAYFKKHLD"
FT   CDS_pept        join(complement(1001554..1001644),
FT                   complement(1000929..1001454),complement(999972..1000858),
FT                   complement(999714..999721),complement(999603..999675),
FT                   complement(999148..999371))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216612" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943561"
FT                   /orf_name="Pc22g04260"
FT                   /product="Pc22g04260 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP97714.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI0001832AD2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT07"
FT                   /transl_table=1
FT                   /translation="MDSDDDFMSDVSSQDDFLGTQGSEDESLGEDFDDLDAGFSDDKDL
FT                   IKHKKKPYEVEFKVLDPPDIEREQVGQVNEVCAVLGLPPESVAILLRFGRWKKEKLIES
FT                   YMEHPEETLEEAGLGSNFEGTAKTERVPGFMCDICCEDGDDLETYAMRCGHRFCVDCYR
FT                   HYLGQKIKEEGEAARIQCPGDGCNRIVDYKSLDLLVTKELQGRYRELLTRTYVDDKENL
FT                   KWCPAPNCQYAIDCGVKNRDLRRIVPTVRCFCKHEFCFGCSLNDHQPAPCKLVKMWLQK
FT                   CEDDSETANWISANTKECTKCNSTIEKNGGCNHMTCRKCKYEFCWMCMGLWSEHGTSWY
FT                   NCNRYEEKSGADARSAQAKSRSSLERYLHYYNRYANHEQSAKLDKDLYLKTEKKMTSLQ
FT                   SQSGLSWIEVQFLDTASQALQQCRQTLKWTYAFAFYLARNNLTEIFEDNQKDLEMAVES
FT                   LSEMFEKPVAELAELKVDILDKTAYCNKRRVILLSDTAENLKNATTFCVRGVLEILRIL
FT                   HVSSFDEGFSFAQSISTTFDPLTMKCKGFPWETGGHSAETEPIYADQMSLVRGLQSHRG
FT                   SACPGQKSRVLFSASSPRLKRDLNLS"
FT   CDS_pept        1002917..1004248
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(1004433..1004456,1004606..1004707,1004768..1004816,
FT                   1005015..1005290,1005366..1005398,1005568..1005728)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823346"
FT                   /orf_name="Pc22g04280"
FT                   /product="Putative uncharacterized protein Pc22g04280 "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP97716.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniParc:UPI0001832AD3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT08"
FT                   /transl_table=1
FT                   /translation="MADSERPRAFCYYCNMPDHTEADCRRLRALGALNRMSLPPATTKR
FT                   KAHRAFRGGKAKKGEWLTYQQPRPPQRRVRVCPKQFYGLSEHNADISCVLSSRLQQHCS
FT                   PQPGPPLPSWPPVSPLPPLPPGLSRSSYLPPRASPPSNEAQASGVVGRAPTPATTTIVD
FT                   GEKKNNEKKNNEKKNNEKKNNEKKKSFLPFSFSFFLYQSPGSGPNTINRPA"
FT   CDS_pept        join(1006224..1006720,1006774..1007017,1007066..1007251)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943562"
FT                   /orf_name="Pc22g04290"
FT                   /product="Pc22g04290 protein"
FT                   /protein_id="CAP97717.1"
FT                   /db_xref="UniParc:UPI0001832AD4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT09"
FT                   /transl_table=1
FT                   /translation="MAETQAQSHAFLRSLIQQAKDLEPDFPSPDDFQRLGVQVVQVPLA
FT                   PENDQGLQFEPCFFRPHPDKLFQKHPIHPLDLENDPQNIQYSETLKDYIEDALTEHSPE
FT                   NAPIIARMEYEMSLGFPPERDPYIQAKDVEDMIGSHIRAGRYGPHEWFTLGDILDNEQK
FT                   CWEPHQRENDPLTYEGVEDPKPWQVVNHNRYTSRPLKPHSIMSCLAQLWPDASQGLSTH
FT                   ELRAIVNTMLLRVNHNPFRKCHIHPILVLSFMGDYQGRIIQASYDGKGLILQYSQLWSF
FT                   ADIKKAPVELFVRYRLSQTVGGIRTLS"
FT   CDS_pept        join(complement(1010700..1010777),
FT                   complement(1010551..1010607),complement(1010361..1010485),
FT                   complement(1009127..1010301),complement(1008396..1009066))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216610" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670579"
FT                   /orf_name="Pc22g04300"
FT                   /product="Pc22g04300 protein"
FT                   /function="binding"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="RNA metabolic process"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP97718.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="InterPro:IPR003307"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001832AD5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT10"
FT                   /transl_table=1
FT                   /translation="MAPKQKAGQKPKPNTAEEVEETFQAVVLADTFETRFEPFTRDKPR
FT                   CLLPLANTPIIEYTLEFLANAGVEEVFLYAGAHSDQLEKYINASKWRAPSSPFKQLTFL
FT                   KSTSTSVGDVMRDLDAKHVITGDFIVVSGDVISNLPIEGALAQHRARRALDKNAIMTMV
FT                   LREAGLRHRTKSTSVSPVFVIDPTQDRCLHYEEIDRHPHEEQSSRLNIDAEIILKHPEL
FT                   DIRQDLIDCSIDICTPDVLSLWSDSFDYQSPRKHYLYGVLKDYELNGKTLHTYIIKDQY
FT                   AARVRNLKAYDAVSKDILSRWTYPLCPDTNLLPGHSYTLRKGSMYQETGVTLARSCVIG
FT                   RRTVIGQGTSIGDRAEVHNSVLGRNCKIGRNVNLNDSYIWDDVVIGDNSDIRGAIIADG
FT                   VVIGRSCAVEAGSLLSYGVKIADNIWVEKGKRITKTRNDGGVAKNDPSVVGDNGEGYEF
FT                   IHGEEEEDEDDDVSVASSGLVYRMPNLSLSTASISTLSSEVSDASWTRSEGGSFSADEE
FT                   DNFHHDASVSLFDSLREGVAADVVQLELVTLRMSANASDNQVRRAIVSSFMKHIQQLME
FT                   GGKGAGPAVSEVFTAYKEVVERTLFDRNKEEKKDQVDLLLCLQNDLIHRNKGDMVLLFT
FT                   AKSLYELDLIEEEAYDQWWNDERSSNSEEMRTVRSQTQQFVDWLAEAEEESSEEESEEE
FT                   SEESDEE"
FT   CDS_pept        complement(1011447..1015025)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000250397" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976548"
FT                   /orf_name="Pc22g04310"
FT                   /product="Pc22g04310 protein"
FT                   /function="ATP binding"
FT                   /function="copper ion binding"
FT                   /function="copper-exporting ATPase activity"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97719.1"
FT                   /db_xref="GO:0004008"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001832AD6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT11"
FT                   /transl_table=1
FT                   /translation="MLSKNPHAGGASRRALAITTIKIDGMTCGACTSAVERAFQGIDGA
FT                   RDVSVSLIMGRAAVQHDPSVLAPTKIAEMIEDCGFDAAVLSTEEQNNPDSSSSSATQLS
FT                   VTNLAVEGMTCGACTSAVEGGLNGVSGVNSVDVSLLSERAVVEHDAGIITPEQIAELIE
FT                   DRGFGARVLDTSLVGSKEPSASADTEKESGLLVTTVAIGGMTCGACTSSVQGALGSVAG
FT                   VIQFNISLLAERAVVVHDPTILPASKIPDLVEDAGFDASIVSSEAQASISKKTQQVNLS
FT                   LHGLRDGVSATALEDNLLQQPGVQSASIKMATSRIALTFDPSTIGIRSIVEVIEAAGYN
FT                   ALIVDSDDTNAQIQSLSKTKEIQEWKRAFIIAASFAVPVFLISMILPMYLPGIDFGGFA
FT                   LIPGLYLGDLICLALTIPVQFGIGKRFYVTSFKSLKHRSPTMDVLVMLGTSAAFFYSCF
FT                   TMIMALCGMDHRRPSTVFDTCTMLITFVTLGRWLENRAKGQTSAALSRLMCLTPSMTTI
FT                   YEDPIAAEKLAERWASKPINGAPEQATLAEDMTVNHKCIPTELIQVGDVVILHPGDKVS
FT                   ADGVVIQGESYVDESMISGEALPIHKKKGSQIIAGTVNGTNSIDFKVIRVGKDTQLSQI
FT                   VKLVQDAQTSRAPIQRMADIVAGYFVPTIIGLGLITFFGWMFLSHILPHPPTIFEMAGS
FT                   GGRVMVCLKLCISVIVFACPCALGLSTPTAVMVGTGVGAEHGILVKGGAVLEAATKVTH
FT                   VVFDKTGTLTTGQMRVADTRIEPQWTMNDWRRQLWWLIVGLAEAGSEHPIGRAIFSTAI
FT                   SESGHHGEDGLPGSTGDVDNYVGKGVSAVVEPTSSGQRIRHHVLLGNASFLRSKDVPVP
FT                   ADADPDSGAPVDDPEADIPKTGATAAGITRIHVAIDNRYAGTISLQDTVKETAVAAVAA
FT                   LHRMGISTSMVTGDTLSTAISIATAVGIPTSTIHASVSPSEKRSIISALQAEGERVAMV
FT                   GDGINDSPALATASVGIALASGTDVAVEAADIVLMRPDDLLSVPASLSLSRSVFKRIKL
FT                   NLIWACMYNVIGLPFAMGIFLPFTGFMLPPMAAGAAMALSSVSVVVSSLLLKFWRRPSW
FT                   MEVECLEKELASGEISPLGVARRGHYRKVSWWASTAILSDSPGSLRRRAGNVVSSFWSL
FT                   VTGKGPKPAVQGDEGYVPLQTVEPPV"
FT   CDS_pept        join(1015954..1016212,1016304..1016947)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192225" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976549"
FT                   /orf_name="Pc22g04320"
FT                   /product="Pc22g04320 protein"
FT                   /protein_id="CAP97720.1"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI0001832AD7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT12"
FT                   /transl_table=1
FT                   /translation="MDQTHTRALEALQPFIHLARSSSASTPRFIANLITNATSNAQTYV
FT                   FAELLELPAIQALRSPDTPAEFKGYLKLLEIFAWGTWQEYQTTPNLPELNTEQTLKLRL
FT                   LSLLTLSTTIKPLTYSALMTALSTPTKAELESLVTAAIYASLITARLSPASNPPSVNVT
FT                   AVAPLRDVQPQSLPKMIANLSEWESRCGEVVSDLEAEIARVKSDAAKRAARARAHGEAL
FT                   EEAVKRKQSAGKKGGRRGGRLGAGVGGSKRDADDIDEDDGFFETYDGGEHGSRMDIDEG
FT                   PGARAGNSRQPKRVLGRKS"
FT   CDS_pept        join(complement(1018650..1018804),
FT                   complement(1017860..1018595),complement(1017568..1017804))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192236" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943563"
FT                   /orf_name="Pc22g04330"
FT                   /product="Pc22g04330 protein"
FT                   /function="signal transducer activity"
FT                   /protein_id="CAP97721.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI0001832BA0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT13"
FT                   /transl_table=1
FT                   /translation="MSHHDFVDAESRNRLPTLFEVLSRRTLAPVDLFSFYIYMRDQQRS
FT                   VDYLDFWLDVSQHMLLCRHYVRELRRSVLVATPDMERADSKRSSAMLDNLENLGDIPLT
FT                   EAGPSRLRNGFQENEKDRDADQRLSAFLRSEGQTTSPSRGNSLRSSGESAHQTSSYEDG
FT                   RDTPDSRVNDSTSPGHTVARNDIRASAEKILYTYLLPGSEREIMLPESMVSTIINLVED
FT                   DGRDDPVVFDPAKDYVFQAMERDAFPGFLQAKALGNMVPLSIILRLAFALISFGGGFWG
FT                   AFYVVLRNKPRNIRCWVILPFAVAAYFIISYQYKIDPVMAFLGYSEYTFMNWAPIREPY
FT                   VRKLLNKRALVTALIAFITAAALSILFIFVPGTML"
FT   CDS_pept        join(complement(1021274..1021295),
FT                   complement(1021117..1021208),complement(1020968..1021021),
FT                   complement(1020691..1020899),complement(1020521..1020635),
FT                   complement(1019743..1020462))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192257" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670580"
FT                   /orf_name="Pc22g04340"
FT                   /product="Pc22g04340 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP97722.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniParc:UPI0001832BA1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT14"
FT                   /transl_table=1
FT                   /translation="MVVDSPKSFKRKASEEAASPDSGSQIIKKARTDSPVKEEDGPLKR
FT                   PPLRIVPFPEKPAVLEERRGDIEFRVVNNDGSHDSFIVLTGLKCIFQKQLPKMPKDYIA
FT                   RLVYDRSHLSMAIVKHPLEVVGGITYRPFDARKFAEIVFCAISSDQQVKGYGAHLMSHL
FT                   KDYVKATSPIMHFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCTML
FT                   PKIRYLEMGRMLTKQKESVQAKIRAFSRSHIIHPPPKEWKNGVFPIDPLSIPAIKESGW
FT                   SPDMDEMARQPRHGPNYNQLLHLLNDMQNHSAAWPFTQPVNRDEVPDYYEVILEPMDLS
FT                   TMEEKHEKDLYPTPQDFIKDAMLIFDNCRRYNNETTPYAKSANKLEKFMWQQIRNIPEW
FT                   SVSI"
FT   CDS_pept        join(1021471..1021585,1022032..1023233)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192258" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943564"
FT                   /orf_name="Pc22g04350"
FT                   /product="Pc22g04350 protein"
FT                   /function="damaged DNA binding"
FT                   /function="exodeoxyribonuclease III activity"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97723.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008853"
FT                   /db_xref="InterPro:IPR003021"
FT                   /db_xref="UniParc:UPI0001832BA2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT15"
FT                   /transl_table=1
FT                   /translation="MSLNEVWEAASATPFIPLIAKDSQFSVGFNLLLIGKLLVRASSLH
FT                   NKMEPLFAGVPNNAHHLYTLLSCIGFAHKATVQITPDGLRFSVEEGRVIQGLAFLDKSL
FT                   FTSYTFNPSTDPEHNNQNGTPQDDNESSQNGAYPHFVVSLSAILETLKIFGINEFPESN
FT                   RPRDTSITQSGIASSSAFNAPALLMDRSCTLQYAQHGAPLSITITEAGVKTTCELVTYE
FT                   PDEDEADIPLQRDAIIMKIIMRSAWLHNAIAELDSSTPTILKLSACAKREPYFALSGAG
FT                   GPFSESTVEFSVDQHNEIAGGAGQGNTQSQMHKVLFDDGSSRARATRAKLAPTVTETFL
FT                   VSPPSSMGERIRQSYRFGLVRKAARAMSVANKVSIRGDRQGVLSLQFMIELDDHNVPMG
FT                   RPVGAGVKGPNGPVCFVDFRFVPLLDEEEAEMEMDAGGE"
FT   CDS_pept        join(complement(1024457..1024848),
FT                   complement(1023641..1024364))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976550"
FT                   /orf_name="Pc22g04360"
FT                   /product="Pc22g04360 protein"
FT                   /protein_id="CAP97724.1"
FT                   /db_xref="InterPro:IPR013861"
FT                   /db_xref="UniParc:UPI0001832BA3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT16"
FT                   /transl_table=1
FT                   /translation="MSLRINIPPATRICLVSLLTLSLLYNIARWRQIDTTGGTPTTSPL
FT                   VPYLTLVPSFFYYYPWTIVTATFVEQNIFTVVLNAATVFYGGKYLERAWGSREFSKFIA
FT                   VVAVIPCIAIIPIYLIWGAIGGSSSRALTQICGGVSIQASFLVAFKQLVPEHTVTIFKG
FT                   IIKMRVKHFPALFLLLNTISGLIIGTHTAAILSWLGLLTSWTYLRFYKRQPDLTGTSNG
FT                   AGIKGDASETFAFACLFPDVMQPPVAFVADKIYALLVAAKLLTPFSQDDIASGNELVLA
FT                   RGEAGLPTLLNSQRGGARGAGKREEAERRRAIALKALDRRLQAATAGRVQAHSPGLGEP
FT                   SSSMPRPATPTPAAPVGQSMLGETSYNPDHA"
FT   mat_peptide     join(complement(1024457..1024758),
FT                   complement(1023644..1024364))
FT                   /db_xref="UniProtKB/TrEMBL:B6HT16 "
FT   sig_peptide     complement(1024759..1024848)
FT                   /db_xref="UniProtKB/TrEMBL:B6HT16 "
FT   CDS_pept        join(1026339..1026388,1026439..1026455,1026513..1026661,
FT                   1026764..1028254,1028349..1028372)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216617" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823347"
FT                   /orf_name="Pc22g04370"
FT                   /product="Pc22g04370 protein"
FT                   /protein_id="CAP97725.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI0001832BA4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT17"
FT                   /transl_table=1
FT                   /translation="MAQPDLTSHHVNYLIWRYLQEAGHGDAAVSLQRAWFPDPQTLPFA
FT                   PYIKTHALVSLVQKGLQYHELESSLDKEGNRKSISPSDYFFGPEPFEIGAKAGSVKCPD
FT                   EVVGTDPDSPGQLARDRPVNGHAEPGKDSRKDETDSDEFMEDKAQTESQPDTPDHMDED
FT                   GDVSMAEEIPELPTLENGESSSAQIAPAKPIDLTPDTALLDLDHHVTHAAWRPRDPTVV
FT                   VGAGDLFCSLWKLSMSSEPVQKRIVELKKGDTSVSTVAWDAIGEKLAVATCTEDRGTIT
FT                   MYNVNGDAVDLLPEVPRLITGLHWATGSSQLVVVASNHNVSELALWDDSRRPDVFPPPQ
FT                   VIENNIYDLAWCGRNLAFASGDGAVYQCEVDNSIRLIKTFPSPRDNATWEFIRCVQTES
FT                   HSVAIAASGLSASIWIPTHDILIPDAHKDRITGIDISPQFDPHRIEFASFSADGKVKVW
FT                   QVNLDIKDYTNFHQLSLDSTPAITGSFSPDGYALGAASKDGLFIWNTGHPGGNLMSTWT
FT                   ATSPEVKKEEPDRMTNGQNGHHGQNGHSKSDPHRALSWDADGKRLAYGFDKQSGFETAT
FT                   "
FT   CDS_pept        join(1029098..1029109,1029202..1029350,1029513..1030878)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000025142" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943565"
FT                   /orf_name="Pc22g04380"
FT                   /product="Pc22g04380 protein"
FT                   /function="anthranilate synthase activity"
FT                   /biological_process="tryptophan biosynthetic process "
FT                   /protein_id="CAP97726.1"
FT                   /db_xref="GO:0000162"
FT                   /db_xref="GO:0004049"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniParc:UPI0001832BA5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT18"
FT                   /transl_table=1
FT                   /translation="MATPVVTIPSLETARDVISKSRNSAFPPNLLPVTASIAADLLTPT
FT                   LAYLKIAEKWVIPGVFGPIPSLTTSSHTDPRKVIKTGEGHGPAADPLPYLEDELSQFRV
FT                   ATVPELVLPPLTAGAIGYVGYDCVRYFEPKTARPMKDVLGVPESFFMLYDTIVAFDHFF
FT                   QVVKVITYVPIPSADADIEASYLKGQSIIQKTIEKLLQDRTPLPPQGPIIPNQEYTSNI
FT                   GQEGYEGHVNRLKEHIAKGDIFQTVPSQRLSRPTSLHPFNLFRHLRTVNPSPYLFYIDC
FT                   QDFQLVGASPELLVKEERGRIISHPIAGTVKRGKTPEEDAALSEELRSSLKDRAEHVML
FT                   VDLARNDVNRVCDPTTTQVDRLMVVEKFSHVQHLVSQVSGELRPDKTRFDAFRSIFPAG
FT                   TVSGAPKVRAMQLIAELEGEKRGVYAGAVGYFGYNSANADGSAEMPGAMDTCIALRTMM
FT                   LKDGVAYLQAGGGIVFDSDPYDEYIETINKLGANIACIKGAEAKYLSMEK"
FT   CDS_pept        join(1031916..1032067,1032117..1032547,1032603..1032985)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000005595" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976551"
FT                   /orf_name="Pc22g04390"
FT                   /product="Pc22g04390 protein"
FT                   /protein_id="CAP97727.1"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="UniParc:UPI0001832BA6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT19"
FT                   /transl_table=1
FT                   /translation="MSPSLKSRAQAAIWGVCVADALGGPVQFKDPGTFKPITCLRKVAP
FT                   FDQPAGSYSDDGSMTLALACSFNKSNMQYNHTLSIQYFVEWLRNGHFSTVNHSWDVGRS
FT                   TRISLGQWEKYGIEKGDFELAQVMVNGRLEYEEYSGNGSLMRIVPIGLVYWRDSRLARE
FT                   IARTHGQITHPSLACVEACEAYTELVCKVMNGETKKQLFHAVSVFPFTHSALKERLSLY
FT                   RYRTISDWKAKEPSDMKSSGWVVDTLECALWAFFKYDTWKDGALAVVNLGGDSDTAGAV
FT                   YGGLAGSFYGFDAIPGEWVDGMQNKGFIGSIAGALSDGIA"
FT   sig_peptide     1031916..1031984
FT                   /db_xref="UniProtKB/TrEMBL:B6HT19 "
FT   mat_peptide     join(1031985..1032067,1032117..1032547,1032603..1032982)
FT                   /db_xref="UniProtKB/TrEMBL:B6HT19 "
FT   CDS_pept        join(1034874..1034946,1035121..1035190,1035247..1035467,
FT                   1035527..1036869)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216614" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943566"
FT                   /orf_name="Pc22g04400"
FT                   /product="Pc22g04400 protein"
FT                   /protein_id="CAP97728.1"
FT                   /db_xref="InterPro:IPR001026"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniParc:UPI0001832BA7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT20"
FT                   /transl_table=1
FT                   /translation="MSKVVRSVKNVTKGYSSVQVKVRNATSNDPWGPTGTDMSEIAAMT
FT                   FGSPNEFYEIMDMLDKRLNDKGKNWRHVLKSLKVLDYCLHEGSELVVTWARKNVYIIKT
FT                   LREFTYVDEEGRDVGQNVRVAAKELTALVLDEDRLRSERSDRKLWKTRVSGLDEGYGSS
FT                   SMEPPRRDRRRRNGDDDSDAEYRLAIEASKAEAEEERRRRAKETMATQDDEDLAKAIKL
FT                   SREEEDLRKRELEESNAQSLFDDTPAQVQPTGYNQGYQQQGAVDWFGNPINPQHPMTTG
FT                   YLNNQYAQPTGFQNQPTGMNNPYANGYQAQPSAFDQNPYGQQQNNLLQPQAALQPQHTA
FT                   FNPNNPYGADIFSQQQQQQQQPQENYQTAGSNNPWAGNPSQQLQPADALKPMPTGSNNP
FT                   FAQRTQTQFNKPAQTGPPTLNSLSEDRATNQFAQNNAQYGQSSQFAQPTQPNPIAGFQA
FT                   PQPPKSTPPQDPHHARLNALLGSGEGLDTFGNVGDLRIPAQHTAPGTFVNSAGQGLDRL
FT                   HATPTGNPFFNQQFTGMPQQTGYVQQQQQPANNNPWGGRQQQPGGGSLIDL"
FT   CDS_pept        join(complement(1038765..1038835),
FT                   complement(1038650..1038693),complement(1038446..1038571),
FT                   complement(1037492..1038342))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000014260" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976552"
FT                   /orf_name="Pc22g04410"
FT                   /product="Pc22g04410 protein"
FT                   /protein_id="CAP97729.1"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="UniParc:UPI0001832BA8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT21"
FT                   /transl_table=1
FT                   /translation="MSASMISSECSPFTNAVVSSMRKLYPEALADKSFDNTGLLLEAPF
FT                   DKSRIQKNSALLTIDLTTAVADEAIKNRNSIVVAYHPIIFRGLKSLTFADTQQRSLLRL
FT                   AQHGISVYSPHTAVDTVPGGMADWLCDVVTGNFNPAQTPNTTLKSCTSSMYSAPTYPDS
FT                   PIPTVQAQTTGPAHTRSTIHPSPPASIPEGFESAGAGRLVTFAENQPLTTLIDNIARGI
FT                   GLPGGIPIAVPQGKSVDDISIRTVGMCPGSGSGVLLKGDGELPDLLLTGEMSHHEALAA
FT                   TERGSVVISLSHTNSERGYLRSVMQPKLLDEVTRVWGQSASLEAGNDEIGVIRNLAKEQ
FT                   GAVEVSVSEADRDPYGIMIWRGN"
FT   CDS_pept        join(1039204..1039297,1039427..1039599)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000255170" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976553"
FT                   /orf_name="Pc22g04420"
FT                   /product="Pc22g04420 protein"
FT                   /protein_id="CAP97730.1"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="UniParc:UPI0001832BA9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT22"
FT                   /transl_table=1
FT                   /translation="MADTSGITADSLKNKLTEALQAQHVEVEDLSGGCGQAFQAVIVSP
FT                   QFESKTMLARHRLVNSALKAEIAAIHAWTPKCYTPEQWQALQQ"
FT   CDS_pept        join(complement(1040535..1040739),
FT                   complement(1040369..1040468),complement(1040257..1040302),
FT                   complement(1040022..1040187),complement(1039941..1039969))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000255884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943567"
FT                   /orf_name="Pc22g04430"
FT                   /product="Pc22g04430 protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP97731.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="UniParc:UPI0001832BAA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT23"
FT                   /transl_table=1
FT                   /translation="MFARRIATNIPRVRAQASLFHSTAPAFVQKGDAIPNLDVLVENSP
FT                   GNKVNLAKEIKNKAVIIGTPAAFSPACSSTHVPGFINHPKLKEAGQAFVISVNDPFVTK
FT                   AWADSLDPSGKSGIRFLGDPSGEFTKALDLSFESSAIFGNDRSKRYVLLVEDGKVKEAF
FT                   VEPDNTGLDVSAAEKVLG"
FT   CDS_pept        join(1042526..1042582,1042643..1042659,1042711..1042783,
FT                   1042855..1042998,1043060..1043944,1044006..1044195,
FT                   1044247..1044761)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216609" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127635"
FT                   /orf_name="Pc22g04440"
FT                   /product="Pc22g04440 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="response to stress"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97732.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014402"
FT                   /db_xref="UniParc:UPI0001832BAB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT24"
FT                   /transl_table=1
FT                   /translation="MDGGQTSSNPAPAGNSSDFVRKLYKMLEDPTYASIVRWGDEGDSF
FT                   VVLECEKFTKTILPKHFKHSNFASFVRQLNKYDFHKVRQNNEENGQSPYGQNAWEFKHP
FT                   EFRANSKESLDNIRRKAPAPRKQTQPSDDSVPTQQIDLLNQQIVAQQQQIQQLSDQYAR
FT                   LTVDHQLMLQEVMRVQKTVLNHENVIHQVMTYLLSVDARQRRDSKAVPFQATGTTMSPS
FT                   QVGAMDDEPSSPLQQASKLLNDMNAELQFNMNGVDSMNDPQKAVVSTPTLDPNARNGSL
FT                   RPATAAPPNPALVYPKMAGDLEQVVYPVGATNGIDPMYSEHINNVPYPMPAKQEIDTSD
FT                   ARRQFPDNRKKSTNVDPGWVRSPQILLVEDDATCRQIGGKFLYSFSCVIDTAFDGLEAV
FT                   NKIQGGSKYDLILMDIIMPNLDGVSACHLIRQFDRTPIIAMTSNIRSDDIQLYFQHGMD
FT                   DVLPKPFTRKSLLDMLERHLDHLKISPQNPGMEPVRPSAAAVTMAAATQSSANQSIKED
FT                   SSPGQSPAGSMTNWQSPGQFQNMQAVPPNMPAVQGPYVTAQPAAYAVDQNGVQYPAPPV
FT                   GVPTAGAPIRPPHRRQISEMGGADNPNMPKRQRMYSQPQPMLAVQAGRPG"
FT   CDS_pept        complement(1046593..1047702)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192214" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976554"
FT                   /orf_name="Pc22g04450"
FT                   /product="Pc22g04450 protein"
FT                   /protein_id="CAP97733.1"
FT                   /db_xref="InterPro:IPR015267"
FT                   /db_xref="UniParc:UPI0001832BAC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT25"
FT                   /transl_table=1
FT                   /translation="MPQVRPEPIGQPSFPNHSSQANSIPPESSNKENTSPADIQTSPQA
FT                   ARTGSPPSSERVPDSQPQPSSASTDDRLPPQLAFLLSAIRSSIKSFFEDKPPHTIQRLA
FT                   ELVLYPTKHYRTLPAYLRAVDRVVSVTSSADIFPFQTPAVTNAQTNGLLPGNGSGVYMA
FT                   PEFAQGLGSDESLGGALLTPIPWLTNASFEGEDTNGDAGMLVEGTSIHYSRATGFLFTN
FT                   VSPGTEPLPTQPEEPVNTTIASTEADEKAATTSPEPSDEVPHARGPIVLGVEDMGLQDG
FT                   KGVEMRLAADGAADVSAAAATTTTQPIEGQEKAEPTGDNDGDIVLADTKPKEGEETKNE
FT                   GASTEPQAGNAESEPTGGSSQAPDAEKKA"
FT   CDS_pept        join(1048208..1048673,1048727..1048824,1048884..1049841,
FT                   1049907..1050103)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000034027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943568"
FT                   /orf_name="Pc22g04460"
FT                   /product="Pc22g04460 protein"
FT                   /function="ATP binding"
FT                   /function="phosphoribosylaminoimidazole carboxylase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /protein_id="CAP97734.1"
FT                   /db_xref="GO:0004638"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR016301"
FT                   /db_xref="UniParc:UPI0001832BAD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT26"
FT                   /transl_table=1
FT                   /translation="MWNSPKVGILGGGQLGRMLVESANRLNIQANILDADNSPAKQISS
FT                   HDGHVTGSFKEPDAVRKLAESCDVITAEIEHVDTYALEEVASKVRVEPSWQAIRTIQNK
FT                   FNQKEHLRKYGIPMAEHRELVNNTPEELAQIGEELGYPMMLKSKTMAYDGRGNFRVNSK
FT                   EDIPEALEALKDRPLYSEKWAYFKMELAVMVIKTKDDVLSYPTVETVQEDSICKLVYAP
FT                   ARNVPDSINQQAQALARKAVSAFEGKGAFGVEMFLLEDNSLMLCELASRIHNSGHWTIE
FT                   GCALSQFDSHIRAILDLPIPPKSLELLQPSIMLNIIGGATPDSHLKATEAALSIPNASI
FT                   HLYSKGAAKPGRKMGHVTVTAATMHEAETMIQPLIDVVDTMRAQRTDIKTKAAPSGPSK
FT                   PAPSVAVIMGSDSDLKTLVPGLKLLRDYFGIEPEVEITSAHRTPDYMAEYAGQAASRGI
FT                   KVIIAAAGGAAHLPGMAAAHTALPVIGVPVKGSSLDGVDSLYSIVQMPRGVPVATVGIN
FT                   NSINAALLAARVLGSFDPAIQRKVEAYAEAARAENMELKGTKLRELGWQKYFDQM"
FT   CDS_pept        join(complement(1053427..1053468),
FT                   complement(1053333..1053372),complement(1052844..1053194),
FT                   complement(1052606..1052790),complement(1052362..1052554),
FT                   complement(1052040..1052310),complement(1050522..1051989))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192203" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943569"
FT                   /orf_name="Pc22g04470"
FT                   /product="Pc22g04470 protein"
FT                   /protein_id="CAP97735.1"
FT                   /db_xref="UniParc:UPI0001831F35"
FT                   /db_xref="UniProtKB/TrEMBL:B6HT27"
FT                   /transl_table=1
FT                   /translation="MSVNVPTNSKQKEKDINQKLQYFGIYHGLSRPQNKQCDIALNSAL
FT                   NSKALTSPPNALSSDGKTLVADLRNVVDAAKKMLLVKNEGELLQDFIWQAQKISGDNLG
FT                   GKRPGLPVDKETGQQDASKAVDGLKTLGTLMITNGEFRKLLNDAMTLGKDIAADASQKA
FT                   ANQVRPSEEELSQIDQAAEENVWHEKPNISKDDLKSRFKKNKDEKGGAASAGAAVAEEE
FT                   TGVSAQDKKKAYSDKTKKYLSEKVPKERREQTVWRLKKMIIEIQGHADYQQAVETLLTM
FT                   AEQYAGHTKDISKEGGSSARDVLKGDNVQAVQQNLRTLIERFANHTSLDSFFESLNTIY
FT                   RDAEKDPELRNWFKNVDTLIRKSLREQGFIMEDECSRQWNELYDKGRYLLRERYRGHSD
FT                   RIVDEVKFLADQFEQDPQNQALAESCQKLFKDLGRDASGKATFKPDLLRDLRDVIIPSI
FT                   FENVRYIPVPRIEVSDPMVDVVVENLVLEGDNLMPNVVEFGSDNYFRWGRKKITNKRDN
FT                   KIMISMSGIQLDLRDISYYIKKKEGFPAITDRGVMDIFLGGEGLSVKLAASTAQKNDKE
FT                   NYFKLDKVNVSISNMDIKLKKSSHKLLFNTFKPMLFRVVRPALQKVVEGQVREAFKKGD
FT                   LFVRDIHTEATRAQEAAREDPENAPSIFSRYADAIRARTQAKAKQAEGAAKRDTKVQTV
FT                   MTLHDSIFPDIELPGAVSTKATEYADLAAKGERWECPIFSVGNASESTGIPSGGPITNK
FT                   PHGASTAGAGAAGVASAAGVSGATGAAASGNGTKASDYQARGFSDEVDKAFVNGKSQKL
FT                   GEAIKHGDGANGADGVPDGPATTVTNGTTINNIGTTV"
FT   CDS_pept        complement(1055183..1055695)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000085050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670581"
FT                   /orf_name="Pc22g04480"
FT                   /product="Pc22g04480 protein"
FT                   /function="hydrolase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP97736.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI0001831F36"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTF1"
FT                   /transl_table=1
FT                   /translation="MTTPNPTLTPLTQPQLTAACDAALVHQAQAQDLHKKRPFAAILLA
FT                   PDNETILLSSNSLSHVRHAESELARNAADNYDWAYLARCTLVSTWEPCAMCAGAIYWAH
FT                   IGRLVYMASEKALQEVIGAGDPENLTLDLPCRRVFEKGQSVVEVIGPLVEEGWERRVVE
FT                   DSRRYWG"
FT   mat_peptide     complement(1055186..1055605)
FT                   /db_xref="UniProtKB/TrEMBL:B6HTF1 "
FT   sig_peptide     complement(1055606..1055695)
FT                   /db_xref="UniProtKB/TrEMBL:B6HTF1 "
FT   CDS_pept        complement(1056018..1056992)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943570"
FT                   /orf_name="Pc22g04490"
FT                   /product="Pc22g04490 protein"
FT                   /protein_id="CAP97737.1"
FT                   /db_xref="UniParc:UPI0001831F37"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTF2"
FT                   /transl_table=1
FT                   /translation="MSLADIPGSNFSLADRSVRDRFAERTIIACLIGIAWYNALELIVL
FT                   CFSTFKRYGGCYFWCLLIASFSIIPFGLGYLLIIFDIYTSMFPFVMELVAWVGMVTGQS
FT                   LVLWSRLHLVCHSRTVLRATLAMIIVDAIVLHTPGFVLEIGSHSNKSSLFIHGFNIFER
FT                   VQLVGFSIQEIILSVIYSWESVRLLNLRPRGHYRGTLVQLLIVNVAMILMDAAIIGVQY
FT                   SGFFDIHVTLKAMVYSVKLKLEYAILGKLVHITETGGSSAATDLSDFVDLSLHHARTQP
FT                   DTENPEYGPPARARVSSKGSSTDPLRRNSSAAPSPSSTNPDYP"
FT   CDS_pept        complement(1058753..1059499)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076752" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670582"
FT                   /orf_name="Pc22g04500"
FT                   /product="Pc22g04500 protein"
FT                   /protein_id="CAP97738.1"
FT                   /db_xref="UniParc:UPI0001831F38"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTF3"
FT                   /transl_table=1
FT                   /translation="MQFQYSFRDRKYVICGSESVYRERITDVLLAEHALLELSQREEML
FT                   HHRATALDKTLAVESDRLQPEKTNSVESTRTELEKTHQQLKEAQVECARKEYALYEATS
FT                   MLTPYIKKFYDNLRRDPKWFMREELVQDCSDRGGCCSRECGCCAQRCEEEKNLLQRKKG
FT                   RGHCTTECQCCIGFRGFEFPEEDKEKIRRDFEAKVKYPITGSAYFIKLANWYFCPLKCQ
FT                   KPSNPSKPKSRRYRIFGRGSTDEKES"
FT   CDS_pept        join(complement(1062026..1062141),
FT                   complement(1061806..1061963),complement(1061473..1061732))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943571"
FT                   /orf_name="Pc22g04510"
FT                   /product="Putative uncharacterized protein Pc22g04510 "
FT                   /protein_id="CAP97739.1"
FT                   /db_xref="UniParc:UPI0001831F39"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTF4"
FT                   /transl_table=1
FT                   /translation="MATNSTQNETPAWVAPVAAGGYGLIGLIVVVVFLFCAIRFWVRKT
FT                   DPEWKLIYHFDRQVAKIPKAVKAAKKIEKKRGQRTRWGEWTWAGFTGILGRPEPQPAGT
FT                   DDNEAAGDRITRPVLPVFVEPCDTAAAEGRLEDVDCNGLVVRWVPVPRGHRLAKKTKKA
FT                   NALAEVVGALKGKN"
FT   CDS_pept        join(1062556..1062617,1062705..1062908,1063018..1063171,
FT                   1063373..1063517,1063601..1063671)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823348"
FT                   /orf_name="Pc22g04520"
FT                   /product="Putative uncharacterized protein Pc22g04520 "
FT                   /protein_id="CAP97740.1"
FT                   /db_xref="UniParc:UPI0001831F3A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTF5"
FT                   /transl_table=1
FT                   /translation="MTGEEIFDSRPYFNLISIVVRVFACRSFHFGAGFLVCTSLSWTLR
FT                   KARNPKCCEHDTVLSTNCIYATRDLVRPTTHIRKRLQPDVVLARALYMTQALPGWVGVT
FT                   GHLRKQIIHMLLRKTMKKKTVVFKRIDGLGGSTISKQAQRTYEEFQKREINSRPCIVED
FT                   ATHQFIIYCGYQEHDDVRNICNRDTAQTAKGQSSHNPNTLARRVGVAV"
FT   CDS_pept        join(1064393..1064605,1064656..1065150,1065203..1065879,
FT                   1065935..1066100)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943572"
FT                   /orf_name="Pc22g04530"
FT                   /product="Pc22g04530 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP97741.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831F3B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTF6"
FT                   /transl_table=1
FT                   /translation="MASPGHATPGASHPKFGSDYAEKEIGDIFPEPAALLSESHKSYLL
FT                   ERHGTLDLDPIPSMDPADPYNWPSWKKSTNLGLVAFHACMGTFTAAAIICAYEDIAEDL
FT                   GVSIQRVSYLTSLQIAILGGAPLFWKPLSHRFGRRPIFLLSLVLSCACNIGCAKSTNYA
FT                   SMAACRALVSLFISPAMAIGSVVVTETFFKHERARYMGVWTLMVTLGVPVGPFIFGFVT
FT                   QRVGYRWIYWILAITNAVEFILYIFFGPETRYIGADVQSRSSAFKTQYLSLRRIDPTPF
FT                   KVTEFWHPLTLFTNIPVMLAAIAYSMVFLFASVLNSVEVPQLLQSKFELNAQQLGLLFL
FT                   GLIIGSLLGEQLGGFMSDMWMNTRARRIGRKPAPEFRLWLSYIGFLLTIAGMVVFLVCT
FT                   EQATAGKLDVRPVVGTGVAAFGNQVVTTVLTTYAVDLYPQDAGSVGVFINSVRSTWGFI
FT                   GPFWFTSMFESVGIANSSGVVTALIVGASFIPTMLLHWKGNRWHDKNTDSLGLGGIEK"
FT   CDS_pept        join(complement(1067794..1068513),
FT                   complement(1067718..1067736),complement(1067387..1067514),
FT                   complement(1067187..1067211),complement(1066965..1067118),
FT                   complement(1066806..1066905))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943573"
FT                   /orf_name="Pc22g04540"
FT                   /product="Pc22g04540 protein"
FT                   /protein_id="CAP97742.1"
FT                   /db_xref="UniParc:UPI0001831F3C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTF7"
FT                   /transl_table=1
FT                   /translation="MADPSSSSAGAARLSSFSAAADAAHLDDDSNDWKALQTTVVANQS
FT                   VDLPELGSFNLYKLTPPLKERADLGNWIDQVEKVLQGYNLHHLINKSIPWPRIRDPNGK
FT                   KWHTQSLWLSSSIHHTVMQEINARGSGLGLGLSTGWVMTIIDADLAKSLDLPLQKCTPV
FT                   PVAGIGSRHLSSAFVSFDVFFRGSENVACIRVEAHLVDNLKAKLLIGMDLMGHEGFRLD
FT                   LDAKKLRISSCMNIEIPIFLLRLRMPIHPRSKDDSVLLELLNVASEKGPLLALQVGGIA
FT                   MLYLLIRQFLVSVSSALPIHPRSKELLHVATKKGPLLALQVGGVAMFYLLIRQVALFLS
FT                   WWAQFHIERRARTSGNNRAGDANGNADGQAANGNGTGNGSG"
FT   mat_peptide     join(complement(1067794..1068444),
FT                   complement(1067718..1067736),complement(1067387..1067514),
FT                   complement(1067187..1067211),complement(1066965..1067118),
FT                   complement(1066809..1066905))
FT                   /db_xref="UniProtKB/TrEMBL:B6HTF7 "
FT   sig_peptide     complement(1068445..1068513)
FT                   /db_xref="UniProtKB/TrEMBL:B6HTF7 "
FT   CDS_pept        join(1068931..1068951,1069093..1069332)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976555"
FT                   /orf_name="Pc22g04550"
FT                   /product="Pc22g04550 protein"
FT                   /protein_id="CAP97743.1"
FT                   /db_xref="UniParc:UPI0001831F3D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTF8"
FT                   /transl_table=1
FT                   /translation="MEGAAQVASAYESEGGETTYVHLLMNQRTIPLGRSITECGERDDG
FT                   WCELQTFVKVQKENIAKAKYDESCFGDYSIPAYGDITTGAI"
FT   CDS_pept        join(complement(1070600..1070674),
FT                   complement(1069664..1070464))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234986" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943574"
FT                   /orf_name="Pc22g04560"
FT                   /product="Pc22g04560 protein"
FT                   /protein_id="CAP97744.1"
FT                   /db_xref="UniParc:UPI0001831F3E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTF9"
FT                   /transl_table=1
FT                   /translation="MKASFIAAVAALAGSAFAAPTPATGLSDVTKVLNLPAPASPSASG
FT                   TPAVQDGHLVQNLGPQLDNILTVAGPDATTLLIQLSPEVTALVSGLGLPGLGVPLGSIV
FT                   ASASGLGGLVTGLGPVVDGLVTVVGADVGALLISLSPEVTGLVSGLGLPNVGVPVGTVV
FT                   ATLGKNLKRGELVHDVAPKVKNTLEVTGANTKNLLVELSPSVTSLVAGLGLTTIAGPVG
FT                   SIVHEASSVGDLVKDVSGPVEDLLHIVAKDGKHLLIKLSPSVVGLVTGLGLPTVATPVG
FT                   AILTTVAQNL"
FT   mat_peptide     join(complement(1070600..1070620),
FT                   complement(1069667..1070464))
FT                   /db_xref="UniProtKB/TrEMBL:B6HTF9 "
FT   sig_peptide     complement(1070621..1070674)
FT                   /db_xref="UniProtKB/TrEMBL:B6HTF9 "
FT   CDS_pept        join(1071996..1072400,1072742..1072985,1073060..1073105,
FT                   1073350..1073541,1073941..1074007)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943575"
FT                   /orf_name="Pc22g04570"
FT                   /product="Putative uncharacterized protein Pc22g04570 "
FT                   /protein_id="CAP97745.1"
FT                   /db_xref="UniParc:UPI0001831F3F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTG0"
FT                   /transl_table=1
FT                   /translation="MVKFNLAGYFQPWKVTFEVQHQSATTRTWDPRSCCQKLGCHLHDP
FT                   KGYFTFFLRFVYFPTGVCGKPPIVGTMTRPTSAYKFDRWRYPEHVRALIAEIIRRILTA
FT                   GTCMMHRRFYSYIRWALSITGWTSQYPVQYPFDSWFVNIWVSICPELHRPGLDLVLWPS
FT                   TTEYVRSISIHPQQRTFWAYPLCLQGVVHRSGTGRPAPSSHPQANKWLGLAALEDGNQG
FT                   PPYSTQDMNQLWQIMLECGPAVWDYLGLLAQLATVTSYSRNKQKTEVKLGLISPVWVLR
FT                   TPYSTLCFATVVIMGTQAAFVDLSGKAPARFAPTTS"
FT   CDS_pept        join(complement(1076257..1076660),
FT                   complement(1075596..1076201),complement(1074681..1075545))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192192" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670583"
FT                   /orf_name="Pc22g04580"
FT                   /product="Pc22g04580 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97746.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831F40"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTG1"
FT                   /transl_table=1
FT                   /translation="MSVTATTFLDNPLLKVSRPVAACSRCRTAKIKCDGKLPACSACER
FT                   VGKATTCSGASDEFAKGKERSYVASLEGYCEKLEKKISQMRARSTSLSAEGDGIPREMS
FT                   ITSVSSESALGPAHRREVSDIDDLVGDFGFLSVNATSRDFHGITSNTSFANLLLSVALA
FT                   DSSPPSSPYSLPARHEATPLLQHYFDNVFVQLPFFVETSFWTSVDAVYQSGGRFAKPFD
FT                   HWMLRMVLAIASASVSYHYNDRSHQRAWALVSDALTYAEEVLRPGSISGIQAILLLAQY
FT                   SLVDPIRFRSWYLVGMAVKVAIDLGLHQDPPAEVSTNPDRLDIRRRVFHCIYCLDRGLS
FT                   PAMQRTYSFSDGSVNVALPSIAAPGAPIEQSHIFLRSPAPALHIVKIRQILSAGYQEMH
FT                   YSGRDPSPQPLVLVWTLCWRAREWFHQCPNNAPHHFSLLYRLELLYTIIILLSPSHRYP
FT                   TLHDYNKALLFDRCMDYISQIHQVLGNPSALPFLTYLDMQRVHQVGRLFVDVLSDNYDK
FT                   LISAAVPAPPSVPAGTPEPPVLGAEDLFNCHARAIRCLSYIRDLLKYCDRKWDMHGHLE
FT                   QFEVESASIEKTLMDGSMGYMSNQMYSQDPLSGMPLAGDAYSGYHIGL"
FT   CDS_pept        join(1077467..1077580,1077712..1078210,1078291..1079053,
FT                   1079111..1080176)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192181" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943576"
FT                   /orf_name="Pc22g04590"
FT                   /product="Pc22g04590 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97747.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831F41"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTG2"
FT                   /transl_table=1
FT                   /translation="MTPSPDSSTGLKSPELHSLEPPDGRIAHTLTACTRCRQRKSRCDP
FT                   GIPRCAPCERSNAKCVYYDSGRDKTVPRTYIVSLRERARALERELAEAENEIQHAADAE
FT                   LMVRGAGRIRFKENDEPRYLGASSGIAMTRLVMEMAKQNTDSKSIKDVVPEFTAQEIKD
FT                   AFAEEDSKPTSKVYPMISSIPQPNLPPKALTYKLIDLFVAKAQALLPTLHEPTFRQEVE
FT                   EVFNGSTDPCKNFQLRMVIAISMQKMSTEYAGLADSYYLAALPYLEPTLKRLDLGALQC
FT                   LVLIASYSMVTPTRTAAYWVVGTAAKLCQDLGLTEEATVTKSPCGKPLNPLEIDMRRRL
FT                   FWIVSSMEFGLSHSLGRCSSYCVSHDHINVKFFELVDDRYITAEGITPGAKPVLAKCIA
FT                   VHFFKMRLLQLEPRRMLYSNRRETPVDDQDPWFSQMLAKIDHWMATTPKNDDGSGLNVK
FT                   WFQGRRNTIIVLMYRPSPQIPEPTVNAAKICYDAAISNIAMHKEQMITGSVDLTWVFVQ
FT                   ALFMALNTVLWTLSYPEIRKEHTIEEVQGHLDMALEVIVFSAERWPGVQSAFLLYRRLV
FT                   AACLKAYRTEESFVVHSPSNHPTPTSSQGMTPPAMSSPSGSTPASYHSNNHRGGNLSIG
FT                   DTASNGTYSRGQSADPTFTQEPTPPAVAPGASKEPPMQSVSSAFGMQPPLTAQSVAPHY
FT                   TSETYVGPTLYPDISIDPNTPYNTIPSVVPGLQGWDPNFSLASTTAGHLAYTDATVDPM
FT                   NWSTIGDQYSQYFNEPFPVPSWRERTLSQQEQIELLASLEHNIPDVSAQLVNEYNAYYQ
FT                   S"
FT   CDS_pept        join(1081181..1081832,1081947..1082321,1082354..1082619)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192170" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943577"
FT                   /orf_name="Pc22g04600"
FT                   /product="Pc22g04600 protein"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAP97748.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="InterPro:IPR013942"
FT                   /db_xref="UniParc:UPI0001831F42"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTG3"
FT                   /transl_table=1
FT                   /translation="MSDRTHPASFQARPPSPSSPAGSLKENHRLPISSEHIPQTPTSPP
FT                   LMSVSEQSHAANFISSHTSPNQATVQPPNISSPPSSAPMSTQVSQQPTMSTKNSFPTPA
FT                   SSVSGHPVNATSEDVDQGRKSFNIGIQDSAENSGAGAAQQPAQQQTQHRPTDHDRQSLQ
FT                   TDRTNDFAAGQGQHSTDPDAMDVDTDPTRRANTLSLDLDSLQKELTSAFHLCKRSPIVT
FT                   GPDPSVDLVSLYGLGPIANSVARTDPVTGEKINRLRKSYEGKLKGLGLAGRNKPHKQEI
FT                   GAPGSLRHMTLWPEEEWQNQKVHGKAIKVADMDSALQNLQSRAMQMEPGPIPNNDFWED
FT                   ILGETGKKAAAAPSAGRSSTQSYAATPQAQEAERPRPSRGRKRHYDDNSFAGYGEGFVD
FT                   DDDDPGFYSNGEGTGKKKRKKVLHSHGNLLC"
FT   CDS_pept        1084302..1085702
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160769" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823349"
FT                   /orf_name="Pc22g04610"
FT                   /product="Pc22g04610 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97749.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0001831F43"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTG4"
FT                   /transl_table=1
FT                   /translation="MPSPIPQPQGLPILGNIFDMIPGNTWASLNKLAAEHGGAGIFKIK
FT                   ILTKQLIFITNAALLEEVCDEKRFRKCVTSPIVEIRSLAHDSLFTAFDNEESWGIAHRI
FT                   MAPYVLPEAIKEMHRDMQLTTDDLIWKWTSTDSTRQRIDVVNDLDRLNHAANMKCFFSQ
FT                   HVDCILGEEPSVIKAMADTTFEAVRRPTRPKLLTRLLYQSAFDKDIKTCRDYCAQMIAK
FT                   RRNDPIEQRDLLYALLHEKDPKTGQSLPDSRVIDEIINILIGSATTPNLVSFTLYYLAK
FT                   NPDAVTRAREEIDALIGPSGQIEHFHLSQLPYCEAILRESFRLCAPAPGFNIEPLPTDG
FT                   PVLLGGGEYEIPKTQPMIAILAAVNRDPAIFDDPNAFKPERMLGEAFDRLPSGVKKGFG
FT                   NGKRECYGKRYAWEWSLHALVRIIKDVDFELADKEYTFDMEGKNFNGAFTVKPYGMFAR
FT                   TKKRNAVA"
FT   CDS_pept        join(complement(1086262..1087137),
FT                   complement(1085920..1086210))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205012" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127636"
FT                   /orf_name="Pc22g04620"
FT                   /product="Pc22g04620 protein"
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP97750.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI0001831F44"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTG5"
FT                   /transl_table=1
FT                   /translation="MALDDPLNLNQYKTTISEPKKNWVYSSNEKQKLTCFYKDQNEMIE
FT                   CFLGASEEERLKAEDEAQNGGKVKLAVRASFTVNFFLFVIQLYAAVTTGSLALFATAAD
FT                   AFMDLVSSLVMLVTSRMSSRPKPYKYPVGRRRVETMGVIMFCALMTIVAVELIIESAKA
FT                   LAAGKTESEQLHIVPLICVGIAIFSKLCMCIYCYGLRRYPAAHVFYIDHRNDLAVNGFG
FT                   LVMSVVGDRFVWYLDPVGACCIALLILFSWASTAFENMWLIVGKCAPREFVNKCIYVTL
FT                   THDQRIQKVDTCRAYHSGQQLYVEVDIVMDPETKLRESHDVSQALQRKLEGLADVERAF
FT                   VHVDYDYMHDVNEEHRPLYEIGGAKSSIRALVKRLWSKSEKQTDGTAV"
FT   CDS_pept        join(1087165..1087282,1087387..1087437,1088214..1088278,
FT                   1088381..1088455,1088549..1088611,1088721..1088816)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943578"
FT                   /orf_name="Pc22g04630"
FT                   /product="Putative uncharacterized protein Pc22g04630 "
FT                   /protein_id="CAP97751.1"
FT                   /db_xref="UniParc:UPI0001831FF7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTG6"
FT                   /transl_table=1
FT                   /translation="MVAQCKTLMVQYRAQDGDQIRQKIFLRSKVSGLARTPSLGISATK
FT                   LARSWESWDFSGGNRKSPGYPDEFSDWCHKAVHEVHRAGSQNQGRKGNAIQFPIRSMEA
FT                   IATNPKAKLRQLRKRSPWPKAYHIQTLGSEQTKEYCPVIGSFDFPPYIPTP"
FT   CDS_pept        join(1089008..1089164,1089224..1089934,1089999..1090642)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178887" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943579"
FT                   /orf_name="Pc22g04640"
FT                   /product="Pc22g04640 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP97752.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831FF8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTG7"
FT                   /transl_table=1
FT                   /translation="MASKVLQNNTNSNWMKDPGLRRLNLGIGFMLSASATAGYCASMIN
FT                   GLLVLPEFSTFLEGLDANERGLIIAAVSLGSFCAFIPGSYIADNLGRRICVLIGSSLVI
FT                   IASIIQISTQDHWVFFGARVLAGMGVGISQTAAPLLITESSHPRQRQTFTGLYNALWFI
FT                   GSITSATIGFAGLTIAGSWSWKLPCLTQVFYPVLQLIGLCFVSESPRWLVSRGRKEDGM
FT                   AILARYHANGDVNDELVQDEFYQICKSINAEADKSCRRWSSFFATRSNMHRLSICVILG
FT                   FMQEWSGNGVVSYYLAPILESVGIYNASHQAAINISMQVWNLCFAVGGAMAADRYGRRK
FT                   LWLSATMLMFIYLSAATTMSGLFQELHVLEAGIAVVPMLFLFCSAYDMAYMPLFIAYPA
FT                   EILPFQLRAKGLAITLTTDSMACFFNQFINPVALDAIHWKYFTVYLGCLVIFMATIYFL
FT                   LPETKGLSLEEVARIFEKEKPYQVETPSDVSQELLVFPKKSSTSS"
FT   CDS_pept        1091203..1091790
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142761" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943580"
FT                   /orf_name="Pc22g04650"
FT                   /product="Pc22g04650 protein"
FT                   /protein_id="CAP97753.1"
FT                   /db_xref="UniParc:UPI0001831FF9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTG8"
FT                   /transl_table=1
FT                   /translation="MTKFETALERIDAAHADDPRQTQTATGPIPYELHYAQKMTSYLST
FT                   LNPSAPELLQLAIRAQHLRRWEVPRDSYPATKIGYHSWRAGLQRRQAALVEQICVESGY
FT                   SAEEAARVGALVRKADLKQGDPDTQTLEDVACLVFLDDQFDKFEAELADEEKMVDILRK
FT                   TWAKMSERGREEALEIQLSDKAKKLVGIALSG"
FT   CDS_pept        join(complement(1093044..1093107),
FT                   complement(1092631..1092982),complement(1092070..1092577))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000096548" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943581"
FT                   /orf_name="Pc22g04660"
FT                   /product="Pc22g04660 protein"
FT                   /protein_id="CAP97754.1"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniParc:UPI0001831FFA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTG9"
FT                   /transl_table=1
FT                   /translation="MAFLFIKQKLFPTKDADTIRSGKRLLTRIDDDDTIRGDSDQDLES
FT                   QSTRSYDTFGRCNSPDESTSTTTSNSSTRVRINPRIVSDAILGLSDGLTVPFALSAGLS
FT                   ALGNTKVVVLGGLAELAAGAISMGLGGYVGAKSEAESYQTTVRETQQLIQTDSQETRAM
FT                   VCETFSPYGLSDSAVAEITRDLHASQDRLLEFLIAFHHRETAPDCNQAWTSAITLALGY
FT                   FIGGFIPLIPYFIVSQIMAALYWSIGVMAITLLVFGYVKTCVVRGWSGRANVMAAIWGG
FT                   VQMCCVGGVAAGAAIGLVRFIDMGST"
FT   CDS_pept        complement(1094510..1096834)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191443" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943582"
FT                   /orf_name="Pc22g04670"
FT                   /product="Pc22g04670 protein"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP97755.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR022783"
FT                   /db_xref="UniParc:UPI0001831FFB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTH0"
FT                   /transl_table=1
FT                   /translation="MESPSFSGQKRKVADMSSDEEDARPTTGFRGFARAASRSVTPPTM
FT                   GGLGSGTHNNRNTMANSRGGGSSRGGKAMGGGGRGGGANSFAARMMAKMGYREGQGLGT
FT                   TGQGIVNPIEVQARPQGAGLGAVSEKSKKTREEERRAAAQRGEILEDSSEEERQRRRKK
FT                   KEERKAQGRSATGTPIQRAKPKFRTAREIEDDMEGLEVPNVLKSLVDATGKEQRVLTST
FT                   AGLMSTQQFVSQEEGEALKITQRARNDLEAFADEWKGLKERKQYIELEEAQVVDELDAY
FT                   QSRINHLTGLIAAVEELDIFENDESIATKFNELTDKLEDLESKYRDAVDEHRLPETAVA
FT                   ALHPLFRQAMEEWEPLQDPTFLVSNLTRLQPLLSRTNGLEEPRKRASTSPYETMIYTLW
FT                   LPRVRSALLNDWDVYDPSKATALVVAWKAIVPPFVYANVLDQLVVPKVGLALKNWKPRV
FT                   SRRHPGSEQDGKFPWWLFTWLQYLDERHTNPKQPAGLMSDAKRKFRSVLDTWSLRKGLV
FT                   DRVEIWRDALGSEFDVCLRNHLLPRLARHLREDFTVNPQDQDLTALKDVLCWKVFFQPN
FT                   VMGLLLVSDFFPKWHEILYIWLTNDPNYEEVGTWFSWWRAQIPEEVNELTIVDDEWNKG
FT                   LQTMDLALQLGDRAAAELPRPTTARAPLPTREDKVAAAAATAAAAAPEPRVKAPVVEEV
FT                   AFKDILEGWCLEQGLIMLPLREAHPQNGQPLFRITASATGKGGVVAFVQGDVVWVQNKK
FT                   AKEIWEPMGLEDQLVERAEGR"
FT   CDS_pept        join(1097138..1097261,1097354..1097760,1097823..1097890,
FT                   1097942..1098029)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000013583" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943583"
FT                   /orf_name="Pc22g04680"
FT                   /product="Pc22g04680 protein"
FT                   /function="metal ion binding"
FT                   /function="superoxide dismutase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /protein_id="CAP97756.1"
FT                   /db_xref="GO:0004784"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="UniParc:UPI0001831FFC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTH1"
FT                   /transl_table=1
FT                   /translation="MAALLSNSARVALRSGASATSKAGAAGLTFARGKATLPDLSYDYG
FT                   ALEPSISGKIMEVHHKNHHNTYVTSYNNTLEQLQEAQAKGDIATQIALKPAVNFHGGGH
FT                   LNHTLFWENLAPKSAGGGEPPSGALSKAIDSTYGSLGEFQSKMNAALAGIQGSGWAWLV
FT                   KDKQTGQIGIRTYANQDPVVGQFQPLLGIDAWEHAYYLQYQNRKAEYFSAIWDVINWKT
FT                   VEKRFT"
FT   sig_peptide     1097138..1097242
FT                   /db_xref="UniProtKB/TrEMBL:B6HTH1 "
FT   mat_peptide     join(1097243..1097261,1097354..1097760,1097823..1097890,
FT                   1097942..1098026)
FT                   /db_xref="UniProtKB/TrEMBL:B6HTH1 "
FT   CDS_pept        1098305..1099750
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191454" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943584"
FT                   /orf_name="Pc22g04690"
FT                   /product="Pc22g04690 protein"
FT                   /protein_id="CAP97757.1"
FT                   /db_xref="UniParc:UPI0001831FFD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTH2"
FT                   /transl_table=1
FT                   /translation="MSAESPGQKNGFKSFFSNALRPKKSRQTLRKGSRSTTDLRLAARS
FT                   SIEEAPPMPELAPLHAHRLKYRELHAQVDSQLGERRDYTEIIHTLGALDLNDVSSPTHE
FT                   QNDRRPPGEGDIASLPPKLWAQIAGYLNPAEAASLAMASITLYRRLGPRYLMALDHPDN
FT                   HTHKINFLSNLDISLPHHLLCFPCVQYHRRTQEGTERIRPSHVLNPLFNCPNSRNALKP
FT                   PPRHRITHGRNLPFAFVQLAMRAHRFGPTYGLAPDALGRRWQRDDWSHTSRFHIHEGRL
FT                   LMRVTSQTFAAPALTPSAQRMLLYSREDYCPYFSVCAHWRDGELMPACKCALEHIPRPR
FT                   SSGGLQALEHRVKDRIAGQAFDPNALTTLCGFCRPMRRCPECPTEYLIEVKLSEDLVDR
FT                   RFKQSIVITRWSDLGDGTTPDGIEWGAINGKRDDYDSFAHYAKRGIASIFEAAFTADTL
FT                   PGQRVVSLNPKKKKLGEEGNKWY"
FT   CDS_pept        join(1100293..1100474,1100536..1100608,1100682..1100792,
FT                   1100842..1100898)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943585"
FT                   /orf_name="Pc22g04700"
FT                   /product="Putative uncharacterized protein Pc22g04700 "
FT                   /protein_id="CAP97758.1"
FT                   /db_xref="UniParc:UPI0001831FFE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTH3"
FT                   /transl_table=1
FT                   /translation="MSAPQIPSAGNNDYPDPGPNPGPKFGTSTSTVTSTGTDSTHKNSY
FT                   GSYWRGYSINPPRHWAQSKKRICDCENHNQEEWPFDFAELIIAPCACKCPFCNDFNKAL
FT                   KTKHMASNLRRHITKTHIEGNPDFYGTLVVAPGGMK"
FT   CDS_pept        join(complement(1104451..1104577),
FT                   complement(1104216..1104356),complement(1103893..1104146),
FT                   complement(1101480..1103834))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191465" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943586"
FT                   /orf_name="Pc22g04710"
FT                   /product="Pc22g04710 protein"
FT                   /protein_id="CAP97759.1"
FT                   /db_xref="UniParc:UPI0001831FFF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTH4"
FT                   /transl_table=1
FT                   /translation="MDGKTQRRSSAAGQPAPSHSQGPVYHPNTAPKRIVSSKDHSSKRP
FT                   QHPSLSRVKGRANMFTPPRMNAEVSWLRDQSPIHSGTKTPIRSSETPEPGTPTLVNPAS
FT                   ALLQDLLKEERAHRSSRGTISDEFKENAPQTPETTRTQEDTASEKARKASDVFSAGQRK
FT                   PKEMGMREMDQYVSKMNKLNFDLKLEVFHRTQQMAIYEKKLERMAEMEEQLAHMDELIA
FT                   EVEELRTTEKDNQILRESNEQLRIDLDKRDMAVTEAVELICQLESKIDMLENGGRASRL
FT                   SMSRPMTADGSEALAAKSRAMVDIPERTSSKRNSSVLSVAQRQTSSELRKLSKAPSFLR
FT                   ADNKSTATLRSLYTPEEETQSRTAKTELTKSESFHTTTEVMEPESPRLSVLSECSELNP
FT                   FDTPTRWQEFDQLELPVRRSSSTGSLDSYVPPTGREESKKDQIDRWMQSREDINQTIIT
FT                   RRRNRSSSDATKASIPSFTTDLYAPKPRGRGRLDSSLFGGVRLPPTPDTMSTAYATGAN
FT                   RSNGSNGSIKARKSPQTEQDLFFSGRRVNRPRSAEEMASRSSFDGSEVDDSMQTNCSDT
FT                   PRLGVTSDESRTILPSFNTVSSKASALLGPGSPNNPAIETFGDLYHAKPNEASTPTIKR
FT                   VRSPTKAMTPEANTNDRDSPSPLTPQDWVAAAKQGPRCCKPKPLEIHQEIQQPELPART
FT                   AVRPASLHDDSSIASDPSEPEVPGIPTLDMTTLDILEQPLDLGQSKPKPEANPEPRRRL
FT                   SFIPPFFNRSSNNPRRVQGSPVPDEFEDDEEGAPSPVIPKTRTMGGASQRPMSQIITAP
FT                   TDLYSSNPPIHNGEPPHGFRPRGFPQSLTMSTLADHPGSATVSGRPSTSHGMEHKRRSS
FT                   LGIFGWMKGKRSDSVSVPGVEKFIDSAPKENRAPSRLAYETSHGLGIPRAETPDSMEAH
FT                   VRPHSEMAVHSDEHSRRPRYMGRRARRG"
FT   CDS_pept        join(complement(1106706..1106747),
FT                   complement(1106562..1106630),complement(1106445..1106503),
FT                   complement(1106170..1106359),complement(1105991..1106099),
FT                   complement(1105856..1105923))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943587"
FT                   /orf_name="Pc22g04720"
FT                   /product="Pc22g04720 protein"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97760.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="InterPro:IPR010492"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="UniParc:UPI0001832000"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTH5"
FT                   /transl_table=1
FT                   /translation="MSYYDIDSILTDAQKLPCTFELEVPGLGILEGNAGEDIKAGTRID
FT                   LPLWLGEMLSIGARLGTSRLVTLDMPEALSERVMNALKADPRTLDLRALAPHFYNLSER
FT                   ILELFEEEEMVDVLGDAFKKRAADIADHAHNSRGAVGGGVDFLRGLDETERQLFRVAHD
FT                   RAKDMRIWTGEAKRK"
FT   CDS_pept        join(complement(1108160..1108166),
FT                   complement(1107450..1108105))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000063193" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976556"
FT                   /orf_name="Pc22g04730"
FT                   /product="Pc22g04730 protein"
FT                   /protein_id="CAP97761.1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI0001832001"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTH6"
FT                   /transl_table=1
FT                   /translation="MSKHQDKSAPLRMGVVLFPGFQALDVFGPVDCINVLSWSHSVTLA
FT                   LISSTLEPVTTKSPASANAIGQNVVPTHTFATAPSLDLLLVPGGLGTRGSNPAIEEAIL
FT                   YIRNVYPQLCYLITVCTGSGLAARAGVLDGKRATTNKMAWAEITGLAVNVDWVPRARWV
FT                   VDGNVWSSSGVSAGIDVTLAWIEEVYGSEVARKISNSIEYTRHEDPIHDPFAELHGL"
FT   CDS_pept        1109600..1110772
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127637"
FT                   /orf_name="Pc22g04740"
FT                   /product="Pc22g04740 protein"
FT                   /protein_id="CAP97762.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001832002"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTH7"
FT                   /transl_table=1
FT                   /translation="MINDKNLLRRASKRNRGLNCAFDTADPLGENRMGGMHIHLRIIFS
FT                   DGNAWLARILRQNYTSFSDSFSNLCLKSECATLEWLKDMNVPSPTLYDFGLLNDPENDV
FT                   GVAYMLIEELPGTPLLFLSPSEEQFRKLYDNYADILCTINKYPLEQIGSLSLRSNGTIC
FT                   MGPVVGDRTGTFSQMGPFRNAREYYATWAERYLELICDRQLFTRYSANAYLIFRYLKEL
FT                   AEQGHWNAFEPSIDNGPFFLKHMDDKGDHILVDEDYNITGLIDWTFTRAVPIYEAFGPS
FT                   PLTAEMSGIYEGKAGRSRGDTILAEALQAKNKHLVRFAGGPDLVRRFSFGLGMGMDISW
FT                   DEAVALFRGIMCTAEGSSLEFDWDAWRQNRLSQWAGDARLQGLLLQLGET"
FT   CDS_pept        1112174..1114780
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191490" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823350"
FT                   /orf_name="Pc22g04750"
FT                   /product="Pc22g04750 protein"
FT                   /protein_id="CAP97763.1"
FT                   /db_xref="UniParc:UPI0001832003"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTH8"
FT                   /transl_table=1
FT                   /translation="MAYNAVAQVDHEVASISSASASRTPSPAHGHVFEQLPLDTDHIGG
FT                   GSHLEAAKTTDNPSFNQLGSMIRSMTSTSYDVVEDDDYDADPSPEERSNSLRIPPLNTT
FT                   VARHSPPEPPIHSACSEASVPLSHPTPDLQSIQGAYKGNVTRLEQSAEQLSSCSADIES
FT                   EIRRIDQEQKRRSVSSASNSIIHRNGAFSPARTVSSAHGSNMSPARQRSVSGARLAQLS
FT                   EPALDEREHEVDEFPGLPNLPPSQPLFNTQSDYHYDQYVPQGVPAEAELERRASVASND
FT                   TYQQARTLFTDFDGVHFTPLEPGRQVSLEQPPLARKPEHYKQPQAGENMVFYPAPVPRM
FT                   LNLPPKLSRKSNMDRDKRRTQLAGAIAAEDRKSTAVLPDADQTDPRDSNNDKRKSAIPP
FT                   HLRASVFFDQPSTSLQIEVEQESAVATLESILDASANAPVSAFTDHPYAGQVGGFIYKS
FT                   KRKTLTKDLTGQKANRISRAMIGHTYSTNNVDEDGAPVASRRGSEAGNDTDRDHDEHGR
FT                   ERGSEGTDAESDEQSEDEDEEDEEDGELDYIGPPNTLIAELELRKHELKHRRRTAVPVP
FT                   FQGMQTTLLEMDEMVQKQSDKRRQRPVALAWEGRDEDEDVPLAMLYPEKAGAENDDRPL
FT                   GLLAKRQQEENEPLSSRRARLRGEPIPQPEQRPATVYAAEPPAHVPEPTAESEEETEIE
FT                   TLAERLQRLKGHNRSDSKFASDLMAEIDSRAGIAPKAAQEVTAPDEEETLAQRRSRLQK
FT                   EAAAQSGSPKNPRMRRSMAALTQGRPSHLARQSSHGVFNQRPATMSQYGNRMSMQQFPT
FT                   QMGYPTPAGYPMAQQYGYPMGPAMMGTNGVGYAPSMAETPGPVKTEVINRWRQSIR"
FT   CDS_pept        1115369..1118359
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943588"
FT                   /orf_name="Pc22g04760"
FT                   /product="Pc22g04760 protein"
FT                   /protein_id="CAP97764.1"
FT                   /db_xref="UniParc:UPI0001832004"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTH9"
FT                   /transl_table=1
FT                   /translation="MPPSTVFSYWRRDHRRSSASPASIPAPSPVKGANGSPISSPPQLR
FT                   QIPDTPTLTTTFDSHSSPDGPSNESPLDIDTSKLNISSSVAPLSSSITLAVPSPAFERE
FT                   NRPHSSPGDSGEEQFTSQSNNSQLSVTGRRADQGDADSNFKSSSPFRRSFAKQKRSPTA
FT                   PTGSGHFRFRSSPDDSPDKQTMPQKDFKMDGVPVDQTHHKSGKAMLHLLNPMSLLARRR
FT                   SSQVIGSRTEDIKIKNRDVPAMPDDYDPRIRGKIIHDFSAPRPRRNISATQPDTGVNGQ
FT                   DTSPPQIPSQPRAASWNDQIKRHSDHSPVFKEHFEDQNVLQVENKGYLQSSLLTGQSQP
FT                   GYDSSLPVFARNLPSHLPERTIDAPEQLEPGAEQPPSPPKAVSHAHPQQPQDQDTIPNV
FT                   PFNPSALPRHLKSNASRFSFDMSGVESSTQEKMLEEKHKAKEASRRMEDGYFDDFDEDF
FT                   DDDMMDDLDGLEEKIPGVNADADDDDFDDFSVSRNINEPKSWAIPGLSPVVASPVTAAP
FT                   PEPTNTSHLTSEATQLDDGPSQQIPDQQPSLGATTDATAIIPQAPITKQPTQILDDDDD
FT                   LYFDDGDFGDLDVNNQDGGFDESIFDDVNSHLYERKRVVAPAAPLATDSADPDEDDSSL
FT                   GKESPVAERGSQGLQHMPSVASDYRATGSVKRGPLGEPIPNMGPVRAHGAGVLTEQNLD
FT                   ILHNALAFAANEASYSGRFERTFSTSERSQGQESAAQTSQTIDSQPGLVSDDSRITQAA
FT                   DAMAFEDVFDTQVYDDQFYDDNDDAYFDDAIVAAANAEALENDDDGFYGQEFGFYAQAD
FT                   GTGASELTNGGYFGPRRVEGITRNHSSRGKFQEPSLTPITEKSEWSTRNSMISVKAHGG
FT                   THPNSALASPGLAQLVDMGNLDDEMSLSALLKLRRGAWGGSNGSLRSTAGSSPPHTISP
FT                   SHRASLNGAEASPTVSEPRPFSSGEGASNGVASFHDDSHTRTASPLSGRPDSEEIPTSG
FT                   PQRLNVL"
FT   CDS_pept        join(1119147..1119368,1119485..1121529,1121585..1122500)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000259586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943589"
FT                   /orf_name="Pc22g04770"
FT                   /product="Pc22g04770 protein"
FT                   /function="oxoglutarate dehydrogenase (succinyl-
FT                   transferring) activity"
FT                   /function="thiamine pyrophosphate binding"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAP97765.1"
FT                   /db_xref="GO:0004591"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="UniParc:UPI00018320C4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTI0"
FT                   /transl_table=1
FT                   /translation="MFRNTALKATNSGMLRGATASSSRRSFHLATSARSASKSSGFSMT
FT                   ARRPLAVVDRAFNGARSYAAPAEGPSQGVDPNDSFLTGSTANYIDEMYMAWKNDASSVH
FT                   ISWQTYFKNMEEGKMPISQAFTPPPTLVPTPTGGVPQDMPGQGLAAGADVTNHLKVQLL
FT                   CRAYQARGHHKAKIDPLGIRGEAEAFGYDKPKELELDHYGFTERDLDQEFALGPGILPR
FT                   FITESRKKMTLREIIAACEKIYCGSYGVEYIHIPDRKPCEWIRDRFEIPQPYNYSVDDK
FT                   RRILDRLIWSSSFESFLATKFPNDKRFGLEGCETLVPGMKALIDRSVDYGIKDIVIGMP
FT                   HRGRLNVLSNVVRKPNESIFSEFAGSTEPSDEGSGDVKYHLGMNFERPTPSGKRVQLSL
FT                   VANPSHLEAEDPVVLGKTRAIQHYNNDETNYDSAMGVLLHGDAAFAGQGVVYETMGFHS
FT                   LPAYSTGGTIHLVVNNQIGFTTDPRYSRSTPYCSDIAKSIDAPVFHVNADDAEAVNYVC
FT                   QVAADWRAEFKRDVVIDMVCYRKQGHNETDQPSFTQPLMYKRIAEQKAQLDKYVEKLIA
FT                   EGTFTKEDIDEHKKWVWGMLGDSFDRSKDYQPTGKEWLTSAWNNFKSPKELANEVLPHL
FT                   PTAVPAKSLQHIADKISGTGVPEGFELHRNLKRILAGRKKAVDEGKNIDWATAEALAFG
FT                   SLVDEGYHVRVSGQDVERGTFSQRHAVLHDQQTERTYTPLKHVRDNQGSFVISNSSLSE
FT                   FGCLGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQFIASGESKWLQRSGLVVSLPH
FT                   GYDGQGPEHSSGRMERWLQLCNEEPRSYPEADKLDRQHQDCNMQIACMTTPANLFHILR
FT                   RQIHRQFRKPLVLFFSKSLLRHPLARSDIEELTAEDSHFQWIIPDQGHGTAIEAPKDIE
FT                   RVILCSGQVYAALTKHREANGIRNTAITRIEQLHPFPWAQLKENLDSYPNAKDIVWCQE
FT                   EPLNAGAWSYAQPRIESLLNATEHHNRRHVLYAGRAGSASVATGLKAVHLKEEQDFLEE
FT                   AFSIHQDHLKGE"
FT   CDS_pept        join(1123193..1123561,1123674..1124314,1124367..1125109,
FT                   1125159..1125217)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191512" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943590"
FT                   /orf_name="Pc22g04780"
FT                   /product="Pc22g04780 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP97766.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00018320C5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTW2"
FT                   /transl_table=1
FT                   /translation="MSAVSSSVNNPPGQGIRQSARQTRTNPSRTSKTIGRSSFAFGRGS
FT                   TAEIPSTPPVPHGFYPALTHFTDAITALPREFRRHNSLLKEVDAKAWALEENLLQLLQF
FT                   SSESQPVPHPPHPAPIIEGSSESPESKNRRLLFDRVRQSLSDLMMTADEKNHVISNANE
FT                   ELDRQVVRLDTVFPYIAGEISEEARLGSLTHWAYSNKSTAKAATNERPRREAVAQRQDL
FT                   SHVLQEAEAASRSEARRDAVLARKQRRAQPDADYEDTRSSGARKTNNAKSRGGDHAADP
FT                   NAAPKRRKVERPVPVDTSVPMERSASGATSQRAANKDPAEKKRSRAPNQAAAARKKANA
FT                   SNAASPVLAPSPLIGTFNGPRGAASPGPNTSRPQSSRAQQNSGPSNPRARPSSSASNLP
FT                   SNSMPLQPPLPEFPINHIPYTDKIADSRSTTRDGPVKYELADTHRDYEGETNGRTSVPA
FT                   GSKREDLDGKAGSVEVETTKGRNSKTSTPILPAFTEPSQHARPTRSRDPASTKRTQKKP
FT                   IPQPAIPSDDESLHEGDDEDEEGEPRYCYCNEISFGEMVACDNDACPREWFHLSCVGLT
FT                   KPPGKNGKIKWYCNECKENMRRSRNGR"
FT   CDS_pept        join(complement(1126408..1126674),
FT                   complement(1126096..1126277),complement(1125612..1125996))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000191523" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670584"
FT                   /orf_name="Pc22g04790"
FT                   /product="Pc22g04790 protein"
FT                   /protein_id="CAP97767.1"
FT                   /db_xref="UniParc:UPI00018320C6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTW3"
FT                   /transl_table=1
FT                   /translation="MLTSGLTNAPLTKSLLIYTIASSIALSLFDIKHLAVIYVSPHIWP
FT                   YAQFWRALAWQVAGFTNSTEALFAAMLVYHLRVVERAWGKRKMATFLLTTLPYTTLLPP
FT                   ILLALLIRPLSLNNLNYLPSGPTATIFALLAQYHATIPYTYRYRIGLSLLLSDKSTTYI
FT                   VAAQLALSQFPAMLLPSAVGWVVGVAWRAELLPGLSPASTGFRIPAWVVGEQERRGGPD
FT                   SGSGGAERERYEDLRRRLEGEVASASGLEGSGAQAQRRANSAEAGAFVNRLTRDW"
FT   mat_peptide     join(complement(1126408..1126593),
FT                   complement(1126096..1126277),complement(1125615..1125996))
FT                   /db_xref="UniProtKB/TrEMBL:B6HTW3 "
FT   sig_peptide     complement(1126594..1126674)
FT                   /db_xref="UniProtKB/TrEMBL:B6HTW3 "
FT   CDS_pept        join(complement(1128817..1128955),
FT                   complement(1126969..1128758))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191534" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823351"
FT                   /orf_name="Pc22g04800"
FT                   /product="Pc22g04800 protein"
FT                   /protein_id="CAP97768.1"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013876"
FT                   /db_xref="UniParc:UPI00018320C7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTW4"
FT                   /transl_table=1
FT                   /translation="MSPRGAASYKKKDGTIAISADEKSVSWSPAVAGAGNMITIPVVNI
FT                   TNLQQTPASNPKVMLKIFAQAPDAPPDSTPDQYVFQFTAGADARPQADVIKDTLSARIN
FT                   SAKSATPSQTPGPRGGSEGLSAAMAIANAVTSAGTSKSPLDDENKLRSDIELQQSLLRS
FT                   DSNLQRMFFEGLHTKPEALSSGSFVSQFWSTRLHLLRAHAIEQGQIRGSYNVLSSLKPR
FT                   VEDNVTRLNISKEQIQLIFSQHPLVKRVYDENVPKLSEQQFWSRFFQSRLFKKLRGERI
FT                   TEADATDAVLDKYLRTDEGAKPDRDTNIHHFLDLAGNELNHSQRRGNRPELDMRPSGVD
FT                   KVPIIRTLNSLSEKIMANVAPADGDMSAPIGINEEAWKKLQLQDLRGEEAQSRITLNIR
FT                   DQSRFFTHGQEEDKTKQFAKQDPDQLLQTLRAEINQNLPSQGNTQLRKLVDPGDDEDEE
FT                   MEDAPASRRPVGSSAALHDAFSQLLEALRVRRAQMTERAASETYGLSMALFDRLTLTHA
FT                   TTTEFLHQFWQAFLSGNPDRAGEVASLAESLQRARERIEAVANDAEAERKVEVDRLKKQ
FT                   ARDVYESTGRKLRVNLEGVEGGQKVVNQLLGPTLHALEVASTRYQRELAEQKSKEAAIA
FT                   SQEMAGT"
FT   CDS_pept        join(complement(1130142..1130217),
FT                   complement(1129598..1130031))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943591"
FT                   /orf_name="Pc22g04810"
FT                   /product="Putative uncharacterized protein Pc22g04810 "
FT                   /protein_id="CAP97769.1"
FT                   /db_xref="UniParc:UPI00018320C8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTW5"
FT                   /transl_table=1
FT                   /translation="MSIFDDALAPPGACMTSPTAREVITDYEEEENRRDQKRIHAMAVR
FT                   VGVSVYMDVIQKLPNPLSNEAEERTLNLIRVVILRAIARPGKVTQAGYCDNGFPGYGPV
FT                   VMRNFAAGLKKVLEEVDFVDYNYNHNQKVLKDALRKAILKEARPMFEEILIEVRKKKLE
FT                   KFFKYG"
FT   CDS_pept        join(complement(1133480..1133666),
FT                   complement(1133079..1133423),complement(1131636..1133029))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191545" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943592"
FT                   /orf_name="Pc22g04820"
FT                   /product="Pc22g04820 protein"
FT                   /protein_id="CAP97770.1"
FT                   /db_xref="UniParc:UPI00018320C9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTW6"
FT                   /transl_table=1
FT                   /translation="MTSITPAPSQSKPAFPRLSSIPCGDHFHSRDSSPSPCSTPDGSRS
FT                   SSQRRPSFGSIKEDTEDGIAQSFVDTQQAPSPKEQDQQRKVERPFQMQQTPDFCCPCGG
FT                   FLGWKQIRLGGKSLSRSYSDLRGLGNLQAKGWAWEAQEPEKMELLPPKVPEAEVLQQTP
FT                   PGTSALERLPPEVLDQIISNLAIDLPPNGYAPRNVDLVSCLLTSHTLHAATLGVLYRNM
FT                   TFPHSIIFSKALNHMSQYPALGTLVRRLDFSHFTSVGLGRTKQMNAEIQNLTSRTLLQC
FT                   LELLPNLKECLLQEHLEGDISVDVIRKLFMGLPNLRAVDFCGCSTQAFSGVFQEALVGG
FT                   PALSMTLPNLKRLSLHECSTIPAPMFDYLLPRLVNLTHLDLTHTQVNDSALVAIPETAR
FT                   ISHLSLSRCTRLRPCALVKFLTTHPSVNESLVYLNLLTDPTRFRLLEETDVSALLPNLP
FT                   DTLRSLNLGGAKVTSDHVPHLVPLTKHLEELGLSSADLSVTDVNSFFGRYRNPATGVEI
FT                   NAPSTLCYLDLAKVPQMTIGAIFNTSTCLLLSDQSYPLQVVEFSDKIITPLRERAKTQR
FT                   VSVGWTVRDLGRRGWYVREPASMPHEPLDDGARYWKMGARWWGMRKIPMAVGEVGGLYG
FT                   HYMFKK"
FT   CDS_pept        <1136586..>1137279
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(1139403..1140860)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184411" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976557"
FT                   /orf_name="Pc22g04840"
FT                   /product="Pc22g04840 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP97772.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR006353"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00018320CA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTW7"
FT                   /transl_table=1
FT                   /translation="MTRFEDSDLAVDPASQDPRAQDPQGALSPRDQRAASGLAIPSASG
FT                   NTVEIPATRSAISDAAQFMHNLSLSPSMKDRRGSRNSFGTSLPIPRSPRLSRLSSAQRG
FT                   RPSVSRDILASQVQDINKEKTAKAKNMAFAFDIDGVLAHGNHAIEEAKVALKMLNGDNE
FT                   LGIRIPHILLTNGGGKTEEARCTQLSEILEQPISTDQFIQSHTPMQALAEYYETVLVLG
FT                   GEGFKIREVAENYGFKNVVHPKDLLAWDPSISPWATLTDAERAEAKPRDFSQMKFDAIM
FT                   VFADSRDYQTDFQVIMDLLLAEDGKLMTKAKDPVATRIPIYFSQGDLLMPTEHKGLPRL
FT                   TQGAFRISVEAQYKTLTGVDLERVVYGKPERATYTYADEVMKAWMEELHGVARLPDNIY
FT                   MVGDNPASDIIGGNMYGWNTCLVRTGVFQGKEGENDPNSPANFGVFNNVLEAVKAAIAK
FT                   ELGADFKLKWDPKVNPVTHGEGASAIE"
FT   CDS_pept        join(1141992..1142399,1142456..1143025)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943593"
FT                   /orf_name="Pc22g04850"
FT                   /product="Pc22g04850 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP97773.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI00018320CB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTW8"
FT                   /transl_table=1
FT                   /translation="MSSGKTFTLSNGVTIPAVGFGTFASEGSKGETYAAVTAALNIGYR
FT                   HLDCAWFYLNEDEVGEGIRDFLKANPSVKRSDIFVTTKVWNHLHRYDDVLWSINDSLER
FT                   MKLDYVDLFLVHWPIAAEKDGQEKPKIGPDGKYVILKDLTENHEETWRAMEKLYADGKA
FT                   KAIGVSNWTIPQLEAMAKFAKVQPMVNQIEIHPFLANDELVQYCFSHNILPQAYSPLGS
FT                   QNQVPTTGERVSENKTLNDIAEKGGNTLAQVLIAWGLRRGYSVLPKSSNPKRIESNFKS
FT                   IELNDADFEAVNEVAKTHHCRFVNMRDTFGYDVWPEETASGLSI"
FT   CDS_pept        join(complement(1146839..1147376),
FT                   complement(1146143..1146742),complement(1145130..1146079))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191556" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670585"
FT                   /orf_name="Pc22g04860"
FT                   /product="Pc22g04860 protein"
FT                   /protein_id="CAP97774.1"
FT                   /db_xref="UniParc:UPI00018320CC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTW9"
FT                   /transl_table=1
FT                   /translation="MENHPPSPQAWYVNSFFLPFDPIFVFLFVSRESFAPLTQGFGLFP
FT                   LYFETHRHIDLSLTQAASRASSSANPPTESSFSFTPIKALSALPRLWDRKPSTPVRAGD
FT                   KTRKLWKRIRFPFTGMNTATAAQASGIGASKNSDYQRGVKRLCVDPADADRETEAEQRG
FT                   RSFLETKWEMQASRKRRKMPEFNFNIHEDGSNEVFGFTANQPEGTPKDVVGDVATNASP
FT                   QPRSDLWKTSKTPVYNDAMATDEDLTASDSKTVHDLQSGSSIQDAPTVVDNAEEDKTNV
FT                   VSTTESVQDLTQEQEIKLVRSALRSSLDGEDAALLNEFLSKANAKRAAKATYPEDAKST
FT                   EMSSSPEESSEVECSTPPRRVLEELTTNSPSPVKLQFSPNIKEEQAPSSPAYRRSTRTK
FT                   GSSTPSMRNTISFRRAKGTEFVFQQRTESQQVAMATKRNTRINKGKSVTPMVALEALAQ
FT                   QSSEEGLQSDNLQNEGSNHKDTNSRGLAKPRKQVSWNEERMAEYEEYKEPMDEEDEEGD
FT                   RCTNDVGATPRPRPASKCLAKKAESGHRSSRSQTQKAAHNADSGATESGPTAPTTAPAT
FT                   LTPRSRRVRRLGDSGILGSGTPVKTGSRSTSKPPAATASIAAVAPSTPTKGRRKLAPKS
FT                   PISSKLPARASTRANKTTDQPFVSGIPTRSSQSTDDGQRQSMLQMSAGCTPTARRVRSR
FT                   S"
FT   CDS_pept        join(complement(1149055..1149064),
FT                   complement(1148534..1148907))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191567" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976558"
FT                   /orf_name="Pc22g04870"
FT                   /product="Pc22g04870 protein"
FT                   /protein_id="CAP97775.1"
FT                   /db_xref="UniParc:UPI00018320CD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTX0"
FT                   /transl_table=1
FT                   /translation="MAIDLLDPRDPDGDSTMTSSVESIRPDDGTRSGARTPTGTSHASS
FT                   AGADVSELSPPGSQTKQEAGAYVGDIATALEQRGGQSAEKTSDSNIAAWKSKRAQEDYQ
FT                   RAMEYVVDKDFKLGMWPFYVYLV"
FT   CDS_pept        join(1149338..1149400,1149513..1149625,1149697..1150345)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191578" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670586"
FT                   /orf_name="Pc22g04880"
FT                   /product="Pc22g04880 protein"
FT                   /protein_id="CAP97776.1"
FT                   /db_xref="UniParc:UPI00018320CE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTX1"
FT                   /transl_table=1
FT                   /translation="MNANSGAVPDAWEDSWESQADKLDSKPTPPAEKKVSSKVTKAQRR
FT                   AEQAEFNRQLWAEAESTETFHFVEARADVPLKQDFKPAVTLLSRKPQLVTRNPSSSRTI
FT                   GATTAGLGQLGLDDDDDSDEEPKPPQPTPEERHAIALKNREEKQRKYEEVRERLFGSPS
FT                   ATASGTSSPGSTTPPRQTQTGEGRARGKGRGGGRDHQKRDSSSASSKSSRHLYDPSTSA
FT                   KSNAPFLQRGGRPQVERNGSDNQAPQQPMRSPRGPDASGRGGFNFNRGARTG"
FT   CDS_pept        join(complement(1152232..1152890),
FT                   complement(1151605..1152160),complement(1151312..1151433),
FT                   complement(1151062..1151239),complement(1150926..1151006),
FT                   complement(1150526..1150871),complement(1150411..1150472))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191590" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976559"
FT                   /orf_name="Pc22g04890"
FT                   /product="Pc22g04890 protein"
FT                   /protein_id="CAP97777.1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI00018320CF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTX2"
FT                   /transl_table=1
FT                   /translation="MDSELRLSSPRLGSSIQINDQSNLQLGQFDPESQTFGSFRPPTEA
FT                   ESQLQNATHAFIRPPRQGEPATNFITTSQSTQHQSHQGHPSNGLASHLQPQGQPSSGIH
FT                   QSQGYNDGIAHAANMSGALHGAAAGQMAPPASLSQNELAMGNNAHQANNSLTTLQSSSQ
FT                   PFQPDFTGLDPGPTDPVAFTGPGELQGFKLVPNPPHLDYWRERLFNVDEMITLSEEEFQ
FT                   TYFPHVDNVYSHRSTQRYKRKPFVSHYWDCRLKGRPPGTPKSDDPEKKKRKRTARERDL
FT                   CHVKIKVVEYFPSSEIANTTHAVEPLPSNILPGMYTFSLNDDPAIRNAQTFGMLTPNPG
FT                   LPPNHPGSNGGRYFTIQRVNGNGANGKNDGVGGGHQHTLEESDRVKKSSVQRYVLKEKK
FT                   DKRTRTDRIMSRAGQKSYHTKATGLAAETAIKHSADVNLRLYGSCFCPFVQRVWIALEL
FT                   KGIPYQYIEVDPYEKPQSLLEVNPRGLVPALRHDDWGCYESSVLLEYLEDLGVGATMLP
FT                   ADPKLRAHCRLWADHVNRHIVPSFYRILQEQDQQKQIEKTQELRDAMEKLLEAAHPKGP
FT                   FFMGPQMSLVDIQAAPWIIRLRRVLKPYRGWPDAEEGTRLASWVNAIETNQHVQATTST
FT                   DELYHDSYERYAQNRPNTSQVANAINAGRGLP"
FT   CDS_pept        join(complement(1153837..1153842),
FT                   complement(1153647..1153764),complement(1153172..1153578))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191612" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943594"
FT                   /orf_name="Pc22g04900"
FT                   /product="Pc22g04900 protein"
FT                   /protein_id="CAP97778.1"
FT                   /db_xref="UniParc:UPI00018320D0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTX3"
FT                   /transl_table=1
FT                   /translation="MDVFRAYTYSTAAWLSLQSLPLITGPSMMVTMLLDETRPVSPMEI
FT                   YFARCLGFSFLTIAVLTVMLTGSIPLTADIKESVTTEEDDPKAPYAVPTLMVTSIFHAA
FT                   CAFYAYTWYVTGGQGLFAVGVAGYSSIAAIGLWCMLFASSHGKISRRNGADKRTTGFPF
FT                   KNSEAAKKHGKGL"
FT   CDS_pept        join(complement(1155479..1155518),
FT                   complement(1154239..1155404))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000191633" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670587"
FT                   /orf_name="Pc22g04910"
FT                   /product="Pc22g04910 protein"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP97779.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="UniParc:UPI00018320D1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTX4"
FT                   /transl_table=1
FT                   /translation="MPSPVSVVCVGMAGSGKTTFMQRINSYLHEKKNVPYVVNLDPAVH
FT                   SVPFESNIDIRDSINYKEVMKQYNLGPNGGILTSLNLFATKVDQIISLLEKRTSPNPEN
FT                   PSAKPIEHILVDTPGQIEVFVWSASGSILLETMATSFPTVIAYVIDTPRASSTSTFMSN
FT                   MLYACSILYKTKLPMILVFNKTDVRDAEFAKEWMTDFDAFQQALRQEEDSGAFGAEGGA
FT                   GGFGAGSGYMGSLLNSMSLMLEEFYRHLSVVGVSSMTGDGVEEFFEAVETKRQEFERDY
FT                   KPELERKKKEREEQTASQRELELGKLMKDMSVSGSSRQPPRKPAEEPETVSEAEDEEDE
FT                   IIKRGLADGEDSDYEDYVGPNAGDDEGLSQRYQAALSGSQSAPTDQDNSFTRYLRASNM
FT                   QK"
FT   mat_peptide     complement(1154242..1155396)
FT                   /db_xref="UniProtKB/TrEMBL:B6HTX4 "
FT   sig_peptide     join(complement(1155479..1155518),
FT                   complement(1155397..1155404))
FT                   /db_xref="UniProtKB/TrEMBL:B6HTX4 "
FT   CDS_pept        join(1155759..1157042,1157099..1157917)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191634" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127638"
FT                   /orf_name="Pc22g04920"
FT                   /product="Pc22g04920 protein"
FT                   /protein_id="CAP97780.1"
FT                   /db_xref="InterPro:IPR006767"
FT                   /db_xref="InterPro:IPR006768"
FT                   /db_xref="UniParc:UPI0001832E10"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTX5"
FT                   /transl_table=1
FT                   /translation="MTLEDFEKSLAEGREQRQEKSEGRHHRDRNRDRDRSKERSRQHRH
FT                   RSSHHHRRQSSRSRDRDSERVRESRHRDDDGHRHKRSRRSDDQGDERGHKRHHRNSKDE
FT                   GEGVPLVVVQEEPKNIKRDAWMEAPSALDVDYVHRPDATRQEEPKPIMLSADYELKIHD
FT                   KELNDHLRDLKDGRTVDEIEDEPAQHEVDYTIGDSGSQWRMTKLKGVYREAEESGRAID
FT                   DIAIERFGDLRSFDDAREEETELDRRNTYGKAYVGKDKPSGELFQERKLQSDIRRDPRE
FT                   HLRDPEQELNAEGQGKKIDTAPPPQTSRHLDMTALNRLKAQMMKAKLRKAPDAANLEEQ
FT                   YNTAAAAMSNRKESDVVVLDVMHNPMLAGARNEVKAIDTKRGRERGQVEANEDMTIEDM
FT                   VREERKTRGQPGGEGRRLADQIGRDAKFENRLEYMDDNASKLAKRVHRSEIDLKNSTIN
FT                   DFHKMNRILDSCPLCHNEDKGTPPLAPVVSLATRVFLTLPTEPEVSEGGATIVPTQHRT
FT                   NLMECDDDEWEEIRNFMKSLTRMYHDQGRDVIFYENAAQPERKRHASMEVVPLPYSLGE
FT                   TSPAFFKEAILSAESEWSQHRKLIDTLAKSKQGLGRSAFRRTLVKEMPYFHVWFELDGG
FT                   LGHIVEDSHRWPRGDLFAREIIGGMLDIAPDVIKRQGRWNRGDRRVEGFRKRWKKFDWT
FT                   RILVEG"
FT   CDS_pept        1158234..1158599
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670588"
FT                   /orf_name="Pc22g04930"
FT                   /product="Putative uncharacterized protein Pc22g04930 "
FT                   /protein_id="CAP97781.1"
FT                   /db_xref="UniParc:UPI0001832E11"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTX6"
FT                   /transl_table=1
FT                   /translation="MVYEIPVDCAALSRQERDRLIAEGANPASVILQSELHNHIIRREG
FT                   KSVGDYMKRYSDDMNAMIRRGVSILNDLLTADMVPSGFRTEDGRFFDLGPESGATKGEY
FT                   REFGQWLLEVSDSRTDI"
FT   CDS_pept        join(1159023..1159075,1159143..1159357,1159419..1159828,
FT                   1159889..1160128,1160180..1160278)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000136700" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670589"
FT                   /orf_name="Pc22g04940"
FT                   /product="Pc22g04940 protein"
FT                   /function="NAD+ or NADH binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /protein_id="CAP97782.1"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001832E12"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTX7"
FT                   /transl_table=1
FT                   /translation="MSSTGPKPKVLQVGNINHAQTAWSALGEMAELVESAATNRAEFIQ
FT                   ECKDGKLDGVVAIYRTIGSVVQTGLVDEELLNVLPSSLRYIAHCGAGYDQVDVHACSAR
FT                   NPAVRVSNVPTAVDDATADVNMFLILGALRNFNTGMNALREGKWRGQPAPPLGHDPQGK
FT                   VLGILGMGGIGRNLKKKAEAFGMKVIYHNRRKLSDEMSAGAQYVSFDELLSTSDVVSLN
FT                   LPLNKNTRHIIGKAEFNKMKDGVVVVNTARGAVMDEAALVDALDSGKVFSAGLDVFEEE
FT                   PRIHPGLLSNQNVMLVPHMGTWTSETMLAMEEWTIGNIRMALEVGKLKSPVPEQADL"
FT   CDS_pept        join(1160732..1160755,1160804..1161670)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191656" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943595"
FT                   /orf_name="Pc22g04950"
FT                   /product="Pc22g04950 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP97783.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR013085"
FT                   /db_xref="UniParc:UPI0001832E13"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTX8"
FT                   /transl_table=1
FT                   /translation="MAEFWKSAPRYWCKQCKVFIRDTPFEKTQHEASPKHQGSLKRFLR
FT                   QIHNDNEQKQRDSQLAKAEVERLRKAVGGGSSTDKDSAKGKAPPPAPKSAERPASLEDR
FT                   KKQIAQLAAMGVAVPQEFRADMAIAGDWQTTSETVIEVKQGLDGPTKSVGIRKRKLEGE
FT                   EEGDEHAPEPIVNKGWGSRMRQYPGAQEEEGLDDLLASTKDIKRTKTFTPKVELDEQET
FT                   ATEPTEPTEPTAPTIKTEDDPTKPEAQETNGPVTVKTEEPAQSLVEPVIQEKPQREDAA
FT                   PGVVFKKRKPKAMRK"
FT   CDS_pept        join(1163234..1164340,1164513..1164906,1164984..1165846)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191645" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943596"
FT                   /orf_name="Pc22g04960"
FT                   /product="Pc22g04960 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97784.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001832E14"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTX9"
FT                   /transl_table=1
FT                   /translation="MAEPTDSSAPPGESTNPATEPNAPAVETAQPLAQNEPPPVGTNQP
FT                   PMETSQEPVAPPAQPAQSAQPAPSEAPVERTASEAQPIPEVPRTSDVPATPEVPTEPNS
FT                   STAGPSHDANTYQPEEVTQPARGPDVTLPSVESSLPAIDPSLPAMDTSNGFDDSELHSF
FT                   DALPSIGSSAPHDMSLPAIDTSLPSLDHSLPAIGTDDIPTMDGHDFGDNSHLDHHNSNA
FT                   GMADSTGGHDNGDVNGASDYHATNGSYQYSHSPAQSQQPGSQQSPQAHTHQFQAQPQHY
FT                   QQNDMYHNSGSQGQVPQAPIGSPLPNNMPPMASMGQYMAGYPSNMGNAQMRYQLPGDPN
FT                   KMLSGNRHKKEVKRRTKTGCLTCRKRRIKCDEAHPVCRNCVKSKRECLGYDPVFRTQAS
FT                   TPSAIQPAPNPPPSLVVNPQGPSTSSTPSYPSYPSAPPGYMPASSQPFAPSLHSESPTA
FT                   SADQHDHAASIDSSLATAHPSSHTEMQNAGVQRQQGPDPSYKAKNLYINDLFSLRGIAP
FT                   PPPHPVGALPPGRLEEIQAVFLATYAPAIDKLLEVRWYSENALSFLMADSQLMADYSAL
FT                   IIAFNEWDLQDGETLARLESFEASIIWKSMSLCRQVPDGETGQQGRDWNLCVSCARLNV
FT                   IEALLTWNHLDSNPLSRELVMDAANPPNTPDQFQNRQLDFWDQVGEFLTLYDNEASSAK
FT                   QIDDTLGRCRQLLDTYENRDIIYSISVARHLGQRWADFPNSLPKVGYTTEKEAGTRLFV
FT                   AQKFLEEEAEGKGTTQVYKRVCCMAVRSWWVARG"
FT   CDS_pept        join(complement(1169950..1170118),
FT                   complement(1169450..1169900),complement(1169310..1169400),
FT                   complement(1168137..1169255))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943597"
FT                   /orf_name="Pc22g04970"
FT                   /product="Pc22g04970 protein"
FT                   /protein_id="CAP97785.1"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI0001832E15"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTY0"
FT                   /transl_table=1
FT                   /translation="MSVPIVGQRRSFDGHLCTIRYVGTVQGTSGDWLGVEWDDGSRGKH
FT                   SGEHKGVRYFSCKSKHPTAGSFVRPSRPSDQPLSFLEALREKYASESENNLTRNTLDRG
FT                   AAVQGKAIQISGKVVEEVGFDKIRKQLAELQELRIVLLDGLRVVGVLASYDQDQISHSE
FT                   AVQKIGETCPKITELDLSRSLLSRWRDVWDICNQLKHLKRLKLNGNRFQALEDGLAFNG
FT                   ITELHLEETLLSWDEIAAIACRFPDLTSLTASANQLSEITCPLPSTITTLTLEHNEMTS
FT                   ISALRHLAALPSLEHLSVRGNSISTANQNTTDTTPDFQFPPTLRSLDLSRNNINSWTIL
FT                   NTIPTVFPGLTTLRITANPLFDQPPLPPSVTEASKPMTVDEAFMLTLSRFPPSLTTLNY
FT                   SAISPQDRSNAEMYYLSLIGKELSATTVEEEPAILATHPRYSELCELYVEPTITRAVVS
FT                   GSSDARVIHPRSVAARLVKMAFCLPLGNDESNIQVKEIPGSFDTYQVKALVSRLFGLPA
FT                   FGFRLVWETDEWDPVEKEVGEEVVEWDDDSEDEARPDIHSGLEAMADGLDKSRFLRREV
FT                   ELVDSTRDVGFLFQGEVGEVRIRVEILDYASMR"
FT   CDS_pept        join(1170735..1170746,1170819..1171511)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191688" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943598"
FT                   /orf_name="Pc22g04980"
FT                   /product="Pc22g04980 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP97786.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001832E16"
FT                   /db_xref="UniProtKB/TrEMBL:B6HTY1"
FT                   /transl_table=1
FT                   /translation="MDYQNRAGSKFGGGGVASKSATNADRRERLRKLAMETIDIEKDPY
FT                   IFKNHLGTFECRLCLTVHQNDGSYLAHTQGRKHQTNLARRAAREAREGKAQDGTMPGVA
FT                   GVQVKKQLIKIGRPGYKITKILDPLTRQQGLLFQLQFQEITPGVTPRVRFMSAFEQQVE
FT                   TPDNKYQYLVVAAEPYQTCAFKLQAREIDRRDERYWTWFDEDSKEFWIQVMFKTEREEI
FT                   FSGVPGLAPMQA"
FT   CDS_pept        join(complement(1173810..1174438),
FT                   complement(1173225..1173728),complement(1172615..1173091),
FT                   complement(1172242..1172554))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233033" [