(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_18

ID   PENCW_18; SV 1; linear; genomic DNA; GRV; FUN; 228788 BP.
XX
AC   AM920438_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 15)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c23, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920438.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..228788
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        join(complement(1198..2188),complement(609..1136),
FT                   complement(142..547),complement(40..58))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823077"
FT                   /orf_name="Pc23g00010"
FT                   /product="Pc23g00010 protein"
FT                   /function="hydrolase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP79495.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI0001832E97"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW60"
FT                   /transl_table=1
FT                   /translation="MAAWLDLVKENEAWDLVDTNRLEQLVQELPNPKYQYPSLLYFYGN
FT                   SNRNKALRALFPYNNITRKGPAGLIRLHLSTKTAHTQNPILFAESGLCLEQRLGDSKWL
FT                   KNSTTKHQTFSLGGADGTLTPARLQQEVKRQLVLPWTQILCLFLDSVPDIQAATNLLQR
FT                   PRRQLTIGDEVVPAPLQVVIVLTNSQHVTEAFAQECAQLQKLDTGTVTILDLRPRHGLS
FT                   DSVVFQPLQTLIVKQLNIVQAERISNCRRFSASHLSAFWSTGVQSHERLLHAAPFDLLA
FT                   RARRDYVKNKSMDDCLREVTQTSIGYSKEDFDDLVASAFLMDAYPPQMHGFSPTVVFAA
FT                   LYEKRCLSIWDNEFKYHIAGVSSRFVHHFVQLSAVKTSAAIRKETLCRLYRRWGGLRST
FT                   TTCLVCLSRPPEHMLPCKHAICDTCVVIFGKPSRLGEYHFEVAQCPICEERSDVTVRQL
FT                   PPTKPPVILTLDGGGVRGLIQLGLLRALESRIGIPIASLPDLCIGTSVGALTAIDVFLN
FT                   QSSVTQCFDAFPHLARNIFCHSSETPIPRCIRWFASAFNLTTDGFYNSEGLSKILKAAV
FT                   NPSRRMFDVATANPAGCRIAIVASRTSDGKACVLANYRGTSPRSTNTAYEFLTPHNDRQ
FT                   DPSLLDAGAAPM"
FT   CDS_pept        join(2633..3111,3177..3408)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942523"
FT                   /orf_name="Pc23g00020"
FT                   /product="Pc23g00020 protein"
FT                   /protein_id="CAP79496.1"
FT                   /db_xref="UniParc:UPI0001832E98"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW61"
FT                   /transl_table=1
FT                   /translation="MAFGVDDHTSTPAKTGSEKTPLREIDPVLVLSCSAADVAPALCRV
FT                   NQLHHADENSYVRMLREEAEMDMRFSITVGAANWALLAGYLVIPGTFTSLQTSNQVEKT
FT                   LQANEAGRTVLHMIQNPPLLAIACLLFASGIAALMWLMHFPNLRGNYPWLINKVFLPLC
FT                   LHAAAGLLTTVINVCTSQGGDWSVMAIITTAVTGATLLSCSALLALHKFYKLERVRKED
FT                   EDIRRSRASTALDT"
FT   CDS_pept        join(4853..4914,4973..5315)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076513" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942524"
FT                   /orf_name="Pc23g00030"
FT                   /product="Putative uncharacterized protein Pc23g00030 "
FT                   /protein_id="CAP79497.1"
FT                   /db_xref="UniParc:UPI0001832E99"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW62"
FT                   /transl_table=1
FT                   /translation="MSTKVPTTTVTPETVPHVQNHTESFARDIITTHPTVGPGVGDEMA
FT                   STQSMKTTQTPSWNNAAMPLALIIPTFTLPTGGAVEAITTAHIPAPTRIGPTIAAEGSG
FT                   NVVWSSTTRWLTLCYLLLLVVKIIDERRTI"
FT   CDS_pept        join(5787..6308,6359..6458,6510..6691,6735..6842)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076512" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942525"
FT                   /orf_name="Pc23g00040"
FT                   /product="Pc23g00040 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP79498.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001832E9A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW63"
FT                   /transl_table=1
FT                   /translation="MMNRAQTKHTRPSTVWLDESAFCNQQLSPNSTASPHIQPPTIQKM
FT                   ATAVITPGSMEPHPGRPNARIPQLNQNPWDTFEPTAGSSQDRSLIFARNKSERGKLVHI
FT                   QQLEKQFSPATGFLELMEQVAHPSFLKLLECYHHDASCALIWEPTEVSVSHILASSCSI
FT                   TTDELVRIVKPVLEGIQYLRGLGRALATLGPETILLTQSGDVKIMGVENSCEIKESEMN
FT                   PATMKLCALADVVTKLMLKNRTYEWEAEIQNLPCQLESISVEEILQNEMFTRDSCEGEL
FT                   KLLVSVANKTAYHGIKSYYARC"
FT   CDS_pept        join(complement(7462..8108),complement(7313..7400))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976293"
FT                   /orf_name="Pc23g00050"
FT                   /product="Pc23g00050 protein"
FT                   /protein_id="CAP79499.1"
FT                   /db_xref="UniParc:UPI0001832E9B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW64"
FT                   /transl_table=1
FT                   /translation="MILVKWCLLLQAVAFSPTYAHLRMASPEPYGSSRKTLDNSPLAAD
FT                   GSDFPCKISPGDFIVPTEEATYRTGSNNSIKLLGSATHGGGSCQVSLTSDREPTKNSEW
FT                   KVIKSYEGGCPAKGPGNLDGSAESDHSLQLHFTIPDGIAPGKYTLAWTWFNRIGNREMY
FT                   MNCAPITVANESPSNSSDNTPKQSLAFPPMFIANVNGCITRGNVDIHFPWLPGRERSDP
FT                   SSSIQIVCEVENSSLIIFTSLC"
FT   mat_peptide     join(complement(7462..8048),complement(7316..7400))
FT                   /db_xref="UniProtKB/TrEMBL:B6HW64 "
FT   sig_peptide     complement(8049..8108)
FT                   /db_xref="UniProtKB/TrEMBL:B6HW64 "
FT   CDS_pept        join(8732..8941,8998..9057)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127383"
FT                   /orf_name="Pc23g00060"
FT                   /product="Pc17g00020 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP79500.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI00018311BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAT9"
FT                   /transl_table=1
FT                   /translation="MDVQPKLKTKPADAANQKARRRRKSLFKKASEYSSECDADIHLVL
FT                   RMKKSGKIFVLVSNTKDWPLSQHQLKSYHPTPIQMSLSDPESKP"
FT   CDS_pept        complement(9958..11064)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076511" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942526"
FT                   /orf_name="Pc23g00070"
FT                   /product="Pc23g00070 protein"
FT                   /protein_id="CAP79501.1"
FT                   /db_xref="UniParc:UPI0001832E9C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW66"
FT                   /transl_table=1
FT                   /translation="MDTLMTSLPPNVGAILMENISIIQIVSMFSIGAYNALETGIVTFD
FT                   TFKRYRGLYFWSMQFASWGILLHAIPAMARFVSQASNLSTSIPFMIGWYAMVTGQAVVL
FT                   YSRLHLVISDMRKVRWVLWMIITNACILHIPMTVFFFGLNRGDARFARPAAIFDRIQST
FT                   GFCIQDFIICGIYIYEAVRAFKIIITIRGRDGRSAIIHLFCINILVVILNVLLLLAEYK
FT                   LHYIQVSFKTVVYSIKLKLEFSVLNRLRLLTSTKPCVCQHGPEGSRPSNDKNIFGMASS
FT                   RPVIAPDVSSQSGATQTDMPRSLRPSSIYGYDETLRETSSENMMPPGDVYSSATLSEGH
FT                   SNTLPGGSSETLPALELSLSQFSPKFDV"
FT   CDS_pept        join(11791..12078,12123..12287,12400..12555)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976294"
FT                   /orf_name="Pc23g00080"
FT                   /product="Putative uncharacterized protein Pc23g00080 "
FT                   /protein_id="CAP79502.1"
FT                   /db_xref="UniParc:UPI0001832E9D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW67"
FT                   /transl_table=1
FT                   /translation="MAAHTADSCHFREPIGFSAFQAKTRKYDYVTPAGPFQPVFNVYKL
FT                   SARVVRLAIESEQVESADFAFEKSILMEASTEEVTYLLEHPSKNEANENQQVGEPDHGL
FT                   LSAYHSSAGHLRDIPNTSTTVSVRVASSEGPSNKGMLHHYCSVETGLDRTSIGPYSHAV
FT                   FDWSYKGVLCPGLHQSVIVALQSRGIKWRSSRTTANEPW"
FT   CDS_pept        join(13292..13462,13568..14137)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076510" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942527"
FT                   /orf_name="Pc23g00090"
FT                   /product="Putative uncharacterized protein Pc23g00090 "
FT                   /protein_id="CAP79503.1"
FT                   /db_xref="UniParc:UPI0001832E9E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW68"
FT                   /transl_table=1
FT                   /translation="MAKDHKPSRRGAGCGTATTKPGTGRACASSPCSARSTASRSKAER
FT                   NPLKAVGNHKGLGHSTAKSTRKKDHEATHRKCLDVMDQIQKEVQLALEEIDEERAHDSQ
FT                   SMQRLHAEKAQDTSKLQEAITARDKALGENQRLERELCQLQQAQESSHATMQGLVSWHD
FT                   IQPVLHQTHGELVSATTRFWNTIDALQNRRLASYLPSSGGINGSWPEQDGPLGTLGHNA
FT                   LPQFSAPGDYALVNQEAPVSSNQY"
FT   CDS_pept        join(complement(15423..15751),complement(15345..15362),
FT                   complement(15115..15295))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076481" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942528"
FT                   /orf_name="Pc23g00100"
FT                   /product="Putative uncharacterized protein Pc23g00100 "
FT                   /protein_id="CAP79504.1"
FT                   /db_xref="UniParc:UPI0001832E9F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW69"
FT                   /transl_table=1
FT                   /translation="MGRIRKIPFTDQRQSFRSRLQRALSQSSSGSEDIWSPPGSTECDT
FT                   TEEVSSLQENGSFGNYHNDIVVEDGQESPPHTWSMGPRPEEELEQPGQANVAEDCNMIA
FT                   LQCAAELDIRTKLMQKALESSNSLIATIRSDLEDIRSRLAVVETAIEMMAKEGKNSTTE
FT                   DNATRRTLRSQQ"
FT   CDS_pept        join(complement(18134..18270),complement(17954..18039),
FT                   complement(17860..17908),complement(17636..17669))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942529"
FT                   /orf_name="Pc23g00110"
FT                   /product="Putative uncharacterized protein Pc23g00110 "
FT                   /protein_id="CAP79505.1"
FT                   /db_xref="UniParc:UPI0001832EA0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW70"
FT                   /transl_table=1
FT                   /translation="MAHEVGFRDRHPLARLQRYYHSHETLEKNSTRRANQTPRANLDRR
FT                   RSRHDPQAQTFRPSVYDGPGDCYLGTAGAGYNPIRGCVHLVAVIRKNNASGSHELT"
FT   CDS_pept        join(complement(22819..22909),complement(22610..22727),
FT                   complement(22302..22432),complement(21993..22255))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942530"
FT                   /orf_name="Pc23g00120"
FT                   /product="Putative uncharacterized protein Pc23g00120 "
FT                   /protein_id="CAP79506.1"
FT                   /db_xref="UniParc:UPI0001832EA1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW71"
FT                   /transl_table=1
FT                   /translation="MSLQRVAVKEDVDFNRPRLRNVSFNTSNQVGLLVTNALDKFSPLI
FT                   QYWNLYRTGIYSIHRGPANQTVPVLYMGPQILETALTRKTRDSQIRRRSNTMHQSKGHS
FT                   SSLVLTIRKLNLWELTRVALITLHYRQCSTQSHGLHTIPSPVASNNAACPRWKIANQDS
FT                   ESTTGCGDSSANLVASKLEASVLPDSELSRLLLRRSD"
FT   CDS_pept        join(23747..23866,23913..24316,24366..24462)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976295"
FT                   /orf_name="Pc23g00130"
FT                   /product="Putative uncharacterized protein Pc23g00130 "
FT                   /protein_id="CAP79507.1"
FT                   /db_xref="UniParc:UPI0001832EA2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW72"
FT                   /transl_table=1
FT                   /translation="MDSPNSSPDQEKQGEQQPNELPILNDKDNNVEPSDHVPPLTSPWQ
FT                   HEEETRHTLATEPFQPTLKVLADLERDDPKFAFPAARLVGLYRRLWESCVSKHIDGQKL
FT                   EQSNQNLKEAGTHLREERDGLQLRHDKQLARLRFFEQALESSRERLTSLLDDWNYLYSP
FT                   NLAGLTDVAREENTTSGDAVQGKLHRMQSRLYISEAFNKKGTK"
FT   CDS_pept        join(complement(25926..26063),complement(25522..25872))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942531"
FT                   /orf_name="Pc23g00140"
FT                   /product="Putative uncharacterized protein Pc23g00140 "
FT                   /protein_id="CAP79508.1"
FT                   /db_xref="UniParc:UPI0001832EA3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW73"
FT                   /transl_table=1
FT                   /translation="MDHPTSPSPIDRPAKRQCRVSHAPENEPKLENHPQQASNGTTIEP
FT                   KVPMRTRGTLTAEFMKVVNLNDSLATPALKLLDLYFCLWECYVVKSAQKIRLEEEQRQL
FT                   QASNDLLASDSDILLQLCNEQASVLWERKRAVQALCNGVVSALEASDLQAYSVDEPEP"
FT   CDS_pept        join(complement(28172..28174),complement(26515..28119))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670315"
FT                   /orf_name="Pc23g00150"
FT                   /product="Pc23g00150 protein"
FT                   /protein_id="CAP79509.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832F3D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW74"
FT                   /transl_table=1
FT                   /translation="MPNIRDLPNELLLWIVSHLDGSALFALAKSCKDLDFRLQPSTWKY
FT                   NIRFQNSNLLHLAVKYDNVGLVDALLQHNANINAFYRGKTPLMRALKYSSAAVRELLLN
FT                   RRDLDINIQNQARDSALSYAIHYXSSSIVKSVLEHRAXSVDIKHRYGRTALHLAVFTGR
FT                   IGFVQLLLLSGSDPXLEDDSGQSAWSWACRINXPXMKIMFINGPDCEVYLGARNAQDSE
FT                   LPLHEAVLHGSIDAVKWRLRQKDLNLDIQDRKGYTPLHLAVQSRXLEVVDLILSHPLAN
FT                   VNCKDKDGNTPLWLSTYSSCDEITERLLAEKDIDINFVGGRGRLEAPSTSLHHAATRLD
FT                   TILLRRLLAVPGIALNLCVAGHSPISVAAYHGHVKTVACLLSMEGVEVNGRGLIDPPIC
FT                   RAVSHGHLDVVRLLVQQGARLNVNESTVATHDTALCIAARGSDLEMVRELLRHVRIDVN
FT                   LRNQWFEDPLMLAVRGGHFSIVDALVANPRLTHFSLRRSLDLAKDYCIQKAIRSRIYDD
FT                   NTTKKLLKRSPRRIFDRL"
FT   CDS_pept        join(28911..29683,29736..30051)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670316"
FT                   /orf_name="Pc23g00160"
FT                   /product="Putative uncharacterized protein Pc23g00160 "
FT                   /protein_id="CAP79510.1"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001832F3E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW75"
FT                   /transl_table=1
FT                   /translation="MPWNPFAVCGIPHGGPASCCGVTKKGQPCKNSVKFQDTKIGHERL
FT                   TTLAREPFDLSTLQSKLCDIARAFLCARWHRQQQADQVGQRWYEAAIRNQARVPHGSRV
FT                   AAPSIAHPGQRQMSSVSRSRPAPGNTDRSPHGLRQDPPVPLSTNPEPVQPFNPFVTSTX
FT                   LRTNSVPWHVSLAQPAILTSVANVWAGVQSLTLKDLTLSDEFDDIHCVFCLAEDDDLAN
FT                   ESVILRCQCKALSHLACAEEWLEKRTTGFXTSCCVCRNEGPLDALVRPLRVQSXDAETR
FT                   HIHTATESSPERELATIRNXSQNDPSRSQLRQRSVGPQGRSVEQSVENGPRRSARLGAH
FT                   LPRGPSTSAPPRRSARLNSTRR"
FT   CDS_pept        join(complement(34808..35835),complement(30740..34634))
FT                   /pseudo
FT                   /gene_family="HOG000213034" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(37632..37758),complement(37109..37564),
FT                   complement(36722..37002))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127384"
FT                   /orf_name="Pc23g00180"
FT                   /product="Putative uncharacterized protein Pc23g00180 "
FT                   /protein_id="CAP79512.1"
FT                   /db_xref="UniParc:UPI0001832F3F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW76"
FT                   /transl_table=1
FT                   /translation="MLKTSCSLARDYQCLNVQPHLFSADFYLNLTRSSRGICVYYQVCY
FT                   SPQIMSSRAWFEQLQSNFGSLREYIDDLHARRTDEETVLVNIDNETDENVVATAVKKWV
FT                   STRMGMVGRSLLFELKTPWYPPVPVCGAVDIEQRRVFSACDENGLPILAAERNNCSVQD
FT                   AKVIERLVSLESGPFEKGRAVLDMADMDRLLGVSCLQRRMINGPKRFVICSDLNYPFAL
FT                   ANVLHSDTSLCLFPVSCEDRSGGLKKIDRYGVASYYSNRGHVKYTFAFRVAIVPNSITV
FT                   AITPCT"
FT   CDS_pept        join(38269..38369,38452..38573,38593..38912)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942532"
FT                   /orf_name="Pc23g00190"
FT                   /product="Putative uncharacterized protein Pc23g00190 "
FT                   /protein_id="CAP79513.1"
FT                   /db_xref="UniParc:UPI0001832F40"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW77"
FT                   /transl_table=1
FT                   /translation="MARLLNCIPWSQKHAGFSARTPRISPKQANSPQLEDSGAGFEVQD
FT                   VSFEDWQMPWLDRPSLRESTWSTSLRDYTADTKGTKMHGKVMVGEMCWPQKSSEISVPL
FT                   CRTVIGWTWTWVSMNHLSEGWQGGDKSQSENPGEVNLLDGEASIAQLNFPLHPSVADLV
FT                   KPILSMASEMHSSKSYK"
FT   CDS_pept        complement(39090..40460)
FT                   /pseudo
FT                   /gene_family="HOG000234693" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(42013..42549)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823078"
FT                   /orf_name="Pc23g00210"
FT                   /product="Putative uncharacterized protein Pc23g00210 "
FT                   /protein_id="CAP79515.1"
FT                   /db_xref="UniParc:UPI0001832F41"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW78"
FT                   /transl_table=1
FT                   /translation="MSLTTSATMIRTRLVIASLTVTWLALASLNSATVHFAVLLRDRAK
FT                   SDLVTPSDSILDITFQTLMDDVVDGMVIAALVSALFYIFGFVLMIYPKWLQENCAARFY
FT                   YGCIQIVVSMIVLSLGGWIASRVHGFQTSFEIFDRSHIPYYKIMYYGSVGQAAFGSLVI
FT                   IMSLVHFAVCGLRGH"
FT   mat_peptide     complement(42016..42456)
FT                   /db_xref="UniProtKB/TrEMBL:B6HW78 "
FT   sig_peptide     complement(42457..42549)
FT                   /db_xref="UniProtKB/TrEMBL:B6HW78 "
FT   CDS_pept        44523..45065
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942533"
FT                   /orf_name="Pc23g00220"
FT                   /product="Pc23g00220 protein"
FT                   /protein_id="CAP79516.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832F42"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW79"
FT                   /transl_table=1
FT                   /translation="MAIKPTPGCSDIGLEFDRLKDVRAISLNAKLVAFVEKAHSSLQSR
FT                   GIFKQRDCYKRSLLHYAAMGNCTNLLLYLLQSKPDVDSRDQWGRTALSWAAEYGSLAVV
FT                   ETLLEQGANINSSDYEGGTPLAWLIHAGNPEMVDIAATEAYLRERGAKEVKLRGIKSAW
FT                   VWVLSYSHLLRYIRPRI"
FT   CDS_pept        join(complement(46498..47002),complement(46194..46345))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127385"
FT                   /orf_name="Pc23g00230"
FT                   /product="Pc23g00230 protein"
FT                   /protein_id="CAP79517.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832F43"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW80"
FT                   /transl_table=1
FT                   /translation="MAIPPRSMTVIDSEFQHLKGIREICFDEDVMAFLHDAQATLKYQG
FT                   IYNQRGPFKRSLIHYAAMGDCAELLLYLLQDGTAKDDLDQNRRTPLSWAAQYSALRAVK
FT                   LLLDNGAEINSMDNMYTTPLSWLVQAGRGPNRAATMNYLRSNGATRRGATRASIKRKII
FT                   QVFPSVLLDPLNGNALQQDKVSKRRATSILFCHGVKKMKNAKHRLNDEMGAGGTF"
FT   CDS_pept        join(47268..47315,47358..47507,47676..47702,47837..50173,
FT                   50315..50556,50609..50846)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076798" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942534"
FT                   /orf_name="Pc23g00240"
FT                   /product="Pc23g00240 protein"
FT                   /protein_id="CAP79518.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832F44"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW81"
FT                   /transl_table=1
FT                   /translation="MDQVTEGCWQPEFKFRWPIKPDEQHSWSDFEVSAIVWSLYISVRL
FT                   NAGKSPGQFSPHWTSVVPNSRFRRLKNDEKVVHGLSVENQENFQRQHQSEFARSHDAHH
FT                   PANILALPIELLYDALDYLSTEDLVSFAFCRWDLFQALIGFLERKARPSLQGLGLLVTL
FT                   FEEQWPKKWLRIIVPICARSEQPILRDLETLVGLFEDNHWRKEQLRDIIIVSARRDQPT
FT                   VHSCVELGFEELACRYLRKRPHTLFDTNILHMTALHISVLKRFQNIVREIGSIAHNMRE
FT                   FDRVEFVNRHDDIQNTPLDYAITTPSSTIVNMLISAGARIDNTDRLGYTPLMNACHLGR
FT                   DEIVHCLVDRGADIQATNNFNLSALECIMTGESRTKKTLLQRICPHATQLQLNRALWLA
FT                   TNDKKEFVGILLKFGADGQYAGNLEEDGSYDAERNTDPSATTPRPVEASTPLSRRHLSP
FT                   SIATGVTSREDRYIIWKHRNESQAPHARRWLAPFPWNFARNVEMSDAEPDITNESTSDG
FT                   TAGAQTRGMNDSSVGPQLFVDFEKLNISEGRPEKKGRHEDPQPGDIAGFGGTGKSRFFI
FT                   FRVGPAQAPRHVFRRTRAYSTEGFENLSHNRISLLRYNAPNGDRHWQYTRRNIAGFRGI
FT                   AIDETESNLKCPQTWINVEWKDIKEEHRYLLVDECSWTPRTDVIRLSGRKVASTGIRAI
FT                   WTLQETLHIKAIQKEGKLVSPLPFPLAAFEADKIKPERSRTPAQLRSFSSTTKSRSSTS
FT                   RDNMADGIKQEQEQETSTVVPSHSATQDDPGSNVVEVESSGSSQSKNQAPKKFNVQAYM
FT                   ASVEKMEKWNAMSEAEREKRYRIALANYDHYREERLNKGDVEKPDVILELPSLPGVQDL
FT                   TLKNLTLSDQIDDIHCVFCFAEDEDLANESVILRCQCKALSHLACAEEWLEKRSTSFGT
FT                   SRCVCRNEGPLDAVIRPLRVQSSDTETRHTHTASESLSERELATIRNSSPNDPGQNQPC
FT                   QRSVGPQGRSVEQVWRMAPVARLG"
FT   CDS_pept        join(51785..52478,52544..53304)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234702" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942535"
FT                   /orf_name="Pc23g00250"
FT                   /product="Pc23g00250 protein"
FT                   /protein_id="CAP79519.1"
FT                   /db_xref="UniParc:UPI0001832F45"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW82"
FT                   /transl_table=1
FT                   /translation="MTNTSPNGAWVFEKAILVYTPDFDVSCFAVLRIAHDKKANEGSIS
FT                   LKITADLANLSVRSPLMLNISPGVVKECTLARKSNDRLCPPGLFSMLPARVKKVSAVST
FT                   LSLTLRKTGIVVCPTGMESLSPANPGDLNFDAFAKICHSTSLCLYISQRQCADEELDQL
FT                   EIFSGALRSLQAKTFKNARHGVEERDCGVFARWLNPNPPPYPEERVSEQGDPPVYCKHS
FT                   EQVIGKRRTGSMSPDDKARKRLLLTSPGRLGSTSPEALGSPTEANTPSTCSSSPSSIRP
FT                   TDFILASSPGRTKRKRLARLEEELRGVSDEEICQVLIRSGRRHLLALQKYVSDLPSESE
FT                   TVGIANVKMLERRLKHSLKQYVDETIEQLKSQVVGDIVESALNECDEAIEGRYRTHEAD
FT                   LEEQVDDYKVDLGITANDCTKEIEEQALRCMDDIEDQGIRVEKSATERFAELTRCLSDS
FT                   AQSLLDSKSSPGQRRTEGTEARRLSI"
FT   CDS_pept        55965..56455
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(57269..57384,57427..58102,58271..59230,59348..59828,
FT                   60019..60523,60587..61442,61496..61780,61830..62081)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976296"
FT                   /orf_name="Pc23g00270"
FT                   /product="Pc23g00270 protein"
FT                   /function="ATP binding"
FT                   /protein_id="CAP79521.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniParc:UPI0001832F46"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW83"
FT                   /transl_table=1
FT                   /translation="MEAKEHIEQLCRQKGVGNSDFDSVAQSLDNALAMLVFILLAGGLY
FT                   TKPTHFLLELIQNADDNNYATSTPTINFHIESDILLISCNEVGFSSKDVDAICNVGQST
FT                   KSASRKAAGYIGEKGIGFKSGFKLADTIRISSGAYSFKFVKSGQLGMITPIWEDFPSDY
FT                   LQAGLTQFLFEISCPRNVQSVKTDLCSLQPSILIFLRRLRRINLEGESLYKEIQSIQYV
FT                   FADLAGAAVKIRGISVDGIISEDYFVQRHKVGALPGDPKRPEFLIQADFLLTANREDVD
FT                   ERPLWNLSLLDGIVQAFALAVHRFNKTILKYSWPSYLQCLSSSMGSSLFDSLRKKMVAR
FT                   LKSERILESKSSSFRTPAEVWYLGPPYLDDDGEYLLRSEERQDQLLSSQYKIHELSILD
FT                   VRYFTFQSFLKDLKNFACNGNQRFRKMSNMWHSKLANVLEKGGVDLRRELSCCPIIPLQ
FT                   GGTWVTPFTDQIFFASTDAGVFVPGGIDILLVDQAAAQDHHRRQLYQRLGVKTLDLNGV
FT                   CERILETHKKPSSWRCSTDDLVSHASYMFRARDMFQMDLSAHFWLVDLNGKCARGKDLY
FT                   MELPNKVRVACLPRLLHDGSYTSVTPEFYSLMKRSPAQCLLLLRDNWDHYFPPEYHRKR
FT                   ERQGAARAIQLNLQTRCSNGNFTAIGQSFLPRAHMTQHDGCRTILPFLDVSDPDNILWL
FT                   QLSLFGVATDLNLEFYLQYLMGIQGRSLTATNAHEIYKQMTQMTKRLPKDNRYPDCALL
FT                   FKNTLCLRDATAVDIVSELTALRPDETQIPHIKDLLFWLNDHVSQDHDLSLELLAKLER
FT                   SAVFPVYQFLHEQKETWFVTFDDGWFIADRPTLRRAFEAKVPLLDFSLNEIRRMHHLFA
FT                   KLELLECTLSCKVDETTEREGDYAFDEIFTNKLLEKLPFIERLLADVKDNTSMQKLKNL
FT                   EVFGVTKVTLKRELGHIKGESGDGDLDVSESDTCFAFYIRTSDLQSGDVPYSALANCLS
FT                   KILGIDDEHKRLVMDILVTRSHRRLETILEQYGLHCELSQDTGSRNASDASNDYSIDAS
FT                   YTVPATNKVSNKCIEGIPGALLDASQDEDRLIGQSRISVTQAACSFDSDHVKIGRSSMP
FT                   FYAVSGKGIAYHQTGSASPALECRLGPSQRVWDTEELLLALPEPGHGKINGTSSKPPRR
FT                   SRSDLTAGAHRHPRSEAIWEEDQETGYLGELFTYNFLRSKLPTSFAVNCWTSKMRERSG
FT                   LPAFTGLESSYSDFTLHDTAKEFLEFLRGRGLYIDRWADNTTTYHIEVKSTTGAYNEPF
FT                   YMSYNQQNLCRSWSLDRREGIASDIYLVFRVFNLGESPGLQIHLDPWNLFLERKLDFKP
FT                   QGSFIVELMDDAGCGEGTGQRETPEVIHVQQML"
FT   CDS_pept        join(complement(63984..64100),complement(63531..63938))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942536"
FT                   /orf_name="Pc23g00280"
FT                   /product="Pc23g00280 protein"
FT                   /protein_id="CAP79522.1"
FT                   /db_xref="UniParc:UPI0001832F47"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW84"
FT                   /transl_table=1
FT                   /translation="MDASNSSPDQEKGEQRPCELPNLSNKDNNVEPSDHVPPLTSPSQH
FT                   EEETRHTLATEPFQPTLKVLADLERDDPKFAFPTARLVGLYRRLWESCVSKHFDGQKLE
FT                   QSNQNLKEAGMHLRKERDGLQLCHDKQLARLRFFEQALESSRERLISLLDDWNYPYSAN
FT                   LAGLTDVAREE"
FT   CDS_pept        join(64917..65003,65178..65389,65437..65532,65579..65768)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942537"
FT                   /orf_name="Pc23g00290"
FT                   /product="Putative uncharacterized protein Pc23g00290 "
FT                   /protein_id="CAP79523.1"
FT                   /db_xref="UniParc:UPI0001832F48"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW85"
FT                   /transl_table=1
FT                   /translation="MSLQIVAVKEDAGFNRPRLRNVSFNTSNQYTSWTSKPDSSCTVRD
FT                   VVPSRFTAPFTPADRRYEIWISWSRCLCGEVSAIASWSTVAALVDHRFEVQLLTLRGTA
FT                   RSVRTQCTRARATASCGLFIPGLDHQKIEPLGAHQSGPDNPALLSVQSHGLHTIPSPVA
FT                   SNNAACPRWKIANQDSESKTGCGHPRANFVA"
FT   CDS_pept        join(complement(66943..67056),complement(66811..66850),
FT                   complement(66663..66750),complement(66536..66620),
FT                   complement(66307..66398),complement(65809..66223))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076701" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670317"
FT                   /orf_name="Pc23g00300"
FT                   /product="Putative uncharacterized protein Pc23g00300 "
FT                   /protein_id="CAP79524.1"
FT                   /db_xref="UniParc:UPI0001832F49"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW86"
FT                   /transl_table=1
FT                   /translation="MVFAHSASACMENACIRTNRVHHNTFDSPHDAASCMPEAKNEKTL
FT                   RLLLLAGLGSHQMSSEDNEDHAFDTSSLRHLKIFERLIGVQELYHVDKSKNDPICRINR
FT                   EKEAEKRGCSPVVQSESARINLGRAVVAHLFMGIPNHQPCHVAFKLIAICTRFKKKKAA
FT                   LGCTRQFVETVNARDEPACDKYCTSVVECGAMPEVQELHNSAKAVGTRAEDAMEHARRP
FT                   PPWSYPRSGGIRPLATVYFTVDEGCPYNSVKMSVVFVVRGIRLGADIQTQRSCRR"
FT   CDS_pept        join(67066..67185,67359..67572,67774..67862,67890..67991)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823079"
FT                   /orf_name="Pc23g00310"
FT                   /product="Putative uncharacterized protein Pc23g00310 "
FT                   /protein_id="CAP79525.1"
FT                   /db_xref="UniParc:UPI0001832F4A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW87"
FT                   /transl_table=1
FT                   /translation="MSLQLQVSQVDRVSFIRSYRLLTYHALVRQAGFSTSPTSTDGRSV
FT                   YYDYERTSTPAGISPNGNSFQMALLEPNRASIGFQPCSLICRTWLIALTWDTTSQKAIA
FT                   VTSIREIGCAKGAWVCGMGRESSGPAHWPLRPLCEAMALKQLSLGTLHIYARALLIGYF
FT                   HGSGAGTLLWT"
FT   gap             68073..68172
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(70088..70876)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000193042" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942538"
FT                   /orf_name="Pc23g00320"
FT                   /product="Pc23g00320 protein"
FT                   /protein_id="CAP79526.1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001832F4B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW88"
FT                   /transl_table=1
FT                   /translation="MTRSSTNIELLQAEVAENYQSFFRLLVNGQRIKYVTINPGLYSAD
FT                   DMCFGPSLVSLLPALPAGDWNDGLVAKNETNGQPHFAYAIRTAFPGVKNVWNKXSVDYT
FT                   EIVVGNKLRTGIYEAKCNLFDDVVVVKFARFDWEIQYLESETTAYQWIEGYDIGPRFLG
FT                   HLTEDGRVIGFLMERIKDARHAGPQDXESCRKALSRLHCLGIHHGDTNRFNFLIRGSQA
FT                   VLIDFDSARKCGDPDALQKELEHLPNSLEDLSRRGGGGLL"
FT   CDS_pept        complement(72019..>72927)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   gap             72928..73027
FT                   /estimated_length="unknown"
FT   CDS_pept        <73029..74060
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(74688..74897,74947..75345)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976297"
FT                   /orf_name="Pc23g00350"
FT                   /product="Putative uncharacterized protein Pc23g00350 "
FT                   /protein_id="CAP79529.1"
FT                   /db_xref="UniParc:UPI0001832F4C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW91"
FT                   /transl_table=1
FT                   /translation="MSFDHTIPYSAMEVMGYSKLQASSPPESMVREVERSLRSRPNEVS
FT                   ETVTYGRGDHDACESFLRFGIQDHDFTRKIEEVIGRPAFLLHQGPVIVHSPDLPTNWGI
FT                   NAAHPVRNGVSVFRTLSGDRVTLKLYPISHHLSSTEFAQGKGTPRSFNLTSNEVLFVRG
FT                   ALKMEISLPAGGFLAWQGFSEDPWGIDPSAPEAFAFMRI"
FT   CDS_pept        join(complement(75915..76025),complement(75411..75773))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670318"
FT                   /orf_name="Pc23g00360"
FT                   /product="Putative uncharacterized protein Pc23g00360 "
FT                   /protein_id="CAP79530.1"
FT                   /db_xref="UniParc:UPI0001832F4D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW92"
FT                   /transl_table=1
FT                   /translation="MPPATAETLLADLSPQLDMFIRFLKADLTSTILEGDLNEPTPCSG
FT                   SHRFGTMAPFIQEEGLPDNHNTKKALQHGRRLMRFEREFGHGITLLLLPVLSAFRSLSQ
FT                   AEEARTMEMLRDGNSAYVAHLAQSLARLRLNYQCIHGIYPGKLIRSSCLYFST"
FT   CDS_pept        join(77573..78588,78660..79190)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(84764..85028,85086..85711)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(88581..88718,88779..88923,89008..89192)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200100" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823080"
FT                   /orf_name="Pc23g00390"
FT                   /product="Pc23g00390 protein"
FT                   /protein_id="CAP79533.1"
FT                   /db_xref="UniParc:UPI0001832FD2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW93"
FT                   /transl_table=1
FT                   /translation="MTFRNVSPGDVISGGARFVHAGLKGGEIVVTYGKPALVKSANLAT
FT                   QAASWGAQNPILATCAVVGTTGAVVLAAPGLATAPIISSMGFTAGGIQAGSAAAAAHSW
FT                   IGNIAAGSAMSVGQSAGAGGSGLVIVNGAAQLGGAAMSVGSASVAWVKAKL"
FT   CDS_pept        complement(90499..91416)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076695" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670319"
FT                   /orf_name="Pc23g00400"
FT                   /product="Pc23g00400 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP79534.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001832FD3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW94"
FT                   /transl_table=1
FT                   /translation="MSVNKLFMDGNPQMEQQITPPSSQICVDNDLAFTNGIQMLFHESG
FT                   ELKANGAPGPAEWPGMEFHQNRGGQDISQASPRSVQKHEGSWDAHCHGQTGCSIDPGSI
FT                   YCGSRPVICWLGYLPTSVPSNHLLLGPSPEYFGYAPSLFETCLFPNQANINSSYLWPLE
FT                   ALRHDSQNTVARPCQAFGQPVNLLHGSRDPSNLSLGGSQTNVPRRQFKCGVQGCKSHFK
FT                   LRKTLNRHMASHSGERPHICWVPGCQRRFLRRDNLKAHYTTHGKRKGRNRYVATLDTTA
FT                   SVYNPEFCGQLTSEGWPLDHAGQD"
FT   CDS_pept        join(92858..92987,93324..93514)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670320"
FT                   /orf_name="Pc23g00410"
FT                   /product="Putative uncharacterized protein Pc23g00410 "
FT                   /protein_id="CAP79535.1"
FT                   /db_xref="UniParc:UPI0001832FD4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW95"
FT                   /transl_table=1
FT                   /translation="MDIIVENLPARELWFPPTGPSWRSTRLHSADPVACISFVAAVRQS
FT                   AHAGWRRSVEAEGSRDTVNEPLLVWPSDGGRSAHSARQTSLGILLTAGATYSGESRLVL
FT                   DS"
FT   CDS_pept        complement(96502..98412)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942539"
FT                   /orf_name="Pc23g00420"
FT                   /product="Pc23g00420 protein"
FT                   /protein_id="CAP79536.1"
FT                   /db_xref="InterPro:IPR007604"
FT                   /db_xref="UniParc:UPI0001832FD5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW96"
FT                   /transl_table=1
FT                   /translation="MIDVEKYETFHDRNVSGSDAVLYNNVGDILSPLSQWSTDISRILD
FT                   EPVQPNPQDPQNAPCFTSLAKSQGWPYDDTHFGQANGISTTLVHHNSGYSTLYDVYQDI
FT                   FTSRCSGQSNPKSELATPTAQVNEHWIYGHREKYAYAQRTLYLLFAEALHRFRYNATLQ
FT                   APTAMHQPGNEKPVTYLNKGQPYSLTVADSTPPTNNGGFFEYRTFVYVSLEGEDQRSNP
FT                   VASWQLWKEGRGLKEANERKGKLLAVEFIEPSQSGLRIQGHCQVQLEEASVNDFCVIWT
FT                   ADPTAKAYEAVILLKFNFVPTDFTRAKGVKGVPVRLCTKTEMLQSNDRNKSVMNEPERC
FT                   YSLVKVLRDHGAERKLWNDKIRISKRAEKLSKRIMDREANANFASRCHNESAINGRKFD
FT                   VPSHKKRKSSISPRKSPTSEVLRAELATTVEVLSSARLVSVLALRGNMKDRLLDDRHST
FT                   GAINLVSEGAAQIPNKANIQVHSHSPVCQERPPKVPYCSVGASKSSPSPAKHSSKSGSY
FT                   HRKSNSFYAHFYFAVACFYILFALSGKQPEGTYHAIYLTGRTSRNLKVELAAKLHIDPC
FT                   LIPHIIWINSKGLKVVVDDDVVGQLPEGQIMIASVHEHSTTEMAPSSAKRSEVEVELVF
FT                   Q"
FT   CDS_pept        join(complement(101679..101796),complement(101179..101624))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942540"
FT                   /orf_name="Pc23g00430"
FT                   /product="Putative uncharacterized protein Pc23g00430 "
FT                   /protein_id="CAP79537.1"
FT                   /db_xref="UniParc:UPI0001832FD6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW97"
FT                   /transl_table=1
FT                   /translation="MDKAILGLTAQEIREVFTICGIEDSEEHLNLVIAHAADHVYKARL
FT                   VIAGGATEPISQAKEAIIETPSTPPHETRGSYRLMKQTGKDVPTTYSDMASTEKKKKKK
FT                   RKRSDKSELIDQPPGASVADGTGTAKDKAPEESISPEIQTTVYYFVFQIEGSLMDTWFM
FT                   SSPKSTTPNLRVCRIPVTALCHYT"
FT   CDS_pept        join(complement(103077..103287),complement(102140..103026))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942541"
FT                   /orf_name="Pc23g00440"
FT                   /product="Pc23g00440 protein"
FT                   /protein_id="CAP79538.1"
FT                   /db_xref="UniParc:UPI0001832FD7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW98"
FT                   /transl_table=1
FT                   /translation="MTTSSPSVPPSFDPALHLHSDILDLPSESFSDDLEALNIQRIEQT
FT                   RDKVVIQHRAWNLSDVFRSDDDIRPDTPTKTKSKQFQHIIPSSPARLLPLLPSSPPTVK
FT                   MPFMSSPAGFPSGPPSPTDPQKRKNDEPPQSSEPKRQKIMGGFLDDEDEDEDQDALDAF
FT                   GDAQMSQFEIQEQPTVQPTQFPIILGPPQKSPDSTPLANPPVAREPIVESPGPSRKPPG
FT                   VFQIKTCSGKSHNVASRPSKPAIPYERLVAGRSTTAPGWAQKSYYGIDIHKLLDEAAQE
FT                   SQEKASRPPPPPPAVQRSIESNNMSHKSKKATYAMWTEKYRARKFTDLIGDERTHRWVL
FT                   RWLKGWDPIVFPNIARSRPKKANIL"
FT   CDS_pept        join(complement(107083..107517),complement(106802..107039),
FT                   complement(106673..106744),complement(106612..106626),
FT                   complement(105595..106568),complement(105059..105526),
FT                   complement(103692..105008))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942542"
FT                   /orf_name="Pc23g00450"
FT                   /product="Pc23g00450 protein"
FT                   /protein_id="CAP79539.1"
FT                   /db_xref="UniParc:UPI0001832FD8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HW99"
FT                   /transl_table=1
FT                   /translation="METIQHDSELMTQYVAAVSVPNSRRFVAVHDKNGQLMLFSLGTDS
FT                   KLYVSSLDKSGNRVVRDLGLMLGFASSYTGHAFDVVQDAASKLYVAVAIAHDSNASRSL
FT                   LCLLRPFEPREVDLSSSSVDLKSFVMAGSGEDNPRVFDIFMAPAVGKNYPPVVFAFKEE
FT                   NYHSQDLASAAVTRSEDSYSWMKKDNVKLPENAEMIIAVQPLVMKYGSKIIPGHAVLYL
FT                   IQGKKAITFYSINVPHELEVPLKQASDTTPSDLDPRALAALPNADGFTDLLVGGSGLYR
FT                   FKAKGLAHPSSDKIADTGVFSSVKEVQVTRSSSKASLWAANTDNGIGYLMTDLDFQSPD
FT                   PPVQVVPDHQGGYFAPFKATSSSCETFVFANNVGNLSMLEQDAKSGIWKTIPLIQPSLD
FT                   KTIQMQSYMTQIKPLNASGGPLVNHPVILRASGDTSVIVNGRSVLATEKGISVRTDQTG
FT                   LLTLTVPTDDISTHTFTVTDASKASTKSTQKFVDPAHKINQKLSKIQHKEDLNIDLGPG
FT                   KGKLLDGTKLTPEQIEQVAGNIHQLMKTRDSIAQGKTPSSVALESCYRFNAEHIIQGAG
FT                   SGGAWHWLEKQGDKIISFIVNGAKVLVQIGETVYQWAMKTVDQVGKVLSVIFNKILDIG
FT                   KKIIDWLGFVFNWKDITATKDSIVNIVKDALEEGPILTDSLKGKSKGLFESMKKSVSDS
FT                   RPSNHDMEKLGIKADDKTGSTDQSKSKIHNSMASNWAQYQFNHGGARDASTFLQTVFSS
FT                   DMATPEESQAIGNLDQEFKNFEDKYHGKVTARQKKLVDEYQPQGKRSLDAKYAHEQTEK
FT                   TFLTDCIDGVEKLTELLLNIIKTIINKFNGLLTTPINVPIFSSIYKMWISPGNELTILD
FT                   ALALIIAIPATVIAKLATGDKLPAIPRGRYAAIIKKMADGQSAKDADFNKFAAITGAAT
FT                   FGISLVLSVPDSISPLAFESGTDLYEELLVEQPSPTASLVALADLSGSSGGGKVTLEHI
FT                   LDAVVLIYTLHSIPKNKENPGYTLQMIGWFVSLFNSGFNILLHFVTALSKMVVDKVRAV
FT                   MDAILQAIVYSLSVATSVLEIKTPHWKGKNDTDSGLDIATHTFLLLGSWSGALERFVKG
FT                   MFSLIDVVCKFAELTTILDTQPEVEFVAEIAKYVSYGIAVTLIATKVGIHIAHGNWTDI
FT                   PFIGDV"
FT   CDS_pept        join(108348..108637,108689..108852,108900..109625,
FT                   109680..109794,109850..110270)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200404" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976298"
FT                   /orf_name="Pc23g00460"
FT                   /product="Pc23g00460 protein"
FT                   /protein_id="CAP79540.1"
FT                   /db_xref="UniParc:UPI0001832FD9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWA0"
FT                   /transl_table=1
FT                   /translation="MASEKDKRLQSSLKTATGAFDQAVAVSQDALNDGLYYLFDKYEDL
FT                   QKMKVNKKKFGRIDAMMDHAEVSLPVKSSSYRTLVFYCIFQTGKLVLTDDDGNDKKPID
FT                   LADWRFAFEVDYTTLDVPSDTTEHQEAKKQMNQPGDYSIKRLFLDFKTHKIRNFNKDLS
FT                   DFKGHNWDSEDLQSFLSLITFWGDPEKGVMKDKQKSTLGYFLTTAKPETVNPPAPTFPP
FT                   TSVKHQHYKYIAPGKQTPDEGPKDGKNNMLLYLEMTQNRSFPSEDILEYSGNFVTPGMK
FT                   GTTCISRDIFWDSYLLRNPSLSGPYGPQPPLLREFNRHVYAWLGEFHVWAKNYSTDLSW
FT                   SYGFGHTRWEPSRSPDYFAWKKVSANKWEWKNKDKKSGHDEGIWPVRLDAKASSDTLNE
FT                   LRFDPGSNKIHLEGCSKVWAEMKRSDFQNIEEKGGVAINWALDITIDSVSEGGLKLNMN
FT                   LPANPKDIFHTTALTKPFATEAEETQDEAEPAENEPAESTPKTGKTGKISVHDMTEAAN
FT                   DAAAKLDFKSVTSNLQTALENSARFVLPGGRQFFYNNAVFGNNGDLLVEAKYKS"
FT   CDS_pept        complement(<110308..>110838)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(111804..112399),complement(111030..111701))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(114736..114835),complement(114492..114669),
FT                   complement(114308..114410))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(115217..115259,115317..117273)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213041" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942543"
FT                   /orf_name="Pc23g00500"
FT                   /product="Pc23g00500 protein"
FT                   /protein_id="CAP79544.1"
FT                   /db_xref="UniParc:UPI0001832FDA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWA1"
FT                   /transl_table=1
FT                   /translation="TNHPSDTENLQTVLQNPTFTYLQSATQDHLTTKLSHLRAMVLQPY
FT                   IIEPVSSFLASYSSAMPDLLSIFLLAIIILVSLKILDYAYRLVVFWVTLAFKLVFWGSI
FT                   LSLGWYVYSVGIENAGKDFGWLWGVVYGFVGDFQEKSKTAAAAYAGNPK"
FT   CDS_pept        join(complement(118169..118707),complement(117816..118103),
FT                   complement(117382..117756))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127386"
FT                   /orf_name="Pc23g00510"
FT                   /product="Pc23g00510 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP79545.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001832FDB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWA2"
FT                   /transl_table=1
FT                   /translation="MRPSNQGSLDVVPANIRIVREIDRSDASSVFEIELEGQKYAMKLF
FT                   HDNGDLGFAENGRDLNRFRCELNAYMNLXEHGVCERGFVPYFYGYIDRIDPTAFYLAFQ
FT                   HFAHDKYYPRAILLEYLPNAQSLNCENYFEACYHKAIEGIKQIHAAHVHYQDIYPKNIL
FT                   VVLGGQKRMVWVDFDVATTFLIEGPDEQRLSEEEDTIVAEFGELLRADQRQGLCKNTKW
FT                   Y"
FT   CDS_pept        complement(119858..>120091)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976299"
FT                   /orf_name="Pc23g00520"
FT                   /product="Pc23g00520 protein"
FT                   /function="FMN binding"
FT                   /protein_id="CAP79546.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI0001832FDC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWA3"
FT                   /transl_table=1
FT                   /translation="VEMLKKNIIGIEIRVGRLQVKIKVIQEMGKGDREGVVKRFEALGT
FT                   EVGEGVAGQSEVVDWDAIHGGSNPLSTVSQTF"
FT   CDS_pept        join(complement(121426..121570),complement(121023..121354),
FT                   complement(120517..120918))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076800" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976300"
FT                   /orf_name="Pc23g00530"
FT                   /product="Pc23g00530 protein"
FT                   /protein_id="CAP79547.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832FDD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWA4"
FT                   /transl_table=1
FT                   /translation="MAMPSSKFPDLPGSGYPQTPIRPARRVLVQMSKEDQRRERNRQAQ
FT                   RKHRESVKQQLEKYDRLRQSLQHPGNDTNPSTHLADLRSGQQKFCPLPSAGVNPCMHPQ
FT                   SILPSLFPEVEVDQPIDPPSTEPNDPLSHRFLPSAGYAKRVYSSPSTVHDGDSSTAVPP
FT                   SDTSFPLDPNLLSPSSEIESNARACNGQAFGRTLLHQGVIMNSEDIVSVLLAHVADVKA
FT                   QDNDGRTPLHVAAALGYARVGRLLLMHGAAATVSMADGHGLTAMHLAVQNGHASMVEAL
FT                   VECGADINLRF"
FT   CDS_pept        join(complement(123855..124109),complement(123427..123810))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942544"
FT                   /orf_name="Pc23g00540"
FT                   /product="Putative uncharacterized protein Pc23g00540 "
FT                   /protein_id="CAP79548.1"
FT                   /db_xref="UniParc:UPI0001832FDE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWA5"
FT                   /transl_table=1
FT                   /translation="MQRQIAGTLDVRFVDRIQQDILEHRNDTEYDILYLTPVPDSNHDF
FT                   RVRIEDFQSLDLDNSDQWSQRLRTAYAHINQRHPLGVPFINLALGFFLSAALVQGASIP
FT                   NVEQRNNTNALNTRAGNDYRIAVYQNGQCTGEAIPYSGDDEDCHNGLGNGGAGLQLLAL
FT                   DADGMLVFYGAADCPAGQEVDTFNPDQDQTGTDCKPLNGNPVSFQFIKV"
FT   CDS_pept        complement(126263..126965)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(127043..127756)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942545"
FT                   /orf_name="Pc23g00560"
FT                   /product="Pc23g00560 protein"
FT                   /protein_id="CAP79550.1"
FT                   /db_xref="UniParc:UPI0001832FDF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWA6"
FT                   /transl_table=1
FT                   /translation="MEETIAELRRQLEGERQALGKERKAREEAERLQGEAERRLQPNTL
FT                   SQAIRVETDATLTTQGDATDPVNRLYPKRIVHWLDFPQLQEQVWRKFDRTAAFTSRPLF
FT                   PSDTQIDYVVTNIQNRPIYSEASLRNFERDTVDNFVEMVIKALRDDEVFRHEFGIHGQV
FT                   TFYDRVTKYNCRRFPPLLADPTFCLAARLPFFSYLINLAPKLGQGPRLIRRMENTGEKM
FT                   ERDRGSLSALTFPSH"
FT   CDS_pept        join(<128171..129038,129104..>129539)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127387"
FT                   /orf_name="Pc23g00570"
FT                   /product="Pc23g00570 protein"
FT                   /protein_id="CAP79551.1"
FT                   /db_xref="UniParc:UPI0001832FE0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWA7"
FT                   /transl_table=1
FT                   /translation="YSRIGYLVKATLLSYRYTIVIKATIVEKXYRLXAEANNYRYLRSL
FT                   XGNXIPIYLRSFXLXVAYXYYSELMAEIMVLGWLGTRLXHIINNKNSSFFNXERKKALT
FT                   VLRSHGVVYNDSEWRNILXDHLSGXLIIIDLEDMKLLKRRQVLRSTSSNTWRGYRVGPG
FT                   KGRKKPLSSLTTVCL"
FT   CDS_pept        join(complement(130863..130968),complement(129991..130754))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942546"
FT                   /orf_name="Pc23g00580"
FT                   /product="Pc23g00580 protein"
FT                   /protein_id="CAP79552.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832FE1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWA8"
FT                   /transl_table=1
FT                   /translation="MHHPRGKITKGPHTSVRDLTEEQRRAKNCVSQRNYRESVKHRLRQ
FT                   DEYLLQNANIQEGLRVTKQSKSLNVGGSHAEGPNVLTTRDLLPSPCGIPPEVTVTPAKP
FT                   HISPPNNEAYFPLELDMGSELTPWGYSLPFSVTGHGPHKTHQRVRVKSTKLLDQLLTLP
FT                   KASPSDNCTDRTELVESSLSVRKQSLSGSSLLHQAVLLDNGKLISTLLKHGADVQAQDR
FT                   NGQTPLHYAALAGHVESGNMLLSNGADRTISSTDKDGLTPIHLAVQNQKAPFVRLLIEY
FT                   GADANSRF"
FT   CDS_pept        join(131325..131350,131604..131727,131997..132210,
FT                   132267..132625,132701..133099)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076800" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976301"
FT                   /orf_name="Pc23g00590"
FT                   /product="Pc23g00590 protein"
FT                   /protein_id="CAP79553.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832FE2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWA9"
FT                   /transl_table=1
FT                   /translation="MVIQASFRQICENSHACSVMSYCDRLLVPRLLSLLKDSSRWVNVT
FT                   KGVNKTKIQEQHWIRSGDNRTKGASTRVITVMHSSRFPDLPGSGYPQMSTLAREIPIQL
FT                   SKKDQQRERNRQAQRKHRESVKQQLEKFDRLRQCLQDLDSGPKASKDLANLPLDEQQNC
FT                   PSPSAGENSSIPVQSILPSVLPEVDEPINSQCRDPINILTRPFIASTGYTNGLCSQLSK
FT                   SHDGDSSLASSRVEEHYLMAFPPPDTSFSLDPNHCPPLELESNTRACNWRAPGRTLLHQ
FT                   GVFMDSEDIVLVLLAQVADVEARDHDGRTPLHLAAALGHARIGRLLLMHGAAATLSLED
FT                   RHGLTAMHLAVQNGHAPIVEDLVEFGADVNLQF"
FT   CDS_pept        join(133456..133463,133860..134035,134071..134238,
FT                   134311..134874,134931..135345,135411..135699,1
FT                   35750..136124)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217042" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670321"
FT                   /orf_name="Pc23g00600"
FT                   /product="Pc23g00600 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP79554.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001832FE3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWB0"
FT                   /transl_table=1
FT                   /translation="MCMHSRRRNGKLASCEPCRKDKVRCDHAQPVCKRCQKRGFTGRCF
FT                   YHPAPLTSTRRQPDRDVGISTERKKIYRSPSPSLGNLGNPMSDSETLDAVAPCPSVIQP
FT                   ALRTEQMLPAGYLDGRENSAIAPSPALVKRTAEVLRCLQHFPAIKNLVHKYYSVSQTAV
FT                   IPSPFILNALDELEVTVNGSLFGSASDERLFTFSTFVTHNTSKALQIPQNSDGTVFHKY
FT                   FTGPFLRLEIIGVICALAGRASYFGLADSTVGDTESPTQFSRKMLVICDLTIHICKSLT
FT                   ALNDLSLWLVHENLLLSKLLRGDSSSVTWNRLGELATGIFEFGAHRDTPSLVPLFILES
FT                   RRRLFAASYQLDKSIATFLGRPPRISWRHSDCLLPLDISDEDLAGHPHTLEAARRSLDA
FT                   NGWNIKKVYQPASWIRLRFIISTFREEILELSLQKLSPNRTEKLREVSSRCHQAWGLLP
FT                   EHLQYTSSCWESDLPIGVKLISIISYIAYLYNEFSIQSLLYQDSKRTDSALLDVSSEIL
FT                   STILTLGRQWERSVDIKGDFTWIALVYGFSCAGVLIRAMQEQARTGQPLLYSGSRSSLI
FT                   RNLSVFISHLESMAGPEQATSPLFIRATSVFSSIIDGILEPRREVPVNSTNPDTILNSD
FT                   IETPFLFDLQGMDLFETQDFRVAFDDMLY"
FT   CDS_pept        join(complement(138559..138601),complement(136535..138507))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213041" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670322"
FT                   /orf_name="Pc23g00610"
FT                   /product="Pc23g00610 protein"
FT                   /function="ATP binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP79555.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniParc:UPI0001833076"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWB1"
FT                   /transl_table=1
FT                   /translation="MSSDFCILFDRVRDVYMTITTIGFQHMQNESGTKCSILTALVQPA
FT                   PPELIEKCQVVVSGAKSLLVMSTNSVPITIAMKRTKLDSIFACMNTDSSFLSHVQSEQK
FT                   LLKFIIPNEAGYMIRNDIFEERLRGCSGIHKVVGLVEPMEFVHWPQFPQQGLSQLLRAA
FT                   VCCILIDDDGDSYTQLENTIQSQLIEQLSLQWTSPKSINMRRLAVVGEVRQINASWRFF
FT                   KAAHALGVKVVAIGPRGHWLGKGGAVKLAPREAFIEIDMTADDGLSRRISNAIQGYNRP
FT                   IHGLTTVTEFLLIPVAQAAECLGLPTSPSESFAKSVNKHNTRSELSPDSCRLVSSLDGL
FT                   ISQITSNERNALPPGPPWIVKPCFGWHSLGVHKVTTLQGLIEAVGKVSRQTAFSRTGEI
FT                   SKDSGWQTDVLIEEYCDGPEVDCNFVLLRGEIIFFEVIDNFPCTAESSEGNADSDNFKE
FT                   TLNVFPSTLPPSEVATLQKALHQAILRLGFRSGVFHVEARVRNSSHQYQPGGDGEPLDL
FT                   RPNPIHPAHDASVFLIEINARPPGYVDTCATAYTNGVDLFALHILIALRDEYRLRALSQ
FT                   PHQARRHVAISAIQAEKSGVVASDDPWKDLAERSPTLMSRVMDPIMNFGKGDIIEDPQL
FT                   STTPWLAAFTVYSLTSRAETLSICDQVKDDFECKID"
FT   CDS_pept        join(138875..139058,139113..139290,139365..139513,
FT                   139563..139671,139727..139866,139927..140113,1
FT                   40170..140794)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823081"
FT                   /orf_name="Pc23g00620"
FT                   /product="Pc23g00620 protein"
FT                   /function="transporter activity"
FT                   /biological_process="oligopeptide transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP79556.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006857"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="UniParc:UPI0001833077"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWB2"
FT                   /transl_table=1
FT                   /translation="MKNREAQSVSMSSPTLQGRIATEDEIRDLQHVPAHLPKRVWLAAT
FT                   IGMAERFAYYGTQTLFQNYLQNKPTDLVPGAMGLGKSTATTVNLAFTVLVNILPLPTSV
FT                   LVDGVLGRYRSLQIFTCIYAVGSTVLFATSFPSEMKTGISTPGFVVGAILIALGLGGVQ
FT                   ASIQPFIADQYTESDMRIRTNKQGQKVVEDRELTIQYIYNVYYWMVNVGSLGSVATTLM
FT                   EKYIGFWSAYLLDLCAVAICVLVVQVARPKFVHPPIQGSKLPLAARCLWCAAKGGFKLD
FT                   AALPEKQLEVHGRVVPWDEEFIAELRGALSAFKICIGWPIFWVCMGEGSQVSISQAGQM
FT                   ETHGIPNDLIKSANPVAYVLFGVIVQKQLYPFLQKRKIVFSPVNRITLGFAIMAIAMAY
FT                   SAVVQNAIYQAGPCYSRPLACDASQGGQIPNHVHVLLQLPTFVIIAIAEVFCWPTGSEY
FT                   TYSHAPKSMKSILQACYIGTAGLGYLLGMALSPLAKDPLLVVLWSLVAGMMFLTACAFR
FT                   VAFRKY"
FT   CDS_pept        join(142270..142322,142379..142514,142583..142942,
FT                   143001..143575,143639..143933)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246417" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670323"
FT                   /orf_name="Pc23g00630"
FT                   /product="Pc23g00630 protein"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring alkyl or aryl
FT                   (other than methyl) groups"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAP79557.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0016765"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001833078"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWB3"
FT                   /transl_table=1
FT                   /translation="MLEKPALQRFETLQLHAGAFPDALNSCSVPIYTTAAFGFNNAEHG
FT                   VRLLNVSEFGNIYSRITNPTVSVFQNRMAALEGGVAACAVASGSAAVSMTLMALAGIGD
FT                   NIVASFHVHGGTLHQFKVLAPQLGIESRFVTSNDPEDFRSKIDEKTKFIFVESISNPKY
FT                   VVPDLEALAKIAHSKGIPLIVDNTFGCAGYFCRPIDHGADIVLHSATKWICGHGTTLGG
FT                   VIIDAGTFDWGAQDDKFPQFHVNGAEEGSGELSLWNMFGSRAFAIRCQFEVLRDIGSSM
FT                   SPQAAQQLIIGLESLAVRCDRHTSNTRALATWLEQQPSVAWVRYLGNEDHPSHKNAERY
FT                   LHRGYGGVFSFGIKGGKQAGFKLCDGLKLIINTANLGDSKTLVVHPWTTTHQQLTDAER
FT                   LDAGVDEDHMRLSVGIEHIDDLKDDFCQAFASMNETTKASANSVKQNSHIEEQKRMVRT
FT                   LFGSRDPLPLSVPS"
FT   CDS_pept        join(complement(145866..145870),complement(145710..145806),
FT                   complement(145393..145431),complement(145126..145342),
FT                   complement(144289..145070))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942547"
FT                   /orf_name="Pc23g00640"
FT                   /product="Pc23g00640 protein"
FT                   /EC_number="4.3.1.19"
FT                   /function="L-threonine ammonia-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAP79558.1"
FT                   /db_xref="GO:0004794"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI0001833079"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWB4"
FT                   /transl_table=1
FT                   /translation="MSQVFTCYVSSKFNGSTPDCAVNIELVRGALGSTKSQVHNACCSN
FT                   PDYAQLIVMSRVHDMIRSTDLSPAHNLSRHVDFQLYLKREDQQLSFSPHVRGLYNSMSH
FT                   ITPENRWRGVVIPSKGQYARAIAYSARLLNIPAVILVGPEMCPNEVHELQQMGSVVEHL
FT                   SDEPSGPLSAAFNVQALYIDPLNDPYTLAGLGTVALEILRQVKDDQQLEGIFCSARAGG
FT                   ALEAIGLSVKQFAPHVKVIGVDVLPSVELSKLYGFPIDLPNAECNTHIPNALKTGQDNL
FT                   PVISHDHLDRTLTTEISRVNPHVVDHVIMVKACEIQSAIRDTFQETRGIVDLNGALAVA
FT                   GMMRFASTTGSLDVKERAKSLVAVISSADVVFDNIKEFV"
FT   CDS_pept        join(complement(147624..147695),complement(147545..147581),
FT                   complement(147219..147390),complement(147178..147183),
FT                   complement(147052..147094),complement(146932..146997))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823082"
FT                   /orf_name="Pc23g00650"
FT                   /product="Putative uncharacterized protein Pc23g00650 "
FT                   /protein_id="CAP79559.1"
FT                   /db_xref="UniParc:UPI000183307A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWB5"
FT                   /transl_table=1
FT                   /translation="MAGRSMEAWSDKLGPGSKKMPIIQPYYGTHMLNSRGDKYQFRPCL
FT                   KEGSGISRTLVYVDAYIWRRTGVADQTHLRGRGYRWFGSIGGSTPFASRFYHRPPANFR
FT                   APPGTISSGVCRKRSCNSRRMDTLDID"
FT   CDS_pept        join(149136..149172,149219..149267,149699..151064)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823083"
FT                   /orf_name="Pc23g00660"
FT                   /product="Pc23g00660 protein"
FT                   /protein_id="CAP79560.1"
FT                   /db_xref="UniParc:UPI000183307B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWB6"
FT                   /transl_table=1
FT                   /translation="MLNDVFRTSIMLIVTVQRFSKTVYPSDTRYGRQPYHDNYISQPQE
FT                   YEPWEQDSQYSPPTPGYFRSPYAPSSNCSPSPSTPPENDRSSARQRPSTLPLLQESEWE
FT                   PEKAYDEDPPNCIHYFIEWRVTLNKKTVVKDTEEDLVLAPGAYWKLFLEEKLQTVLLEK
FT                   VPRDKRVRVDDTAIMVSNSDRSQRDLNKRFNKTEIVWAPIEKQLRMWSSHFCRGKRLTL
FT                   RVCFNYVEDCSYPPAGRKGEKRGKSSVTKRMLGDRDAQLDAEESSCGQQSIWRHVYDLM
FT                   KCDSAACHLGPYCWLDPKGKKHYRLRTQTLRRLVTYAEKGGILETHRDVPDEIRDELYM
FT                   EEQQREEKDKRKGSNILGSQMSHLPININVHPPGVATTASAVVTAGQKSVSSLKIPGLK
FT                   DVAVKEYGEWLASNVSDDTLKAAFRQACGITLSDGFELEHIYKDQNPEFFVSKGIKPGI
FT                   ARSFVENIGDWVENVKKVLPVLELV"
FT   CDS_pept        complement(151557..>151823)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127388"
FT                   /orf_name="Pc23g00670"
FT                   /product="Pc23g00670 protein"
FT                   /protein_id="CAP79561.1"
FT                   /db_xref="UniParc:UPI000183307C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWB7"
FT                   /transl_table=1
FT                   /translation="DGEKQLRDRDKAFYLAELQSLAAKAVRSESCISITKLAEGGYNKV
FT                   FRLIMNDGKRVLARIPNPNAGPAFYTTASGVATMKLVSSPETS"
FT   CDS_pept        join(complement(152818..153915),complement(152385..152591))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823084"
FT                   /orf_name="Pc23g00680"
FT                   /product="Pc23g00680 protein"
FT                   /protein_id="CAP79562.1"
FT                   /db_xref="UniParc:UPI000183307D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWB8"
FT                   /transl_table=1
FT                   /translation="MVFQFEYTDGSVIAALAILETPTSIEDENPQETGLFVVGKIEDPP
FT                   TGRSGRTTRDESENAREFLWSLRHNSIRELFPTLCGGFLGLAGLFVLSLAGVIDSDPNN
FT                   IVTGFLICGSIMIMGNIFTISTTSNAVTNQRSLARRHLHNERGFWFIFTGLEEFMIYML
FT                   LTVVIMALSKPISAEDGATFPVLGLSRLLLGLSLTNLHAAWVHTVVSKPRKQTIWQRIP
FT                   GWREWLEILPVAFLDIVLPNCVHYLATTLLAFFRGVVFAALSNQAYERIPYPLTTCANI
FT                   VFHAIPIVSEYSASILTGAMYVRVAASMLPENEQTVVPFDRSFGGRAKNGTRCLSILDA
FT                   FRTMKVQNWYRYLKNGWEVLIREYVWVRFGTHHLEFAFAGRSMHLEGSIILFRPYGWEV
FT                   ETVHYTGFRLWDPTVGGRSFCAKDNIETMVEVFGL"
FT   CDS_pept        join(154720..154990,155043..155114,155177..155285,
FT                   155424..155512,155554..155755,155790..155805)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823085"
FT                   /orf_name="Pc23g00690"
FT                   /product="Pc23g00690 protein"
FT                   /protein_id="CAP79563.1"
FT                   /db_xref="UniParc:UPI000183307E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWB9"
FT                   /transl_table=1
FT                   /translation="MARIPNRSATYEEVRIYIAQTLISKYNAGHDFAEDTARSWRLGRG
FT                   SELYDAKLEYFQEVFGMDTGLCLFQSVCEDRDNAWKQSVIGVICFWMTIVSAALLFWFH
FT                   ILPLLRGQTGSPSQLLLFGLTRAIYAYLSPRRDDYMLVSGLFSACIADQARTFLGLASE
FT                   EECTAMHEIKKGHMYLDIVKENKRVDRLDRERDCIEAPCDLHPWTHLWVDGGCTRYKTD
FT                   SYSDIIKSVLLLLADTISSGLGLLRMSEIG"
FT   CDS_pept        complement(156640..157623)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234604" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976302"
FT                   /orf_name="Pc23g00700"
FT                   /product="Pc23g00700 protein"
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /protein_id="CAP79564.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000183307F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWC0"
FT                   /transl_table=1
FT                   /translation="MAPRLSPSKRQFISDMIQGQSLTRYRMADAAECSEQTIKNIRRNL
FT                   RLFGNVHAPPNRVGRRRSITPLMLEALFDHLLEKPGLYLDEMAIFLWDELQMLATTSSI
FT                   RRALVSNGWSRKTARQKAKEQNAELREIYLHNLSEFESYHLVYVDESGCDKRISFRRTG
FT                   WSPLGVAPRQVSQFHRDERYQILPAYAQDGLVLSRVFRGSTDAIVFEDFIDELLRHCGR
FT                   WPEPKSVLVMDNASFHYSERISQMCADAGVKVVYLPPYSPDLNPIEEFFSELKGFIKRN
FT                   WSYFADDPDRDFSTFLERCINQVGAKKDSARGHFRHAGLSVEDLDC"
FT   CDS_pept        join(157802..157885,158149..158218,158274..158407,
FT                   158501..158638)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942548"
FT                   /orf_name="Pc23g00710"
FT                   /product="Putative uncharacterized protein Pc23g00710 "
FT                   /protein_id="CAP79565.1"
FT                   /db_xref="UniParc:UPI0001833080"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWC1"
FT                   /transl_table=1
FT                   /translation="MEVVSVVPGTGRETKRLCPRGKLFSKIAVLLQVFNILSSAVEARL
FT                   PSLAQGAASSRSVAIANRIEARTASKFGAQFWSSEGDFPPRKKDMLPPWVQDEEVRQTS
FT                   IISTDIGNGGMAVKEHEAGNVFASVSASEGLNDFGKS"
FT   CDS_pept        join(159509..159976,160044..160394)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192503" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823086"
FT                   /orf_name="Pc23g00720"
FT                   /product="Pc23g00720 protein"
FT                   /protein_id="CAP79566.1"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI0001833081"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWC2"
FT                   /transl_table=1
FT                   /translation="MLNDTWTHTVSQILGWTYFILWSLSFYPQVLHNHRRRSMDGFSVD
FT                   FAVLNILGLTAYTISNACFLFSPVVRAQYAQRHPQGAEPTVQWNDFVYALHGALVCCLI
FT                   GSHFLYARFWNFQSKSQRVSILAFVVIWACVGVVALAILYVWVSASWEWIDVVYVVGMI
FT                   KVFLTAVKYTPQAAMNYLRQSTAGLSIVAILLDLTGAALSLMQLVLDSSLQADWSGTTG
FT                   NIAKLLLGNITVLFDLIFIFQHFVLYQEQPAERKPGLSEHDPLLDSSDEP"
FT   CDS_pept        join(complement(162228..>162400),
FT                   complement(162025..162164),complement(161778..161963),
FT                   complement(<161143..161702))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976303"
FT                   /orf_name="Pc23g00730"
FT                   /product="Pc23g00730 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP79567.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001833082"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWC3"
FT                   /transl_table=1
FT                   /translation="ATHGHQRPGRACDEWPRRKLRCNIQLSQCGVCQEIGTVCEVAQPE
FT                   AXGPKRVTWGSDAVMHLEAMLRSCLLAXEQDRFLDLRVAIGSYDCHLGGGRVLQTCIFQ
FT                   RR"
FT   CDS_pept        <163294..164271
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942549"
FT                   /orf_name="Pc23g00740"
FT                   /product="Pc23g00740 protein"
FT                   /protein_id="CAP79568.1"
FT                   /db_xref="UniParc:UPI0001833083"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWC4"
FT                   /transl_table=1
FT                   /translation="QVLRSLGSASTTVSRRIGSALSTVSRRTGSASTTVSRRTGSASTT
FT                   VSRRIGSASKTVSRRTGSASTTVSRRIGSASTTVSRRTGSASTTVSRRTGSASTTVSRR
FT                   IGSASSTVSRRIGSAISTVSRRIGLRQQQSSQGGAASTTVSRRIGSASSTVSRRIGSAS
FT                   STVSRRIGSALSTVSRRTGSASTTVSRRTGSASTTVSRRIGSASKTVSRRTGSASTTVS
FT                   RRIGSASTTVSRRTGSASTTVSRRTGSASTTVSRRTGSASTTVSRRTGSASTTVSRRIG
FT                   SASSTVSRRIGSAISTVSRRIGLRQQQSSQGGAALPSELRRGTL"
FT   CDS_pept        join(164747..164784,164929..165047,165103..165122,
FT                   165216..165299)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127389"
FT                   /orf_name="Pc23g00750"
FT                   /product="Putative uncharacterized protein Pc23g00750 "
FT                   /protein_id="CAP79569.1"
FT                   /db_xref="UniParc:UPI0001833084"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWC5"
FT                   /transl_table=1
FT                   /translation="MSVDVSVDVSVDVHHLSINNVSVDVSVDVSVDVSVDVSVDVSVDV
FT                   SVDVSVDVLMVSVDRGGEWSGGEGGGHRLDLAIGPCHPQIM"
FT   CDS_pept        join(complement(167757..167925),complement(167418..167604),
FT                   complement(167277..167359),complement(166835..167182),
FT                   complement(166392..166529),complement(166091..166222),
FT                   complement(165997..166010))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670324"
FT                   /orf_name="Pc23g00760"
FT                   /product="Putative uncharacterized protein Pc23g00760 "
FT                   /protein_id="CAP79570.1"
FT                   /db_xref="UniParc:UPI0001833085"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWC6"
FT                   /transl_table=1
FT                   /translation="MNGGVYEPLAVRIPRSYPITTVQFIITGGFVMRLWLSEVARCTQR
FT                   GFFEATAGDCDVITTRPSGSSLADSDRTIGGTLMFPLLESKRASALSARAPRYRCDPTL
FT                   YHPDMTIGGIDDEPMPCADASTRYIREIPMAYTTVCLSAFEHGAEKCRCLVLHNDRGFL
FT                   PSPLAMLLVQIRVQGEGEAKLPSFLSYRLISVPATNREDKAVYTEAQPSQLKSQKDRPI
FT                   LSHLVPRVAQAFDTYERVEMNQAEIYGATSSRSQKCLLGTVCNNTTQSHPAAFYRQQSK
FT                   LDRMNPGTTPQKATTGGSDAVLDIDTWGLSDLQSPTEAMTSNKKAESIASRCLVEPTKW
FT                   YFERFLINASMPAQSK"
FT   CDS_pept        join(169622..169741,169788..170191,170259..170367)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670325"
FT                   /orf_name="Pc23g00770"
FT                   /product="Putative uncharacterized protein Pc23g00770 "
FT                   /protein_id="CAP79571.1"
FT                   /db_xref="UniParc:UPI0001833086"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWC7"
FT                   /transl_table=1
FT                   /translation="MDSPNSSPDQEKQGEQQPNELPILNDKDHNLEPSDHVPPLTSPSQ
FT                   HEEETRHTLATEPFQPTWKVLADLERDDPKFAFPAARLVGLYRRLWESCVSKHIDVQKI
FT                   DQSNEILKEAGAYLRKERDGLQLHHEKQLARLRFFGQALESSRERLISLLDDWNYPYSP
FT                   NLAGLSDVAREARGARGITPHPKQVIYSRGFLQEGHQIVIIHYRGLD"
FT   gap             170640..170739
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(171715..171852),complement(171309..171662))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942550"
FT                   /orf_name="Pc23g00780"
FT                   /product="Putative uncharacterized protein Pc23g00780 "
FT                   /protein_id="CAP79572.1"
FT                   /db_xref="UniParc:UPI0001833087"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWC8"
FT                   /transl_table=1
FT                   /translation="MDHPTSPSPIDRPAKRQCRVSQAPEDEPKLENQPQQVTNGTTIEP
FT                   KIPARTRGTLTAEFMKVVNLNDSLATPVLKLLDLYFCLWQCYVVKSAEKIRLEEEQRRL
FT                   QASNDLLASDSDTLLQLCNVQASVLWERKRAVQALCNGVVSALEASDLQASSAEEPEGW
FT                   "
FT   CDS_pept        join(complement(173111..173458),complement(172736..172993))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942551"
FT                   /orf_name="Pc23g00790"
FT                   /product="Putative uncharacterized protein Pc23g00790 "
FT                   /protein_id="CAP79573.1"
FT                   /db_xref="UniParc:UPI0001833088"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWC9"
FT                   /transl_table=1
FT                   /translation="MAFNPAHLQWVLGQVLGDPLHRERCIWAGDDGNHCQNTVPLDSRT
FT                   NGVLCFQLLQGPLLVYPLAQQEISSAAKQLLFFECRRHRCRAKVWATRFLHLLDQAKDV
FT                   TVHSEPHDSAPLVGAFRLARAVNIEDPDILQTTSGFNCAVVTCIRYKLCNSRMTKVCYS
FT                   PTQCGLSTSLTNEFRTEWPPEGSLFSHDDPTGCGTKRV"
FT   mat_peptide     join(complement(173111..173407),complement(172739..172993))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWC9 "
FT   sig_peptide     complement(173408..173458)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWC9 "
FT   CDS_pept        join(174166..174378,174463..174950,175003..175318)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942552"
FT                   /orf_name="Pc23g00800"
FT                   /product="Putative uncharacterized protein Pc23g00800 "
FT                   /protein_id="CAP79574.1"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001833089"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWD0"
FT                   /transl_table=1
FT                   /translation="MSSVLPWNPFAVCGIPYGGPVSCCGVTKKGEPCKNSVKVQDTKIG
FT                   HQKLTTLSREPFDLSTLQSKLCDIARARVPHGSRVAAPSIAHPGQRQMLSVSRSRPASG
FT                   NTDRSPHGLRQDPPVRLSTNPEPVQPFNPFVTSAMLRTNSVPWHVSPAQPAILTSVANI
FT                   WAGIQSLTLKDLTLSDEVDDIHCVFCLAEDEDLANECVILRCQCKALSHLACAEEWLEK
FT                   RSTVFGTSCCVCRNEGPLDASIRPLRVQSSDAETHHMRTASESSPEREPATITNSSLND
FT                   PSQSQSRQRSVGPQGRSVEQSVEDGPRRSARLGAHLPRGPSTSAPPRRSARLNSTRR"
FT   CDS_pept        join(complement(176247..176787),complement(176089..176175),
FT                   complement(175847..175893))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942553"
FT                   /orf_name="Pc23g00810"
FT                   /product="Pc23g00810 protein"
FT                   /protein_id="CAP79575.1"
FT                   /db_xref="UniParc:UPI000183308A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWD1"
FT                   /transl_table=1
FT                   /translation="MKLFETPLDIWLSIKDFLTPADVENIINTSSILWKQIFKNTSWLE
FT                   FALTFDGCSPVLIGHNLSAYRPRKSSTRLYLALIAGDYSGDLRYESEKFFAALQDGWKY
FT                   DKNRYEVQFPSGITLNIYDVIECHESVKLPLEKVFTNTKQGVYSEYCYYRYPAIKELRS
FT                   SDIAKWDPDYRPHPHALGYEDKPHHSSKSYEKQAMGKDGTKCARLLIDSRYKTQREEAK
FT                   ER"
FT   CDS_pept        join(177686..177706,177782..178168)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076627" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670326"
FT                   /orf_name="Pc23g00820"
FT                   /product="Putative uncharacterized protein Pc23g00820 "
FT                   /protein_id="CAP79576.1"
FT                   /db_xref="UniParc:UPI0001833120"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWD2"
FT                   /transl_table=1
FT                   /translation="MDHKLSQIPFSRNSSADNLSRGGNEPTESFRRVVGQFILGNSGHT
FT                   SQVLQPSVDQPSGSVATELATSVVSSRDYMITPSAIKAESHDLPPLNVKKRPAESPTFS
FT                   RKRRRHSYSSSQILGRSQTCASKETPKPYKN"
FT   CDS_pept        join(179770..180321,180365..180464,180512..180726,
FT                   180772..180888)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217227" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942554"
FT                   /orf_name="Pc23g00830"
FT                   /product="Pc23g00830 protein"
FT                   /protein_id="CAP79577.1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001833121"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWD3"
FT                   /transl_table=1
FT                   /translation="MSSNLPKDNMICDLGTIKAQYQLPISMSVPTTRESYTAATTNLTG
FT                   PHRRGRLKVVTGPPKSLCLPHLCGLENIASVLIVRQESPWDTYRKVITYENAGKVTIAT
FT                   RRTHPSRMVAIRTYGKDNARRLIYRFGRLEHRNVLSLHECYMHEDLASFLVDDLPLTLA
FT                   HVVAFPSVYPSETELGSIICQILDGACYLSSFGLAHQSLACGDVLFGIDGIIKIASLDL
FT                   YIDCTPKQSEIAYIAALPSIMMRLMQKNGKDQGLVGVNDLERWPIDSAAVEILSATETA
FT                   ESIRSLRNQPLLAEKHRPNDDLVVLARAALLSTSLNCIYDPGSKKC"
FT   CDS_pept        join(181773..182007,182058..182155,182185..182337)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942555"
FT                   /orf_name="Pc23g00840"
FT                   /product="Pc23g00840 protein"
FT                   /protein_id="CAP79578.1"
FT                   /db_xref="UniParc:UPI0001833122"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWD4"
FT                   /transl_table=1
FT                   /translation="MHYITALSLIASLLGMVAATGNSVRRYVQLRAWGQPGCRASNLGE
FT                   EGIYSDYIGLCVPFGNYDTIRSVSVESVESGCTLYIYRNLQCHSERIEVPLMKCVSGEH
FT                   EYKMYILEVVANRMHNWEIWKAALNCIVLTCSVSFAPQLMQEGVFETRTTTEKITGR"
FT   sig_peptide     181773..181829
FT                   /db_xref="UniProtKB/TrEMBL:B6HWD4 "
FT   mat_peptide     join(181830..182007,182058..182155,182185..182334)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWD4 "
FT   CDS_pept        complement(184246..>184734)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942556"
FT                   /orf_name="Pc23g00850"
FT                   /product="Pc23g00850 protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP79579.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001833123"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWD5"
FT                   /transl_table=1
FT                   /translation="IEKEYERRIAAINAVIAVCDAEEGAPSRRRVTQKRSADDVDMPPA
FT                   APLSKRQNPTASDKSDDMFSKAIASVCVKSPTERPTICFICLGSPSLPQRERLRMYKNP
FT                   GSLSRHFVNRHIKPFSNDMYCECSICGEKLESKSALLNHAERVHGTVSRSSKTALGLA"
FT   gap             184736..184835
FT                   /estimated_length="unknown"
FT   CDS_pept        join(185132..185182,185315..185426,185470..185514,
FT                   185605..185714)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127390"
FT                   /orf_name="Pc23g00860"
FT                   /product="Putative uncharacterized protein Pc23g00860 "
FT                   /protein_id="CAP79580.1"
FT                   /db_xref="UniParc:UPI0001833124"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWD6"
FT                   /transl_table=1
FT                   /translation="MGAIEKVQEGKSENRELEGGNQGGEPSSVPLLQEMDEGGAAATVA
FT                   IAEGALFGPESAVCIEARDAKPRDGYLSRRIYNGGSAIIKPSKSNGLSSLSEIESVIRN
FT                   A"
FT   gap             186084..186183
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(187434..187513),complement(186879..187374))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076785" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670327"
FT                   /orf_name="Pc23g00870"
FT                   /product="Putative uncharacterized protein Pc23g00870 "
FT                   /protein_id="CAP79581.1"
FT                   /db_xref="UniParc:UPI0001833125"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWD7"
FT                   /transl_table=1
FT                   /translation="MCHGVPLLPAGLRVSVTTAVAATSPVMIGLREQQFSQGGAASTRL
FT                   PRRIGLRHQYASQGGAASTRLPRRIGLRHQYASQGGAAKTRLPRRIGLRQQQSSQGGAA
FT                   STRLPRRIGLRHQYASQGGAASTRLPRRIGLRQQYASQGGAAKTRLPRRIGLRQQQSSQ
FT                   GGAASTRLPRRGALRYQVNSAGGRCDDK"
FT   mat_peptide     join(complement(187434..187450),complement(186882..187374))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWD7 "
FT   sig_peptide     complement(187451..187513)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWD7 "
FT   CDS_pept        join(190713..191038,191100..191186,191221..191347)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076481" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942557"
FT                   /orf_name="Pc23g00880"
FT                   /product="Putative uncharacterized protein Pc23g00880 "
FT                   /protein_id="CAP79582.1"
FT                   /db_xref="UniParc:UPI0001833126"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWD8"
FT                   /transl_table=1
FT                   /translation="MGRIRKLPFTGQRQSFRSRLQRALSLSSSGSEDIWSPPRSAAGDT
FT                   TEEESSFQENGSFGNHYNGIAADDGQENASHTWSMGPRPEEGLEPGQDNLSGDCNMIAL
FT                   QCAADLDIRTKSVLRRIRERTKADLSQVHAEVIGDLEGIRSRLVVVETAMEMMAKEGEN
FT                   NTKEDNAARRNLRSQQ"
FT   CDS_pept        join(complement(196090..196183),complement(194379..196033))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183225" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127391"
FT                   /orf_name="Pc23g00890"
FT                   /product="Pc23g00890 protein"
FT                   /protein_id="CAP79583.1"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="InterPro:IPR021711"
FT                   /db_xref="UniParc:UPI0001833127"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWD9"
FT                   /transl_table=1
FT                   /translation="MPLTTPVLTVDADNIHKVDTANAQSLHGMWMVFSKCADYMDQGRR
FT                   LENLSWRLWTRETFCVEPEKSNSTSALPLLRSEAGDLPELSASVESAASDQAERIEAYM
FT                   KRPKFFYYRPAVVREDSLASLGCGKEKHITSFSLERMVLNIKEKKQLKPAPHPVEPAAP
FT                   VVDVTPRPSTPSVSTARHVPHFSVRPTPYPHESTELLDDCPGGQRERHCTVNASDTSVS
FT                   TSGILPSRPELVRSTSIVRGFSPSHISSSFRSQPRRSIDPSPSHSTTQLKPSPLRKKGG
FT                   VFTLGGSSGDDDESSFEERMVPQTAQENATGGGLKPKNNNPDSTKKTASFSNQVSSHII
FT                   PNSRVISRSDEDAIETDDEVSESAIGDAEDSDWEDSIAEGGEPSVDEQGGMFQRVDSRP
FT                   DLVSRRSMLTMMMHRPARMQGNAFRFSPALQRSRLTSPSGPSIQQSPPSKEEESSVMRG
FT                   ADVPRSKPIVMNTNASQSMAHSPRTTRRNMLTTELTESLRRHLLWERQQKSVTANAFLK
FT                   RRHTAHDMKNLQEYPGPNGPHKGVGPNQASAEADPIAANFDLGKNVSWTNYTTDYGPWE
FT                   YHVKGW"
FT   CDS_pept        join(<197115..197412,197468..197521,197569..>197819)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942558"
FT                   /orf_name="Pc23g00900"
FT                   /product="Pc23g00900 protein"
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /protein_id="CAP79584.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI0001833128"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWE0"
FT                   /transl_table=1
FT                   /translation="MADIDSGNEGDTNPHPLDVTADPLNPIPIPRIPAPRTSIPSVNNP
FT                   IRFTNDDDDSDDEDKKPSHQGHGLPEIAMMKLQKVKALEHNDADPRAWRQAIVYQLIPY
FT                   ALEWLLDSDIPRPDKSNPVYKRWKYWSRLVASWMYGQIDTILQSKIRNLLKTPKYADKI
FT                   YDKLITMTQGSDMLQIAFLEMRKFDKMKRSDYNSASEYIEEYQKQYHVLARFKAAPHPT
FT                   HALSQVLANLELEVKKVHFITEEASKVEPKKMTLEKVEEYWKALQAAAVMEGVSNAASN
FT                   ASRGGRGGGRGGRGGNRGGQSGHNTGNDSTQPAKDPNAIDSNTAKKKKKGLRKQPTNDK
FT                   DIHDYAREIRNSTTQKDDSNICSFCGFGPHAAKRYAYLSETPPSSXEPSGNLWVYSKAI
FT                   QRAQRQSEGQSNMVVAAASSVDRTNDWLLDTGSSKTLTHDLEDFHTYQIDHPDLAYVYK
FT                   DYSGKRVVTLGHREIIVYAALPNGKTHSFITTGYYSPGGHRKLFGMQKLLEEQDISYDT
FT                   RTRHLTDSKGDIIGYADTSSGVPYLISPKDKDPNEVPSDSDSDSDKEDIDIVNKVTAYE
FT                   VHRRLGHAGKARIASTLQHTEQLGDDEQYGTEHFDCDAYFRGKSKQKISREPQARVQDA
FT                   AXKFHVDTQPIKPTRPNGENYXLPVVDDATRLIEGIMLKNKSDAFHKLTAFCEKIKLLT
FT                   GRYPGIWRMDSGTEFKDFIKWGEAKGMTFEITPPYTAEPNGTVERFGGHINDIQRTMII
FT                   DAGISEDMWPYATETAIYIYNRLVNPKTKVSPLTHWREELEIENPKPSLKHLRPXGSTA
FT                   YVHIPKAKRVQARKAAPRAWKGKLVGYEGDRGHIYKVWDPTTKKVMNSRDIGFPQPGDE
FT                   DDIGPMPVQPRPNPKGPTDDSDDAVGFIPISLTNDEEDSAPKQQQQVVRAQPVQPTQTP
FT                   AQQRFVQTPITPSTIHLPTIYGSVSTMPETPREKTQQQKAIAAPPVRQRKLFQTRLPIV
FT                   HEEPRMSGARLDFAKAPDKTTQAASQQTIQQEASQEATPIHQRRTDFGERLRAFTAQIS
FT                   QLAESMKEVREEADNIERNAITEQSSETATSDRTTPSPERQRADYQYPFSSPQQAPQQS
FT                   VSTQQASVSPRREIIQAVEIAQDAPSSNENTPVTARSEISPSREIISIESSPDPITQDP
FT                   TTPVPPPPRRSRRANIGIPPERYHDPKQKLLAVEHEKRDRDAQRATTRAKAKDSGGNNL
FT                   TEGGGKGSAGPGSTGHGAAATTTSAEKVDINEPFLHDRKPLHAKDVDLPSTYKQAQKSP
FT                   FWTQWEDAMQKQLDDLAAKGTWSLILKPLKAKILPGQWRFTVKTNTRDEVYGFKARWVV
FT                   CGNFQEKDGGETYAPVVAECMIKIVFTLIAVYGLKWRQVDFTVAYLNASREDAETVYMR
FT                   QPTGFEHADASGDKNQWVCTLNQALFGLRDSAYLWNEEMDSKLRQIGFHPLEDDPCVYM
FT                   KGKGMNLTIMIIHVDDFIIAAPQDEDIQQVVDALRQFYDMKDLGEPKQYLNCALHRDYT
FT                   NRTITMSQTAYVQKVLRTANVSGWKDTPLPAAXRETPADATNVLDDEAFDQYQSIVGML
FT                   NWLAVKTRPDIRFAVTRLQHRLAKPTFSDYKAMLHVVKYLRSHPDLAIVLGRTDELRFH
FT                   AHTDASHADWEDSKSTEGSVWYLAGSPVMWATKKQTIIANSTTVAEWCALDQPCRDAMW
FT                   LKKVADSFQLPLCCPEIYTDNINSQLLLSKKGGKSANRWLTLRYFFVKDAVAQGHVDIK
FT                   RVDTKKNAADGFTKALGKEQFETFTNLLGMV"
FT   CDS_pept        join(198011..198112,198181..198820,198884..199198)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823087"
FT                   /orf_name="Pc23g00910"
FT                   /product="Pc23g00910 protein"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP79585.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="UniParc:UPI0001833129"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWE1"
FT                   /transl_table=1
FT                   /translation="MSFKSLELVHLPLFKPIAEHTPDHERTYISYQRAAAVVKIYGLTA
FT                   VDVLQFTQKFWNLHLDLVGALDCAAFTLMTIQINLAGGTLAPFAGKHLQYRKLLDQILN
FT                   FDISAQYLLTEVGHGLDAKNLETIATMLPNGEFDLHTPKPSGAK"
FT   CDS_pept        join(complement(201189..201273),complement(201033..201128),
FT                   complement(200836..200939),complement(200626..200739),
FT                   complement(200398..200569),complement(200145..200353))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942559"
FT                   /orf_name="Pc23g00920"
FT                   /product="Putative uncharacterized protein Pc23g00920 "
FT                   /protein_id="CAP79586.1"
FT                   /db_xref="UniParc:UPI000183312A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWE2"
FT                   /transl_table=1
FT                   /translation="MGAYPTPMESTGNVRYSHGSGVPWDLGLAWLLRSDSRRCDEPDTT
FT                   SCLHGMNGDCIDEDDLITTRPSGSSLADSDRTIGGTLMFPSLESNSKRASVLIVSTFAL
FT                   LFQSTLYLRSCADASTRYIPQIPMGLYYTWRPMCGPTLFSDGIWRLFKPDNPTDTEKCR
FT                   CFVLLNGRGALPSPLAMLLVQICVQGEGAVALALVHCGRMSTDLVVPRLSSQYSFKQDL
FT                   WAFTFLQYEQSRFKFEVHPEARQLISSVSCYSGDIFA"
FT   CDS_pept        join(202071..202616,202672..202725,202770..203408)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942560"
FT                   /orf_name="Pc23g00930"
FT                   /product="Pc23g00930 protein"
FT                   /function="DNA binding"
FT                   /protein_id="CAP79587.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR003656"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000183312B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWE3"
FT                   /transl_table=1
FT                   /translation="MDQCSQSSDAGPSNRYEEHLDRLPCPSSDPIQSFNPDLNYRHQTN
FT                   TSAPLFEVVQSISGPESLRRVGPDRKKIYVLYDDMSKEQFIAWWLQTQYATVEGNDKRI
FT                   NWRSKHSSEVWDNFDQVAHQLTGEAKVMCRSCGKVLPHPQEKGDGTNSMRRHLGSNSCR
FT                   RVTSDQFQQQGIQQSFEFASQLSPQLAKRVLLRNNGHFLAKKDFAELIELAQLAPSTPQ
FT                   LLNPVTARRRLQSMVKEGQERVLLGLPPTAKLSIALDCWASPFQQAFMAITGYFIDKDW
FT                   KYRETLLGFEPLHGAHSGVNSSTILMELLQKYDIVKRVLAITTDNASNNNTLIENIQEP
FT                   IQSLRLPNQALIVRIPCLAHVIQLSLRDLLGRIKANPKNDNPGRVWSDSQKQSLRSSRG
FT                   GHFQIAASFCKYP"
FT   CDS_pept        join(complement(205283..205366),complement(205199..205232),
FT                   complement(204887..205135),complement(204254..204820),
FT                   complement(204046..204173))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127392"
FT                   /orf_name="Pc23g00940"
FT                   /product="Pc23g00940 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP79588.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000183312C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWE4"
FT                   /transl_table=1
FT                   /translation="MKSVRFHGPRDVRIDEVEEPICGKGQVKMRPAYVGICGTDLHEYI
FT                   SGPVLIPKQPHHITGSTYPVTMGHEFGGIIEEVGEDVINLVPGQRAVVRPTIVDGTCTA
FT                   CNQGYSHCCEDIGFIGLSGYGGGMSKKIVAPAGHFYPIPENVSLEAAAFIEPFAVAWHA
FT                   VNISPFKPGDSVLVLGGGPIGLGVVQVLKLHGAKNIMVSELLENRKKYCLDYGATHILD
FT                   PREVNVAQKARELTDGIGADVIFDAAGVEKAIVGAIPACRTQGTIVNIAVWEKSPSLPV
FT                   NQLMYNEVRYMGAALFDEPSFVDTIRAVSDGQLKPEAMITSHVSLDEVVDKGFKALLEH
FT                   RDQHCKILVDVQS"
FT   CDS_pept        join(205948..205988,206159..206284,206325..206512,
FT                   206564..206649)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976304"
FT                   /orf_name="Pc23g00950"
FT                   /product="Putative uncharacterized protein Pc23g00950 "
FT                   /protein_id="CAP79589.1"
FT                   /db_xref="UniParc:UPI000183312D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWE5"
FT                   /transl_table=1
FT                   /translation="MDEPGDLGLGQLDWCTKLLWRREGDAVRLTYVMSCHWGIPKLKVR
FT                   QDPTNEQHALLDPPDSCYVAIQRNIQNSNPVSGCGDQAASRPTLMVDGPAFLNLGVPAS
FT                   TVPPCKQVKHAKQAGFTADRKPQYCGIVAILISEPTMTTKRC"
FT   CDS_pept        join(207697..207746,207824..207903,208018..208079,
FT                   208124..208204,208256..208423,208576..208721,
FT                   208811..209130,209216..209366,209416..209538,
FT                   209597..209668,209736..209799)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942561"
FT                   /orf_name="Pc23g00960"
FT                   /product="Putative uncharacterized protein Pc23g00960 "
FT                   /protein_id="CAP79590.1"
FT                   /db_xref="UniParc:UPI000183312E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWE6"
FT                   /transl_table=1
FT                   /translation="MRAKDQSQTFVEPLGLTRWDEDLRGGILGAWFPGITLELIRYLRS
FT                   IIRQQGGRASQQPQAVISTGLREALDRSSISRPVARKQPHHAGKFPDKDDEHIGHESFG
FT                   RGHNVWAKCDFIAIVHEEYKVQKLFLDVVALLIYIRSGAQPVTNASVSVNMASLKMKET
FT                   ETYEFDISQKSVRRPTLPRNSACERPVVLGTRTRNLAKSSRQNLARYFVRVNRNHSTQP
FT                   VFPSYPFCHCSPSSPVILIVPWTASCLIYARGTDYFRVRLENWDPQRCRIRRAILETSN
FT                   TMPKDLGRGKAPGKSKFLPVFEFFFWNGYKSFTSRSLTADYVAGKPSILGATVRFFRRR
FT                   PGLSLGKAKSGSRSVRSGFAMGCMGSNNTGSRMASTLWFGAHFELGAECPCAHRTRNLA
FT                   YRGSNGHVYCGAGLSDIVNDISGTLMGFGRSNGTLAYWG"
FT   CDS_pept        join(complement(210334..212188),complement(210160..210284))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076773" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942562"
FT                   /orf_name="Pc23g00970"
FT                   /product="Pc23g00970 protein"
FT                   /protein_id="CAP79591.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000183312F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWE7"
FT                   /transl_table=1
FT                   /translation="MSIAVLPVELISKICNHLDFQQLVALRLSCRALYKNTLENFAKAF
FT                   YRKIRFVVISESLHELEELSKSKGLREHVQELWMIPVVFDGIENLPGMISISSKSCRQV
FT                   KGDEQESRHAVQKAMLADNGNLLESEAFTVRLGECLDRFKNIQSIGLAHYRTEFLLDPR
FT                   QKTVPFLGRRQIMSRIDFRFDVYSLGESTRTNKASQIRKLNSLALSKLFLALCSSSCRP
FT                   RKLHTCDSNFCGDIGSRIALSEEQLDSLLSTLEGLEDLHLCIDLNEATWLKFLRKLAPQ
FT                   LEVLILSQDHMPSYLVQDEMPAYPAKSYVGHMFHDISFTRLRKLHIHELDIDFSSLRSL
FT                   LLGVKKSLVTLTVQRVTMRSAKSRATENPRSQHAESPGRQENETSVRYASPASHLTPLA
FT                   VNPISPLYQPTVPSHIPTVPSFDPNLPSYHPTVPSFQPTLPSFSTSSPYTPTVSPPEYG
FT                   PAPPSVLPASETASAESAPQLPQHSSTSESSESSTEEYPNTRWLSTYYYPYEPPESARG
FT                   SVCPTWETVMAWKRNEEEITCVSRFLDVLQNELSLETLSLEDIICDGNYYYFERVDNGN
FT                   KQSGQVEFDIRKANLSLKDWISRLRPIASCPAGRVLELKEDKEMEGWFDKMIGKDSGSL
FT                   NRLDCDCNRKKKPFWGCPFGCHRY"
FT   CDS_pept        join(complement(214468..214519),complement(214340..214418),
FT                   complement(214146..214280),complement(213751..214077),
FT                   complement(213493..213705),complement(213209..213365))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000179228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942563"
FT                   /orf_name="Pc23g00980"
FT                   /product="Pc23g00980 protein"
FT                   /protein_id="CAP79592.1"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniParc:UPI0001833130"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWE8"
FT                   /transl_table=1
FT                   /translation="MRFATVLSLLPLALSVGAIKVTEPAKNDEVDVSGSFTVKWSSVST
FT                   DASTVDIVLVNNAVYPPVEEKIASGVDTSKGSYTAPGLKDVTDGSGFQINLISTEAKNT
FT                   GILAQSEQFDVTESDKSSSSATTTGTSSTVSSASSTASAASTSAVSTGTTSTASTSAGV
FT                   SSTETEASSTGTSTPDVSTKPSPTGDFTSGFLNNCYRFYLYRNYHWHPDLHQHRYDYQR
FT                   FFRHWLRFRSASGSASASPTPSTGAAMGLVDPGAAAGLLAGVLALNLSCQKYRPAIDLV
FT                   ITSEIDQSLGIVSVLLVIEQRIDFSDKLLLWELFIRLGH"
FT   mat_peptide     join(complement(214340..214416),complement(214146..214280),
FT                   complement(213751..214077),complement(213493..213705),
FT                   complement(213212..213365))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWE8 "
FT   sig_peptide     join(complement(214468..214519),complement(214417..214418))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWE8 "
FT   CDS_pept        join(complement(219240..219252),complement(218788..218794),
FT                   complement(218689..218741),complement(218074..218549))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670328"
FT                   /orf_name="Pc23g00990"
FT                   /product="Putative uncharacterized protein Pc23g00990 "
FT                   /protein_id="CAP79593.1"
FT                   /db_xref="UniParc:UPI00018331A0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWE9"
FT                   /transl_table=1
FT                   /translation="MGWLETEYTGNRYSKCIPAAARKLLSAQSILSRFPSTDSSVDADE
FT                   TAAATDDRKSSSTSSPVSANQTQGTNDEPSRKRHRLQNGDFVASVPLNTSQFPTSNTNL
FT                   VTNIRLTDASQIQSNDMANRQFVPCPEGNSARAFHRRTNDPGVVNSPEYCPSLAQLPSD
FT                   SQFSDGFNALDFPNLILGT"
FT   CDS_pept        join(complement(221777..221828),complement(221463..221577),
FT                   complement(221261..221365),complement(220941..221043))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942564"
FT                   /orf_name="Pc23g01000"
FT                   /product="Putative uncharacterized protein Pc23g01000 "
FT                   /protein_id="CAP79594.1"
FT                   /db_xref="UniParc:UPI00018331A1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWF0"
FT                   /transl_table=1
FT                   /translation="MVGDERTEIGGSRSSSPIIASVTTLTRSAAEQHLRKLLCSIALLV
FT                   CYLGSLDERSRNRKPSYQRPRLWIVLVAVVFATTNPDQARNKAVSSFNYMYLVRNGLAL
FT                   GDSPIVAACPQLNAYRNCNS"
FT   CDS_pept        join(223038..223081,223389..223606,223762..224180)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823088"
FT                   /orf_name="Pc23g01010"
FT                   /product="Putative uncharacterized protein Pc23g01010 "
FT                   /protein_id="CAP79595.1"
FT                   /db_xref="UniParc:UPI00018331A2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWF1"
FT                   /transl_table=1
FT                   /translation="MHPYYLEQLRLTQQLDNNTATENQNVLSMYGLTSSSPPAGRLCST
FT                   PRTPHASEGGFQFPRGWLPPGELATSPALAKGDARQAQSPGASTQQSRGLFDLGKPDTD
FT                   DEDNHSDATGNTPLPNSSSQRMTGTLALIDPFPLEGDDVSEDNHVRYMFAPVLHNLTDF
FT                   WHKVTVRNCQNRDDVYSVGRDSQTTANPNGYASYGALMTKKSASVQRPRIGISDAQLRS
FT                   LAKE"
FT   CDS_pept        join(complement(226706..226822),complement(226563..226602),
FT                   complement(226374..226461),complement(226247..226331),
FT                   complement(226018..226109),complement(225535..225838),
FT                   complement(225216..225317))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670329"
FT                   /orf_name="Pc23g01020"
FT                   /product="Putative uncharacterized protein Pc23g01020 "
FT                   /protein_id="CAP79596.1"
FT                   /db_xref="UniParc:UPI00018331A3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWF2"
FT                   /transl_table=1
FT                   /translation="MVFANSASAWIGNACIRTNREEPTGYTTTLLTALMMQLPAKKEKT
FT                   LRLLLLAGLGSHQMSSEDNEDHAFDTSSLRHLKIFESLIGVQELYHVDKSKNDPICRIN
FT                   REKEAEKRGCSPVVQPESARIDLGRAAVAHLFMGIPNKRVTNPPAINIALPWWMNVSRY
FT                   IDEQEATVLDKFFSHDELEATKEEREDKLGEVEVDPFSDTEEGDELDDNPENQLEDSPT
FT                   EYSCPCSQSLPPAYTQTRVSTQYWVEGLDPKPNPDWVGSGFYWVVRKTILEIP"
FT   CDS_pept        join(complement(228545..>228766),
FT                   complement(228416..228495),complement(228242..228251),
FT                   complement(228051..228092))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823089"
FT                   /orf_name="Pc23g01030"
FT                   /product="Pc23g01030 protein"
FT                   /protein_id="CAP79597.1"
FT                   /db_xref="UniParc:UPI00018331A4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWF3"
FT                   /transl_table=1
FT                   /translation="VDVSVDVSVDVSVDVSVDVSVDVSVDVSVDVSVDVSVDVSVDVSV
FT                   DVSVDVSVDVSVDVSVDVSVDVSVDXSVDRGGEWSGGEKGGQRLDLAIGPCHPRIMHYI
FT                   LNTSIVYLSTQIT"
XX
SQ   Sequence 228788 BP; 59183 A; 54353 C; 55245 G; 59461 T; 546 other;
     aaaatgtcag cgtgttgaaa tgtctcatgg tgcttggact cacatgggcg ctgcaccact        60
     gcatatcgat ctgtcaaaag ctaactgtta gcaaggtcga ctaccactgt ccaaatcaac       120
     tggctgcaaa cggtcactta cgcgtcaagt aaggaagggt cttgtcggtc gttgtgtgga       180
     gttagaaact cgtaggcggt attggtggaa cgtggacttg ttcctcggta attggctagc       240
     acgcaggctt taccatcaga tgtgcggctt gctacaatgg cgatccggca acccgcagga       300
     ttggcggtgg cgacatcgaa catgcgacga gatgggttaa cggctgcttt caaaatcttc       360
     gacagacctt cggaattata aaaaccatct gtggtcaagt tgaacgccga ggcaaaccac       420
     cggatacagc gaggaattgg ggtttcggac gaatgacaaa aaatgttacg cgccaggtgc       480
     gggaacgcat cgaaacattg cgtgaccgaa gattgattga gaaaaacgtc aattgccgtc       540
     aatgcgccta gaggaggttt cttagtatat caaccacaat aaaagactcg gccactcggc       600
     gtacgtacct acactggttc caatgcacag gtccggcaaa gatgcgatcg gaatgccaat       660
     gcgactttct aaagcccgta gaaggcccag ttggatcagg ccgcgcactc caccaccatc       720
     taaagtgaga atcacagggg gcttcgttgg aggcagttgg cgaacggtga cgtcggacct       780
     ctcttcgcag atgggacatt gagcaacctc gaaatggtac tccccaagac gacttggctt       840
     tccgaagatc acgacacaag tgtcacatat tgcatgttta cacgggagca tatgctccgg       900
     gggtcgactc agacagacca aacaagtagt ggtggagcga agcccacccc accggcgata       960
     caagcgacac aacgtctctt ttcgaatggc tgccgatgtc tttactgcgc tcaattgcac      1020
     aaagtggtgc acgaagcggg atgaaacgcc agcaatatgg tatttgaact cattgtccca      1080
     aatacttagg catcgcttct cataaagtgc agcgaacacc acggtaggcg agaatcctgg      1140
     acaggttagc ttcttaattg ggttcaggag agtatgagtc aagaaatatg gtcataccat      1200
     gcatttgagg gggataggcg tccatcaaga aggccgaggc tacaaggtca tcaaagtcct      1260
     cctttgagta gccaatggat gtttgcgtaa cctctcgaag gcaatcgtcc attgatttgt      1320
     tcttcacata gtcccttcgg gctcttgcca aaagatcaaa tggtgctgca tgcaggagcc      1380
     tttcgtggct ttgtacgcca gtgctccaga aagcgctcag atgagacgcc gagaagcgtc      1440
     gacaattgga aattcgctcg gcctggacta tattgagctg cttaacgatc aatgtttgca      1500
     gtggctggaa aacgacgcta tctgaaagcc cgtgacgtgg acgcaggtcc agaatcgtga      1560
     ctgtcccagt atcgagcttt tggagctgag cgcattcctg tgcgaaggct tctgttacat      1620
     gttgactgtt ggtcaagacg atgactacct gcaggggagc gggaacaacc tcatcgccaa      1680
     ttgtaagctg tcgacgtggt ctctgtaata agtttgttgc ggcttggatg tcagggacgg      1740
     aatcgaggaa taaacacagg atctgggtcc atggtaaaac gagttgcctc ttgacctctt      1800
     gctgtagcct tgcaggggtc aacgtcccgt ctgcgccccc tagtgagaag gtttgatgct      1860
     ttgtcgttga attctttagc cacttggaat cccccaacct ttgttcgaga catagaccgc      1920
     tttcagcaaa caatatagga ttctgtgtat gggcggtctt ggtgctgaga tggagacgga      1980
     tcaagcctgc ggggcctttc cgtgtaatgt tgttgtaggg gaacagagcc cgcaaggctt      2040
     tattgcggtt tgaatttccg taaaagtaga gcagggatgg atattgatat tttggattgg      2100
     gtaattcctg cactagttgt tctaggcggt tggtatcaac taaatcccaa gcttcattct      2160
     ctttgacgag gtcaagccag gcagccatta gagagattga gagattgaga gattgagaga      2220
     ttggcaaaag aatgggccta ttgggaacct tatatacggg ctctcatctg aaagggacag      2280
     gcagtggctt aatggtggtc gacgctcagg ttgaagttgg cataatcttg tctcgcctca      2340
     aaatcccctc tgaaccaaaa atatgtcaag caccagacca gtgcattcgc agacgacgct      2400
     cgcttaaacc gattatgaag caactttcac gttttgtcag atggcattct tttttgacct      2460
     cggaaactag cccacgtagg tctcaccgca agatacaaat gcgtcttccc catactagga      2520
     ccctagacct agttagagca cgtattatag tggcctttca tatggactat taaagcgctg      2580
     acacggttct tgttgatttg cctccttacg ataaccttaa aatttttggg tcatggcctt      2640
     cggtgtggac gatcatacaa gtacgccagc gaaaacggga tcggaaaaga ctccacttcg      2700
     tgaaattgac cctgtgcttg ttctgtcttg ctcagctgcg gatgtggccc cggcgctgtg      2760
     tagagtcaac cagctacacc acgccgatga aaattcctat gtcagaatgc ttagagaaga      2820
     agcagaaatg gatatgcgtt tcagtatcac agttggcgcg gctaactggg cactgctggc      2880
     cggctatcta gtcattcccg gcacattcac ttcgctgcag acctcaaacc aggttgaaaa      2940
     gacgttgcaa gccaacgagg ccggtcgtac agttctacat atgatccaga accccccgtt      3000
     actcgctatt gcgtgcttgc tttttgctag tggaattgcg gctctcatgt ggctgatgca      3060
     tttcccaaat ctcaggggga actacccctg gctaatcaac aaagtttttt tgtaagtgag      3120
     caaatcccaa ctgaaagagg tatgaaaagc cagatccaac tctaatcctg gactagaccc      3180
     ctatgtctac atgctgctgc cgggctgctg accactgtca tcaatgtttg tacatctcaa      3240
     ggtggggatt ggtcggtgat ggctatcata acaactgctg ttactggagc aactctcctg      3300
     agctgttcag cacttcttgc actccacaag ttctacaagc tggagcgggt caggaaagaa      3360
     gatgaggata tccggcgttc tcgagcatcc actgctcttg atacgtgata tcagggtttt      3420
     cagaacggag aagagcctgg tcagaagtat caccgttgca tcgagactgg tattttccat      3480
     cttttccttt tttattctaa ctctcattcc ggtattgcgg aagccctttt gcttctaggg      3540
     tttagttgtg aactctcaca aagagtctgc atgtggacgt ttgggcgcgc ccaatagtcc      3600
     tctcgtccat cccatcacac agcatcactt cttgttcagt tttccgattc ccattcaata      3660
     ttcatcatgt atctctatta tctaacgaaa ttcgtctgat tcagaaaata gcatgttcaa      3720
     tcctaaaaga gattttcgta cggaaggcct ccgcggccag tatattgaag atcggctaat      3780
     atactctcta gatcgatagt atgtttagac tgattgctga tagaccgata gatagcatgc      3840
     ttttacttaa gacacttctc attttgccaa atatacctca tctttccaaa ataaattgaa      3900
     cgataaccct gtagatattt aataaatact gttgttcatg ccccacgaaa gaacatttcc      3960
     tgttgatttt tgccggcatg tttattatga aaccctactc ttatttcctg cgagtctatg      4020
     tagtctccta gtaaaattca tcgaaatgat ggaaatagcc gccttgatga atagaaggct      4080
     gtattagcaa agcgatagta tcagtcaagt tcaaggaagc tagaagctgg ctaaactttt      4140
     tttttgccac caaagttcaa tacaatacac gagcttgccc acctggtgtt ggatgttgtt      4200
     agcaaacagg attattgaca aggtatgttt ggagaagtct aatagctcga gatttggtca      4260
     atcgattccc cggatcaata cgctgtgatt cctcgaaata tcaaagaaaa tgttctacat      4320
     gacagccgta gggagctaca tacgcatatg gcatacggtg aaggaagttg tgctaacaga      4380
     ccaagctctt aaatctttcc attaattgag tgcaacaaga tttggttcaa gtagccatgt      4440
     tgaggaacgt tgggtagtca agcgtgttaa gtaaccagtc atcttattgc gcatgatcct      4500
     gataccgttg aggctatttg gtaactaacg ttgatcattc ggtagtgggt gatcctagtg      4560
     ccagcatgat tttgaaggcc aaggtataag tgaaatgtgc gagagcataa atattaggcc      4620
     aacccccttt gtgagccctc ctttctgctc aaatacatga gccctatcct cagaaagacc      4680
     gcccaaaacg atctattctt gggaattagc cagttttgcc agtgcatacg gtaagaagcc      4740
     cccaccacgc aaaccccatt ccctcgcact atctctaatc catggagcag gacatagcta      4800
     ggagacaggt gttttccaat agaggaatca aatctagcct gggccaaatg acatgtctac      4860
     caaagtccca acgactaccg tgacgccaga aacagtgcct cacgtacaaa accagtacgt      4920
     tgatcaacca acgttaccga cattgctatg tttatgggtt gacaatttca agtaccgaga      4980
     gttttgcacg tgatataatt acgacccacc ctactgtcgg cccaggtgtc ggagacgaaa      5040
     tggcgtccac tcaaagcatg aagacaaccc aaacgccctc ctggaacaac gccgccatgc      5100
     ccttagcttt gataattcca acattcacac tgccaactgg gggtgcggtg gaggctatca      5160
     caacagctca tattcctgcc cctacacgaa tcggacctac cattgcggct gaagggtctg      5220
     gaaatgtggt gtggtcatcg accactcgat ggctgacttt atgctatctg ctcctcctag      5280
     ttgtcaaaat aattgatgaa cgtcgaacca tttaatttgc tcaacaccct ccacggagga      5340
     gcagaatagg gctagctcac gatatctgtc tctgtccagg gataatttta cctcctgttg      5400
     tccttttctg cagcgagact ctagcaaaaa ggaaaacaca atgttggata ttcaagggga      5460
     acagcatctg aacatgttga aagtagacct gttaaaataa actgaaaatt ataagctatt      5520
     ttctgatgct gagcaaccgc acctcaactt tccacacttc aattgacggt gatggaaatc      5580
     ccgatcaaca gaggttcact gtaacctact ataattgcgg caattcacca ccacacttaa      5640
     agatccaacg tcgttatgtt gttaccaacg gactgacatt gcgaagacga aggtcatgtg      5700
     tcaaaataat atcttggagc tataaatggt tctttgaccc ttgtccatcc tcgctatgtt      5760
     ttttcacgcc gcgaacccaa cacaacatga tgaaccgcgc tcagaccaaa cacacccggc      5820
     cttctaccgt gtggcttgat gagtcggcct tctgcaatca gcagctgagt ccaaactcaa      5880
     cggcgtctcc gcatatccaa cccccaacaa tacagaaaat ggccaccgcc gtgatcacac      5940
     caggttcaat ggagccacac ccgggtcgcc cgaacgcaag gatcccacaa ctgaatcaga      6000
     acccatggga tacttttgaa cctaccgctg gttcatccca agatcggtct ctgatatttg      6060
     cccgaaataa gtcggaaaga gggaagttgg tgcatatcca acaacttgaa aaacagttct      6120
     ctcccgccac aggtttccta gaactgatgg aacaagtcgc ccatccaagc ttcctaaaat      6180
     tgctcgaatg ttaccatcat gatgcttcat gcgcattgat ttgggaacca acggaagtgt      6240
     cagtcagtca cattttagcc tccagctgct cgatcaccac cgatgaactc gttagaattg      6300
     tcaagccggt gagccaataa aatctcttgc aggtgcagtc gaaattaact tggaataggt      6360
     attagaagga atccaatatc tgcgcgggct cgggcgagca ctcgctaccc taggcccgga      6420
     aacaatcctg cttacgcagt ctggtgatgt caagattagt gaggtatccg cggatattgc      6480
     gaaaattgat aaaaactgac tttcaatagt gggcgtcgag aatagctgcg aaattaaaga      6540
     atcggaaatg aaccctgcga cgatgaagtt atgcgctcta gctgatgttg tcacgaaatt      6600
     gatgttgaaa aatcgtacat acgagtggga agcggagatt cagaacttac cttgccaact      6660
     ggaaagtatc tccgtcgagg aaatcttgca ggtaagttca tgctgtctca tcatgttctc      6720
     ggctaatgtg acagaatgag atgtttaccc gagattcatg cgagggagag ttgaaattgc      6780
     tggtcagtgt agccaacaag actgcctatc atggtatcaa atcttactat gctcgttgct      6840
     gaaggacaaa ctccttggct tttgctcggc tgttttttga gggctacaaa attgagaagg      6900
     aacccgcgat cctattttcc atctgtgctg ttcggacaat atattattgg tgcataagga      6960
     aagctaggta cggcagattg gtagatggag catggttccg acggtggtag tttgcaaacg      7020
     ctcttcaagc gaacaaatat agtaggctca gggtagcccc tcgactacac tcaatttgcg      7080
     acctgctaca gtattataat cagtccttac ttatatgacc catcggtatt gtcaatttat      7140
     ttgcattggt ttgcattcgt ttatcgccta tttgactagc gtctatgtaa cacaaggagt      7200
     ccgctgcttc tgtttggatt tgagacataa tcatacctgc tgggcaaaat attatcatta      7260
     tctcgcagat gtgctccccg ctggaactat aatactgaaa ccaggtttgt aatcaacaaa      7320
     gagaggtgaa tattattaga ctggaatttt ccacttcaca gacgatctgg attgagctag      7380
     atgggtctga acgctcccgt ctatatattt cagcgatgca ggacccattg ctcatcagga      7440
     tctttataca agtttagcta ccctggcagc caagggaagt gaatgtctac atttcctctg      7500
     gtaatgcagc cattcacgtt ggcaatgaac ataggaggaa aagccagcga ttgtttgggt      7560
     gtgttgtccg acgaatttga cggcgactca ttagccaccg tgatgggtgc gcaattcatg      7620
     tacatctctc gattgccgat acgattaaac catgtccagg ccagggtata tttcccgggt      7680
     gcaataccgt cagggatcgt aaagtggagt tggagagaat ggtccgactc ggcactccca      7740
     tcaagatttc cgggtccttt tgcagggcat cccccttcgt aggacttgat gactttccat      7800
     tccgaattct ttgtcggctc cctatcactg gtgaggctca cctggcagga cccaccgcca      7860
     tgggtggcac tgcccagaag cttgatggaa ttattgctcc cagtccgata agtcgcctct      7920
     tcagtcggaa cgataaagtc acctggggat atcttgcaag gaaagtcact accatctgct      7980
     gcaagtggcg agttgtcaag tgtcttccta ctagatccgt agggctcggg agacgccatt      8040
     ctcaggtgcg catatgtcgg cgaaaatgca actgcctgca aaagcagaca ccatttcacg      8100
     aggatcatgg taaaacgcga gatggcctcc tgtggtcaaa tacaggttag atatcatgta      8160
     gctgaaggtt atactaggat tggcagcggc ttacatatct ccgaagttca catgtatcga      8220
     aggacgcttg aactgttgag gctgccgcgg atatatgagt ccatcacgaa agaacagtgc      8280
     agcctagttg tgctgtcctt cggctaaaag tgcgccacag caggtaacag gtagaaattt      8340
     ggctttcgag acgagaccaa tgtgattcta ccgattgacc ggaagaagtg gtgagcccat      8400
     cattgtgata aaatgtcctc acatccgaat agaaaatgga gttccccgtt taagtgagtc      8460
     gggtcgactc accactcctt gtacgatctg gcacgaattc aacgatggac ttaaccaacc      8520
     aacatcccct atgaagacca atgctgctaa cattctgtcc ctgtgttgaa tttcccctgt      8580
     cacaaaagcg cggcgctcgc cacggaccac catttaggtc tcaagtcact acaaccaaac      8640
     tcgaatccta gaattgtccg ctcaattcct ccttgatttt atcctcctac ttcttgtccg      8700
     ctctcggtca gagccagcga agaatctcaa tatggatgtt caaccaaaac ttaaaaccaa      8760
     accagccgac gcagcgaatc aaaaagcacg caggagaaga aagtcccttt tcaaaaaggc      8820
     ctccgaatat agctcggaat gcgatgccga tatccacctc gttcttcgga tgaagaaatc      8880
     cgggaagatc ttcgttctgg tctcaaacac aaaagattgg cctctttccc aacatcaatt      8940
     agtaagttct ctgcatcatc gatctcgtcg tcagaaaggt actaaattga tttctagaag      9000
     tcctatcatc ctacacccat tcaaatgtct ctaagcgacc cagagtccaa gccgtgaatc      9060
     tctatcttcc atgctagcaa caagtgtcac cctcaattgg gtacccttgt agggttatcc      9120
     tgattgttca gccaagcccc ttgcagctta tgtccctcac aaagtcattn ccccctatca      9180
     ctnatgtgta ggattaacct ccgagggctt ccgtcgtgtc ctatgaatta taacatctgc      9240
     gctgcgcccc gaagattggt cnnagtcgat caaccttatt attcatgtcc attacaaatg      9300
     ctgcggaaat gtattacaaa cttggttgat cacgttaaag gatatgaaga ttcacttcca      9360
     ctgaagggac taacgatgaa ttcatcgtcc gaaatgtaaa ttctttagga atcagaggta      9420
     aataaaactc catcacagtt caagatttnc actcgcctag tcagataata attgccttgc      9480
     tttacgctaa gccttccctc agcttccatg attgttccaa gtacgaattt caatgcaggg      9540
     cctggttgct caatcaggtt tacctccagt ggcctgaaac cgaaaggcat cttggcaaac      9600
     atcgttggac aacgaatttg cgtgcagata gtacgagact tgtttgatga catatccctt      9660
     gtatactcca tcactgatct gtacatgtat ttcccattct accccttcct gcgagtggcc      9720
     tatcgcgccg accgacattg acgacattng cttaacaagc gaagaacagc atcctcttag      9780
     gcacgatatc aatcacaccg tctaaaaagt cttggaatca agcgcctcag taaggatgtc      9840
     gccacctact aaccagcaag gttgtacgga attatgcctg tctgggataa aggcacaaga      9900
     tccccgcacc gccgttgatg agccgaaata aacgagcagt actccctcgt ggaatgctca      9960
     gacgtcgaac tttggcgaga attgcgacag gctcaattct agcgcaggca gggtttctga     10020
     ggagccaccc ggaagggtgt ttgagtggcc ctctgatagt gttgccgaag aataaacgtc     10080
     tccagggggc atcatattct cgctcgatgt ctcgcgtagc gtttcatcgt atccatagat     10140
     gctgcttggt cgcaacgaac gtggcatatc ggtttgggtt gctccagatt gcgagctcac     10200
     atccggtgcg ataactggtc gtgaagaggc catgccaaaa atattcttat cgtttgatgg     10260
     acggcttccc tcgggtccat gctggcagac gcagggcttc gtactcgtca gcaaccggag     10320
     acggttgagc acagagaatt ccaacttcag cttgatgctg tacaccaccg tcttgaagct     10380
     cacttgaatg tagtgtagct tgtactccgc gaggaggagt aaaacgttca ggattacaac     10440
     gaggatgttg atgcaaaata gatggataat ggcgctgcgg ccgtcacgac cgcggattgt     10500
     aatgataatc ttgaaagcac gcactgcttc atatatatat atgccgcaga tgatgaaatc     10560
     ttgtatgcaa aaacccgttg actggatccg gtcgaatatc gcggcagggc gagcaaagcg     10620
     tgcgtcgccg cggttgaggc cgaagaaaaa aacggtcatt gggatatgta ggatgcaggc     10680
     gtttgtaatg atcatccata ggacccaccg cacctttctc atgtcggaga taacgaggtg     10740
     cagacgcgag tagaggacga cggcttggcc ggtaaccatg gcgtaccatc ctatcatgaa     10800
     ggggatggac gtcgagaggt tggacgcctg agaaacaaaa cgagccatag caggaatggc     10860
     atgcaagaga ataccccagg atgcaaattg catgctccag aaatagaggc cccggtagcg     10920
     cttgaatgtg tcgaacgtga caatccctgt ttctagggca ttgtacgcgc cgatagagaa     10980
     cattgacacg atctggatga tggagatgtt ctccatgagg atggccccaa catttggtgg     11040
     caggctggtc atgagtgtat ccatggtcta atatggctta acgagtacaa aggctagagg     11100
     tatagaggat aaacgatccg cagcttggtt tataaaagcc tccgaaccga gaactgtcct     11160
     cccaatgaga tcatgacatt gtagctaggg ggctcctttg aagctctaaa aacgtctcga     11220
     ctcttatcgg ctcgggatat acttggctgg gtttccagtg gtctgaatgg gtctaacggg     11280
     aagctatgtc gaaacctgag taatgtgtag ttgggactga ggcatacaat tgattttcaa     11340
     tccatgccac agttattttt gacgtgaagg aaagctttcc cactattctc aagtcatagg     11400
     gctagtttca cgacgactgc aaaacctagg gcgcgatcgt cggcccatgg ctgatcgcct     11460
     catcttgaat cttgacaaat gattttcgat gaaccatgga aatgctggtt cggggagaaa     11520
     atgggattat ccgtggataa ataggattta gtttcgatct catcggaaac cttaccaata     11580
     aactttctgc tccacctgct ttctaggtcg gccgtggttg aagctgtccc tacagtcata     11640
     ggagaatcca gaagaatcgg gtatgctcac cacggacgta gtgttttgac atattatgag     11700
     gtagcactac tgtattcaaa atattctcga tctccagagt ctgaggacgg gtagaatgag     11760
     ccggatgctg gaaaaggagt gggaccgcag atggcggccc acaccgccga ctcttgccat     11820
     ttccgtgagc caatcggttt ctcggctttt caagcaaaaa ccagaaaata tgattatgta     11880
     accccagctg gtccgttcca acccgtattc aatgtttata aattgtctgc tcgggttgta     11940
     agactggcga tcgaatctga gcaggtagaa agcgcagatt tcgcattcga aaagagtata     12000
     ctcatggaag ctagtacaga agaagttaca taccttcttg aacatccttc aaaaaacgag     12060
     gctaacgaga accaacaggt cgccacccga cggaggacca agttattttc ttgtgagagc     12120
     aggtaggaga acccgaccat ggattgcttt cagcgtacca ttcttctgct ggacacctgc     12180
     gtgatattcc aaatacctca actaccgtat ctgtgagggt ggcctcttca gaaggaccaa     12240
     gcaacaaagg tatgttgcat cattactgtt ctgtcgagac tgggcttgtg aatcgtgtct     12300
     ggaccttttt gaaaaacttt gctacttctt ctcttgacta caaatagaac ctccttgatc     12360
     ttttgcccca tgggtcatcg ccgagttttt aaatcacagg accgtaccag catcggtcca     12420
     tattcacacg cggtgtttga ttggtcctac aagggcgtac tttgtccagg gcttcatcag     12480
     agtgtgatag tagcgttgca atctcgcggg ataaaatggc gatcgtcgag gaccacagct     12540
     aatgagcctt ggtagctgaa atgcctcaaa tggttgccct ggaaactaag cccaggttcc     12600
     tgctatggct ttttcgacac gatctagaag tctcatggtc agctatggaa ccctggtgag     12660
     cttcgacgaa ggaaaattta gcacgacagc ggcaatggtt ggtccaactt ggattccaaa     12720
     tcctagttcc atagaacgaa gccctatata tgtccttcca tgacttccgg attgtttgct     12780
     tctccgaatg gaatggaaga ctttatggcc caactttcgg aaactgttgt aatagtggga     12840
     ccgtgtaaac agtggaagtt atatctggga caatagtaca actacaccgc acatggctga     12900
     ggccagaggg cctttcttgt ttccaagagc ggctcggatg gttcgactct ggtcgatact     12960
     gagacacaac cgtatacctc aacgtaggcc ccgatgtggg gcagtcgatc actttcctcc     13020
     acaataaaat cgcagatctt gtgctttcgc actagcgcac cgtggggccc ctgtgtcaat     13080
     gggcacttgc ctttcaggct catgatgctg atgctggcac agctgcttgg caggagggag     13140
     tcacgctttc acctcgtttc agggcattcg attgtcccca cctaaacctt taaagtcgag     13200
     accccccaga aggccactgc gatcaatcat accttcactt tgcccggcgt ctcgctaagt     13260
     ccgcattgac tcaccggacg gaggatccag catggcaaaa gatcacaagc cctctcggcg     13320
     aggtgcaggc tgcggtactg ccacaacgaa acccgggact ggcagggcat gtgcctcctc     13380
     gccttgttct gctcggtcca cggcctctag gtccaaggcg gaacgtaacc ctctcaaggc     13440
     ggtagggaat cacaaagggc tggtatgtta gtctctgttt ttccttcact tgctcgagct     13500
     gcgttatatt cttttacttt atcccatcag tcgtttataa ctacaccttg ctgacgctag     13560
     cttttagggg cattctacag cgaaaagcac ccgaaagaaa gaccatgaag cgacccaccg     13620
     aaagtgccta gatgtgatgg accagatcca aaaggaggtc cagctggctc ttgaggagat     13680
     agacgaagaa agagcccatg attcccagtc gatgcagcgt ttgcatgctg aaaaagccca     13740
     ggacacctcg aaactacagg aggctatcac agcaagagac aaagccttgg gagagaacca     13800
     gaggcttgaa agagagctct gtcaactgca gcaggcgcag gagtcatctc acgccaccat     13860
     gcagggcctg gtctcatggc acgatattca gccggtcttg catcaaacgc atggcgagct     13920
     agtatcggcg actactcggt tttggaacac gatcgacgcc ctccagaacc gtagactggc     13980
     atcctacttg cctagctcgg gaggcatcaa cggaagttgg cccgagcagg acggcccgct     14040
     tgggactcta ggtcacaatg ccctgcctca gttttccgct ccgggtgatt atgcccttgt     14100
     aaatcaggag gcgccagttt caagcaacca atactaatca cctgtgtgaa gcatggcaaa     14160
     ttcagcgtgt ccggcggtcc tgtctttact atggaggaac cagctagtca gtttatacaa     14220
     gcactagcag gtggatagct catgagataa tcttcagtaa cgccaccacc gtcccatgac     14280
     aacagtaaat atagaaaaca aagattgcgt cgatcggtgt tctgccgtgg aaggatattg     14340
     acgtagatcc tctgacgatt tgactcgctc cgccaagcgc agcttggaag gcagagagaa     14400
     tgttccatga tcgctgaatg tggttagcgg cagggcccac agcccggaga gatgatgcgc     14460
     tgatccgtcg gaagcaaccg aatctaacta atcatgtccg tggtctccac ccagcatttg     14520
     ataggcaata tgactcggcg acattcatga agaaatttgg ctgtttcctt ggcgcttggt     14580
     tcacatatgc ttttcttgcc acttggcaga taataggatt tcaagcgaca gcctacgacg     14640
     ctggcacgaa ctacggtatt tttctggtcc gcccaaagtg gccgaaaccc aattgagcgg     14700
     gctaagcgcg ggtcataaca taagatttgg aatactctac caagcgtacg acagccaatt     14760
     tatatctcaa attgatccac cactgaatgt ggacgtgagg gtccagtggg ccagggagag     14820
     ggtagccgat aaaaatgata cccgggcgct cgagaaacct taatgacacg aatcggttta     14880
     caactgtcac tggcggagtc agagaattcg ttccaaggag ctcagttcgt tacagcgcaa     14940
     ttatagtaaa tatttgtcta ctttctgcag ccttacggtt atttacagct tccagtctgc     15000
     cccagtgaga tatggttggt cgcgaagcac aatgcgatgg tgatacctca gctaacaagg     15060
     ctgacaacag gctcctggga tatattccac aaccacatca tatttcgatc cagatcactg     15120
     ctgcgaccga agggttcgcc tagttgcatt atcctctgta gtactgttct tcccctcttt     15180
     ggccatcatc tcaatagctg tctccacgac cgccagccgg ctgcggatgt cctccaggtc     15240
     actgcgaata gttgcaatca agctgttaga gctctccaat gctttttgca tgagcctggg     15300
     aaaagtcagt ctttgttcgt tctctggtga gtcgcataac taacttcgtt cggatatcta     15360
     gtctaattgt tgtaagcaga cgcatcacaa aacattatta tagggggcaa attcgcactc     15420
     actctgcggc acattgtaag gcgatcatat tgcagtcctc cgcgacatta gcctgtccgg     15480
     gttgttccag ttcttcttct ggtctcgggc ccatactcca ggtgtgtgga ggactttcct     15540
     ggccatcctc cactacgatg tcgttgtggt agttgccaaa ggagccattc tcctgcaaag     15600
     aagacacttc ctccgtggta tcgcattccg ttgaccctgg cgggctccag atatcctcgg     15660
     acccggagga tgactgggac agtgcacgtt gtaatcggct ccgaaagctt tgtcgttgat     15720
     cagtgaacgg aatttttcga attctcccca tagttggatc tgtgtcaagg tgagataatg     15780
     agctctccca gccagatgtt acaggagaag tcgcacaggc tgatatgaag agttagttct     15840
     ccaaaccgga acttgtgatc ggggtgtgct aggccactat gttacatccg tacttgcagc     15900
     aaatttcgct tggtttggaa tacattcagc caatcagtca cgattttcat taaactttag     15960
     gggaatgaac tttgtaggaa gccaagtttt gcctctaaag tctgtttgag gttacattat     16020
     tcagtacccg gtggggcttg gtctgggaac tcattgcttg ttcttttggc gtacagtaat     16080
     tgcattcaag aacaatttcc aggagtacga aattgacagt taggcgttct tatagctagg     16140
     gattgtttca acacagatgg cttgggggag cctgaaatac ggagtcaata attcacaatt     16200
     cagactcacc gaaccgattc cccagaatgg tccatgggtc atgttattga gactttagaa     16260
     gaattttcgt ggaccaaggg tactatctta actttttact gggacctgga gaggatttat     16320
     gctcactttt cccttctatc aggagctcaa gtcgtgctat tgtccgaaaa ggtctcttct     16380
     ggttactgct agttcatgcg atatgtcccc tcgaagcgag gtggcctggg aggaatggga     16440
     ggaaaagaac cttctcgcct ggctggacgc tcatcgggcg ctgccgcgaa aagcccgctc     16500
     ccacgcatac tatgaacaat atcaggtgga ccgaaggttt gagtctgcca gggaaaaagt     16560
     accatattct gcgcaagcaa tggcgcactc ggtctggatc gcctaagcat gcggcccatc     16620
     gaaaccgagc aggagctcat cgctcggccg gccataaggc ttcattagcg aatctcacaa     16680
     gcagaaggcc tgcgcaaagt aatattgaaa aatggattca aataacaatc ctaaccactg     16740
     agactagcca gatcgacagc attgaatcaa tgaagaggaa aggttcgaga ccaggtacga     16800
     actaatgttt accacccttt gaccacaagc taatcacaca tcacaggccg cgcgatgcca     16860
     ttactccgcc ctttacggcg tgaagaatca cgatcgtcat cgcagatttg gaactatgta     16920
     catcgtgtct gtgcagccag gaagctgaga taccgatgag cggaacatcc atgctaccag     16980
     cagtttgttg gtatctgcgc tacatcgcga tctcgaagca gcaatagcaa ctacgtcgat     17040
     gaattagtgt tgtttgatgt gctacgaacg gggaaaatgg caaacatggc agctgagcaa     17100
     tcaagctact gcatgattgt tgtatgtacg aatacacata ttatcaaaat ataaacaagc     17160
     accattcctt ggaattacga caatagcgag ggagtaccga ggttatagtt tgacaaaagt     17220
     tagttcccca gagatcgtag aacatggccg ggatcgtcga tcgatcgccg aatccccgga     17280
     aaataaagtt cgacaagcca tggaaatgct cgctcggtga gaggatgcgg gaggatgcgg     17340
     ctgtcacgaa tgatcctcat ggaaagctta tctaaacagc ctctgctaca cttgctttgt     17400
     agattgctag cccaaaaaaa cgagatccag agcaggacca acaaattctc attctgctca     17460
     tatataggat attgggaaag gacaatattt tattagaaga tactgcattc agtgtcattc     17520
     tcgagatggg cagggtgctt ggaatacagg ttaggtgccg caggtgggcc ggcccacaga     17580
     acccactcct gggagccaat cggttttccg ggtttagttc aaaaaccgga gatatttacg     17640
     taagctcatg tgatccactg gcattatttc tacaagccat ctgctagagt tactagactg     17700
     gcgatagaat tgagcgtatg gagaggactt gtctggctcg aagagagtat agcataatca     17760
     tcaccggaaa gcttggtgca ggagaagata catagcttct agaacgttct actgaccaga     17820
     taggcaaagt tctgcttccc acttgacagg ggtacttact ttctaatgac tgcgaccaag     17880
     tgaacacaac cacggatcgg attgtagcct accattctgt cgccaaagcc tgcgtgttat     17940
     tccaaatact cacctgcccc agcagtacct aggtaacaat cccccggtcc atcgtacact     18000
     gatggccgaa aagtttgggc ttgtggatcg tgcctagacc tttgcaattg tttccatttt     18060
     ctctccacaa atagaacctc cttgatctac tgtcccgtgg gtcgttgctg agatctgcat     18120
     cgcggaaccc tacctgcgtc tgtctaaatt cgcgcgtggt gtttgattgg cccgtcgggt     18180
     gctattcttc tccagggtct catgactgtg atagtagcgt tgcaatcttg cgagggggtg     18240
     gcgatcacga aaacctacct cgtgagccat gggagctgaa ataactcact tcattgtcct     18300
     ggaaactgga gtcgggtttc tattctgggc tttccaacaa ggtctagact tttattctcc     18360
     gtcaaggaaa acaaccaata ccctggattt gggagtatat tcatagtatc tgtaccgaca     18420
     ggtagcagaa gtattagcgg aggcaacatc agttggttgc gagcaacaca gaaagtaccg     18480
     ttagcgcgag gctaggcaaa agggattgta gagggatcaa tgggaggcac gtcttatggc     18540
     caaccacggg tacacaaagc ctccaaccca ttattgcggc atctgttgaa gcacttcaat     18600
     cctcatgaaa gagacggtga ccgtggctag tggccatggt caaaacgggc agagtagtca     18660
     gtctgccaca gcgttgagcg gtttaattgc aaattcaatg atatgtgaga atcatatcct     18720
     tgcagtatca ctgtcttttc aacagtcgaa aaagtggttc accatactga acgcaagttt     18780
     ttgaaagcag gtcgagactt gactctgaag tagcttgtga tccaatagct tcctcgctac     18840
     aatagaaatt ggcatctttc attcagatgt aggcaaacag agatgagtgt tgtcttgcaa     18900
     tgcttgttgc gttgaaccgt gagtgttgat gtgagtgttg atgtgagtgt tgatgtgagt     18960
     gttgatgtga gtgttgatgt gagtgttgat gtgagtgttg atgtgagtgt tgatgtgagt     19020
     gttgatgtga gtgttgatgt gagtgttgat gtgagtgttg atgtgagtgt tgatgtgagt     19080
     gttgatgtgt gttgatgagc gtggtggtga gcgtggtggt gaatagtcgg gcggtgaaaa     19140
     aggtggtcaa cgtctagacc ttgccatcgg tccatgccac cctcagatta tgtaagtttc     19200
     ctgaataggg ggttcagctt ttggaaatct atcacttgtc acctacccca ataaccacta     19260
     gtatagcaga taattgatca taataaaggc gagtcctagt atgcagtata actagtatgt     19320
     cgtgtttata ataaatttac tgatgcgctg gtaggcatta tattgtgagt ggttttgtag     19380
     gttcagcatg ttttgaagtc atatatattt acgcgcaatg cagacgcatc acacttttta     19440
     tgtatttcgg atcacacttt caatttcact tacactggat agtccattgc ttttactagg     19500
     tttggttata gctgaacaca tgcattgtat aactttctac tcaaataacc tgaatacgta     19560
     gcattatagg acatatacgt gcgtagctaa acattataaa attataagtg actgaagtgc     19620
     ttattagtaa gcgacctatg ggccaattag atgacacggg gttacggtca accgcccgcc     19680
     cgcccatagg cagggggtaa taactcagtg tgaatccatg ggcctcatgg cccgtggcga     19740
     ggtttatcaa tgtctcacgg acatagtacg gagattttca tgccatctca cccacataga     19800
     taaatgtatc aatcactata gattctattt cgtaagcgaa aatttctagt cccattctga     19860
     tcactcggtg aagttggcat acagcctcaa tccgataggg atagtagatc cactggttcg     19920
     actatgacca agcaatacgc ccaagaccca cgtgtagaag catgtgatga ggtgccgaac     19980
     gaatggctta agtaaaatta gccatgcggt aggctttgtg ccctgcgaag tcaaagtcat     20040
     ctctcttata tcccagagag cgcaagaatc aaagtaactt taccaaagag acaaccatgt     20100
     tgctgagaga tttggacagg caagcaatca agaatacccg gttggctcct actatgcctc     20160
     ggcaacgacg gatcatattt caaccaatcc cggatcgaag tgacggcaat tgccttttgg     20220
     gaagtgatgt cccaagttaa tgcaatcaac catgttctgc tgataaggga acacggttga     20280
     aacccgattg aaacccgatt gggttctagc agtgccgtct gaaacgaatt tccgttgggt     20340
     gatatccccg caggagtgct agttcgctcg tagtcgtagt agacaatccg gccatgcttc     20400
     caaaagcaac catcacatgg gcgttgattg acggtggaaa gtttgctcca ggatctaggg     20460
     gctagtccaa gaggtcctat aaacattccg attcgatatt gtttcggaca ccaaagtctt     20520
     tacagtggct gcctggccga acagtaacat gcccacgtgt cctccgcagc gcggtgagct     20580
     cgacgaatat atgatttatt ctcaaaaaaa ccgtcgaaat agggatgtag ggagtccgga     20640
     tttcctgaca agtgcgtgat atgttaggag acgatatgaa cggataaagg atacgcgcgg     20700
     tcgactcgac taacctgcag ctgcagtgac acccaggtta aatggtcttt gcaggtagtg     20760
     attcggcttg gataggaaat gcgtgcataa gaacctactg ggcacaccac agcacttttg     20820
     acagccctca tgatgcagct tcctgtatgc cggaggtgat tcttgggtag tgagctctca     20880
     ctggcttgcc tgtgccccga tcttatcctc tcggtttgta cctgagatga ccaatgtcaa     20940
     attgtaagct agaaatgaga agactttgcg tctccttccc cttgcaggtg gacttgtgct     21000
     aacagcctga ttgtctgcgg aggtacactc atctggcagg aagctagaca aaacatcagc     21060
     attcctgtgt cttttggatt tccaggcctg ggaagccacc aaatgtcatc cgaagacaac     21120
     gaggatcacg cattcgatac cagcagccta cgccacttga agatatttga aaggttgcat     21180
     gcttagccac aggtatgatt cgggtagtgg tataggctga tcggagttca agagttgtat     21240
     cacgtagaca aatcgaacaa tgacctgaca cagaatcaat agggaaagag gcctatgtac     21300
     gcgatacgaa ctttctggtg actcatcgtc gatagtcgtc atgtggaagg gacagagagc     21360
     atgcaatcgt aattgtatag gggagctcga gcagacaaga catctgttcg cgtggcatcc     21420
     gactggagtg acagaaatga gggtgtcctc ctgttgtacg atccgagtca gcaaggattg     21480
     atctagttgg acgagttgtc gtagcgtacc tgttcatgga aatcccaaag tgcgcttgag     21540
     acgggacaat cagtttgcgc aatgattatg tcggcttcac aactagatca cttacaactc     21600
     tctgcaatgc agtcaccagc catgccacgt cgcattcaag ctcatcgcaa tctgcactcg     21660
     cttcaaaaaa gccgcgctgg ggtgcacaag acaatttgtt gagacagtaa acgcgcgtga     21720
     caaacccgct tgcgataaat attgcacttc cgtggtggat gaatgtggcg cgatgccaga     21780
     ggttcaggaa ctccacaata gtgcgaaggc ggtggggacg agggcggaag acgcgatgga     21840
     gcacgctcgt cggccgccac cttggtttta tcctcgatct ggcggaatta ggccactcgc     21900
     cacagtatat ttcaccgtcg atgatggggt gctcctataa tagcgtgaag gtgtcagtgg     21960
     tgtcgtgatt ttgggcacaa ggcttggtat atttaatcgg accggcgcag cagaagacgc     22020
     gataactcac tatcaggaag gacggacgcc tcaagcttcg atgcgactaa gtttgcactt     22080
     gaatctccgc accctgttgt tgactcgcta tcttggtttg cgatcttcca cctaggacat     22140
     gctgcattgt tcgaagcgac ggggctagga atagtgtgta agccatggct ttgcgtggag     22200
     cactgacggt agtgcagggt tatcagggcc actctggtga gctcccaaag gttcactgtc     22260
     aattattagc cagtagacca gcgtggaatt ccataactca cattttctga tggtcaagac     22320
     cagggatgaa gagtggccct tgctctggtg cattgtgttc gaacgtctac ggatctggct     22380
     gtcccgcgtc tttcgggtca gtgcagtttc aaggatttgt gggcccatat acctacagtg     22440
     tgagcagttg cacttcaaat ttgtggtcaa ccagagccgc gacagtagat cagctcgcta     22500
     tagcagagac gtcttcgcat agacgccttg accagctaat ccaaatctcg tatctccgat     22560
     cggctgacgt aaatggggca gtgaatctgc ttggaaccac gtctcttaca gtacaggaac     22620
     tgtctggttt gctggtccac gatgtatact ataaatgcca gtacggtata aattccagta     22680
     ctggatcaaa ggggagaact tatcgagcgc gttagtcaca agcaagcctg cccgactttg     22740
     cagaatcaag tgaataatag tagagcaatt gcaggggtag aggacgtatt tataggcttt     22800
     tcggcttctg tcactcaccg acctggttgg aagtgttgaa ggacacattt cttaatcgag     22860
     gcctgttgaa atccacgtct tcttttaccg caactctttg cagagacatt cttgatgcct     22920
     ttagacgcct agcgagagag gcgagtaaga gcggtgctga gagaaaggga tgctgagtcg     22980
     gtcaagcaac gttggctgac tgttgaatct ttcacggccc tcttaattga ggcttgtggg     23040
     agaaatatga tcgacaatga catgctcata tcttatgctt ttgatcagcg catctatgag     23100
     cgactcaacg ttggatcacc gaaaagctcc tacaatttca tccctaggaa tcatggacct     23160
     ttgtttctgg cctcgcttta gtgttggttt gtgttgggct gtgggtctgt cggcctagac     23220
     tgcagaaagc gaggtcacag taggatatgc ggttgctcaa cccatcaacc cgttgaagct     23280
     tggccaaacg ttgtcaacac tcaatttttg aagttgtgaa caaccttcga agatacattt     23340
     cttttctttt cttttctttt tcgtttcttt ccgaacttct tttttggtga ctctaaggtc     23400
     tataatgctg tttgccgagt ttctgaggct ttcaacgaaa gtggaagagg tgtctagttg     23460
     agatatctct cacatcaatg ggcgtccata tctggccctc aacatcgtca ggcttgatca     23520
     gttttccctg ccaacccgtt gacattcctc ctctcaaatt tactaccaag cgcccgctga     23580
     aaataaaagc aaattctatt cagaagctga ctgcgttgat tgactgatgt ggggatcgta     23640
     aaactcagtc tatagccgtc tgtctgcgtc tgcatattct ataagagata ccaaggctag     23700
     ttggaaacag tactatccag atccttgaag ttcttctgtg gacaaaatgg actccccaaa     23760
     cagctcgcca gaccaggaaa agcaaggaga acagcagccc aatgaattgc caatccttaa     23820
     tgataaggac aataatgtgg aaccttctga tcatgtccct cctttggtaa gtgaaaccat     23880
     tcggcttcaa atgctttggc tgaccatcgt agacctcccc ttggcaacac gaagaagaaa     23940
     caagacatac cttggcgacc gagccgtttc aacccacctt gaaggtgcta gcagaccttg     24000
     aacgcgacga tcccaaattt gcctttccag cagctcgact tgttgggctc tatcgacgcc     24060
     tatgggagtc gtgtgtctcc aagcatatcg atggccagaa gctagagcag agcaatcaga     24120
     acttgaagga ggctggtaca cacctgagag aagagaggga cggacttcag cttcgccacg     24180
     acaagcagct agctcgactg cgcttttttg agcaggcact ggaatcatct cgggaacgac     24240
     tgactagcct actcgatgac tggaactacc tctacagtcc caatttggca gggttgacgg     24300
     acgtcgcaag agaagagtaa ggaattgcct atttcgggtt gccctgtcct atattggcaa     24360
     catagaaata ctacaagcgg cgacgcagtg caagggaaat tacaccgcat gcaaagcagg     24420
     ttatatattt ccgaggcttt taacaagaag ggcaccaaat agtcattatt cattattgtg     24480
     gtctttactg aaatgagtat acgaacaatc ccgcttgact cagattaatc tcactcgtaa     24540
     ttactcgata tattatgtac aaaaaaccgt gggtccaggg atagcgtcgg gggaagccta     24600
     gtcaatagag aatgtgtcga gtaactcgaa tacagtagag attccgtacg aggccaaagg     24660
     gagagtcgga agctagtgcc ggttgcacgg acagcatgcc aggtgattgt gtctagtagc     24720
     cgtctgcgta tccgatagag attccccatg gccgtttcaa cccgtggcag gaagaacaga     24780
     tactctccta tagtctcatc agatactcgg tcaaatcgca caaatcgaaa ttctatccag     24840
     tgcacctctt tagggaaaag gagcgctgac atgtggagga aaatgtcgct agcccgagta     24900
     gagttggaca gaggatctgg acctgtccac ttgagcccgg acagactgtc gagattggga     24960
     tagaaaaggc attcgataaa ggaaggctct tgagtttcgt attctgcagg atcgtctttg     25020
     ccaagaaaac cctgccacag atcattggga tcagtagcga gacagggagg cggtgtcggt     25080
     atgccagaac attcatgcca gatagcgtga aggtcaagat ccaaatcgtg gcctattaac     25140
     attagtgcaa gatattatca aggcaacggg aacagaccat tgttgttcag ttcgttcatt     25200
     tctgttataa gacgaaaata cccaagtgta taaagattta acgtgggctg ggagggatgg     25260
     aaagctggag gctgagcagt tattttattc ctctcttatt acacagaatc aggacaaact     25320
     aggggaattt atagctagat gctaagttat cgaatgcgtt gaacgtatca acagcgtgca     25380
     cgttggtacc cgtcaccaac ccaaggaaaa ttcactagca gtataggcct tatctctcct     25440
     tggggaaaag gcaaatagat agcggaaaat cccaatgtca ttctccctgc ctcgtaaacg     25500
     ctctaccaca tggagtctct atcaaggctc aggctcatcg acggagtagg cttgaagatc     25560
     gctcgcttcc aaggctgaaa caacaccatt acaaagagcc tgaaccgctc gcttgcgctc     25620
     ccacaatact gaagcttgtt cattgcagag ctgtagaagg atatcgctat cgcttgctag     25680
     caagtcattt gacgcctgaa gctgtcgctg ctcctcctcg agtcgtattt tctgggccga     25740
     tttgacgacg tagcattccc ataggcaaaa gtacaagtcg agcaatttga gggctggtgt     25800
     agcgagggag tcattgaggt ttactacttt catgaactcc gccgtaaggg taccccgtgt     25860
     tctcattgga acctattcag tattagtggg tttttttatt tcctttctag aggggattga     25920
     cctaccttgg gttcgatagt tgtgccgttt gaagcttgct gtggatggtt ttccaacttg     25980
     ggttcatttt ctggagcgtg agatactcgg cactgtctct tggccggccg atcaatgggg     26040
     gaaggcgaag tgggatggtc cattttggtc atcacgatga attggatcag gaattatgct     26100
     cgaggggcat ttatagctga caattcacgt gaggctgctg ttatttctac cagtgcttcc     26160
     tcagctaggg tcgactgaaa ttttgaagcc agtgaacagt tagctcaacc gctggcgctc     26220
     gatctcacca gccgctcagg gcaaactgct caggaataag cgggattaaa tcgcacctac     26280
     agcattgaca caaactaatg caaagactgt ctcataatgg tagtctacaa gtgtacttcc     26340
     gatgcgtgga tgctatatat tactttcaaa tcattgaagc tttgccgtga ctgcaaacca     26400
     ttcgaagtgc ggaagtgcag ataatttgat tcccaatgtt gatgtcaaca ggcgctggga     26460
     acagccatct cgtctcacat caccagagct acctggagta gatgtcgcta gcccttacaa     26520
     tcgatcaaat attctcctcg gagacctttt caacaatttt ttagtagtgt tgtcgtcata     26580
     gattctgctt cgaatggcct tctggatgca atagtccttt gctagatcca gggatctcct     26640
     caaactgaag tgtgtcagtc tgggattggc tacaagtgca tcaacaatcg agaaatgtcc     26700
     acccctgacc gccaacatca atggatcctc gaaccattga ttcctcaggt tgacatcaat     26760
     tcggacatgg cgtagtagtt cccggaccat ctccaagtca ctgccacggg cagcaatgca     26820
     gagagcagtg tcatgggttg cgaccgtgct ttcattaaca ttcagacgtg cgccttgctg     26880
     tactaagagc cttaccacat cgagatgacc atgtgaaacc gctcgacaaa tgggcggatc     26940
     tattaaaccc cttccattga cctccacgcc ctccatactc agtaaacaag caactgtctt     27000
     cacgtgtccg tgatatgcag caacggagat tggagagtgg cctgcaacgc agagattcag     27060
     agcaatccct ggcactgcaa gcagccgtcg taaaagtata gtatccaatc tcgttgcggc     27120
     atggtgtaaa gatgtagacg gggcctcaag tctcccacgg cctccaacga aattaatgtc     27180
     gatgtctttc tccgccaaga gcctttcggt tatctcgtcg catgacgagt aagtagacag     27240
     ccaaagtggc gtattgccat ctttgtcttt gcagttcacg ttggcaaggg ggtggctcag     27300
     gatcaaatcg accacttcca ggcntctgct ttgaacggcg agatggagcg gcgtatagcc     27360
     tttccggtcc tgaatgtcca agttcagatc cttttgtcta agacgccact tgacagcatc     27420
     tatcgaccca tgcaacactg cctcatgaag aggtagctcg gaatcctgag catttcgggc     27480
     acctaaataa acttcacagt cggggccatt gataaacatt attttcatgn cgggtntatt     27540
     gattcgacat gcccaagacc angccgactg gcctgaatca tcttccaagt nagggtcgct     27600
     gccacttaaa agtagcagtt gcacgaatcc tattcttcct gtgaagactg ctaggtgaag     27660
     cgccgttcgc ccgtatctgt gtttaatgtc cacactgncg gcgcggtgct ctagcacgct     27720
     cttgacgatg gaggaactcc ngtagtggat agcatatgac agggcgctgt cgcgcgcttg     27780
     attttggatg ttgatatcta ggtctcgacg attgagcagc agttcgcgca cagcagcgga     27840
     agagtatttc aacgcccgca tcaaaggagt tttgcctcgg taaaatgcat tgatgttngc     27900
     gttgtgctgg agcaaagcat ccacaaggcc aacgttgtcg tatttgacgg ccaagtgcaa     27960
     cagattgctg ttctgaaatc tgatgttgta tttccaggtg ctgggctgca gtctaaaatc     28020
     aaggtctttg catgatttgg cgagggcgaa taatgcactg ccatccaaat gcgacacgat     28080
     ccacagcaaa agctcgttgg gcaggtctct gatgtttggc tgtaatttgt tagctcatcc     28140
     gtaacttcag taagaaagaa ttggaactga ccatagtgga acagcanatt agaactagga     28200
     atcaaataat ttgtatatga gggtgagctg tggggtgtga aagttggacg tggagaggtc     28260
     cttatatact tgcctcagct aattccgcgg tcacctaggg tgtagcccgt caccgctgag     28320
     aggtgcctag caatcacgcg gcagcattaa attcttgaca acaatgttta ggcgggtgaa     28380
     agaatccttg gactctagct cctgggaaca ccaaagctgt tcctggtagt tgtcgatggc     28440
     cctaggaacc gaatatagtc tctacatgcc cacacctcga atctagcgcc ataggcgtcg     28500
     aagcaaataa caatctaaca cgcacttcga aacttccata ggcaacccag aatttaacct     28560
     agcatttgtc gactttgctg cgtcccgccg cagccaacct gttcgccaat gcatggtcaa     28620
     cgcaacctac agctacaagt gcagctgatt tgggcagcag tgatgtggaa tgatatccct     28680
     tctcgcaggc cactgatcgg cctataccgg cgcgtactgc atccaaatgc attcttcgac     28740
     gtaccaactg tttcaaggaa ggcgttgcat gtcagcagcc acgcagccat gtaggtaagg     28800
     aggctacggc gatggcatat aaagctgacg agggaacact gcggagattg cccaacatca     28860
     actcccatcc aaagtatttt ctgcctttca agacaacctc aatgactacc atgccttgga     28920
     acccatttgc tgtctgcggg atccctcacg gtggtcctgc gtcctgttgc ggggtgacga     28980
     agaaaggcca gccgtgcaaa aactctgtca aatttcaaga caccaagatc ggccatgaaa     29040
     ggttgaccac tctcgccaga gagccgtttg acttgtcaac tttgcagtca aagctatgtg     29100
     atattgctag agccttcctc tgcgcgagat ggcaccgtca acagcaggcc gaccaagttg     29160
     gccagcggtg gtatgaagca gccatccgca accaggcgcg agtgccgcat ggctctagag     29220
     ttgccgctcc atccattgcg catccgggcc agcgtcagat gtcgtcagtg tccaggagtc     29280
     gccctgcacc aggcaacacc gacaggtcac ctcacgggct cagacaagac ccaccggtgc     29340
     cgctgtcaac caaccccgag ccagtgcaac cattcaatcc atttgtgact tccacaatnc     29400
     tgcggacaaa cagtgttcca tggcatgttt cgctggctca accagcgatc ctgacatcgg     29460
     tcgctaacgt ctgggctggc gtccaaagct tgacgctnaa ggatctcacc ctgagtgacg     29520
     agttcgacga catccactgt gtattttgtc tggccgagga tgatgacctt gcaaatgaga     29580
     gtgtgatctt gcgctgtcag tgcaaggcgc tttcccacct ggcctgcgcg gaagagtggc     29640
     tggaaaaacg aactacgggt tttgnnacgt catgctgtgt gtggtaagta aggctaattc     29700
     caatgatgca atacccaaga tgctgattaa tacagtcgaa atgaagggcc tttagacgcc     29760
     ttggttcgcc cactacgagt ccaatcgtng gatgctgaga cacgtcatat ccacacggca     29820
     actgaatcat ctcccgagag agaacttgcc actatcagga atncatcaca aaatgacccg     29880
     agtcggagtc agctgcgaca gcgctcagtg ggaccccaag ggagatcagt cgagcagagt     29940
     gtggagaatg gcccccgtcg ctcggctagg ctaggagctc atctaccacg aggcccttct     30000
     acgtctgcac caccccgccg gtcagcacga ctaaactcca ctcgaaggtg atcttagttt     30060
     acagcggggg tgtgacggga atgagaaatt agcgaagcga ctgtcaatca caggtgaagg     30120
     cacgtgacca gacacaccgc attcggccca gcaacatata gcatagccgt ggtatggagt     30180
     tttagagcaa gtttagaaat gatgcaaatg aaattcagaa tgttcgaact cgcagagcac     30240
     caaaagtaaa accacgctac ctttacatct ttgcaagtac tagatgctaa tacaccccca     30300
     agagctgtgg gcagtttcgc ttaattttgg gatatttttt agatcgaaat catattcata     30360
     cccaacggtg gtggccaaag aactgtagac atggatttat ctcagtggtg cgtgtcgcgt     30420
     caagacggag attgttgaca gaagaaaaca catctcgggc cggcgaagga ccctggcaaa     30480
     ctcctgtgct gcttaggttg actctgggaa tcaatatgtt gaccctggga aactcaaaag     30540
     catttctagg agctgtctac agtatgtgtg tgtgtgtgtg taattcattt acgctgaccc     30600
     ctcgtcgaaa cgatatgcag cctaccgcta ctatatatat cttcctatgt acatgtatcg     30660
     tgtaccactt cctaagcgaa cttggagcct cgccgaggcc tgccgtggcc tctatgccgt     30720
     cgttgtgttt atgctgccct tatggcgcgc ggctttgaaa ccgtcgcgat gcttcagcaa     30780
     aattcaagac agcctccact gtcttggttt gtgatgcact gccaatctta cctcctcctt     30840
     cttctcctgg tccacccaac agtgtcggta tgctgttgaa agcatcgcca accttaattc     30900
     gcagctctct cctcagttct ctcaatcgtg ggcaatctaa caacacgtgg tgaacgcttt     30960
     cccgttcacc acagacgcac agatcgtcgt ctcgaaatcg gaaagtcttt gcgtatgttg     31020
     acaaccagca gtgtccggtt cgcaactgcg tgaataagta cgctcgattt ctaggcaggg     31080
     agccgtagag ccgtctggtg tacttggctg gtagtgtgtc gtcgatctga cgcagatggg     31140
     cgccggtgct cgagccgttc cattcgttct tccattgggc gtggatccct tgcctaatgt     31200
     gtgctctctc gcgtgataac aaacagcaaa atgggtgagt ttgtcccggc atagctgcct     31260
     ccttggccag taaatcggca gcgtcgttcc ctggcacttc gcagtgtccg ggtgtccact     31320
     gtagtcgtat cgacgtgccg tgggtcttgg tgttcctggc tgcttgtaga atggcatgga     31380
     tgatctgtcg tcccgacttg ttcccgggat tctggattgc ttgcagggcc gacttgctgt     31440
     cactaaggat agtggcagat cccacacgcg agtgggatgt tctccagtgt cggagagcga     31500
     ccttgttgat gatgttgata gcgtacagga ccccaatcag ttcggcggca tgtaccgacc     31560
     accgatccat gggtccaacc tgcacttgta tgctgtcgat tgtttctagt gagtcattca     31620
     gcgcggccgc tgcggcacct agatgacctt ctcttcccga ggcatccgag tacaccacga     31680
     tgtccgcggt tgaccgtgcc gcctcggccc tttctatcgc gatctccctg tctgattcaa     31740
     tctcgatttc cgagaaggct tcttttcgcc aaggtggtag tggggttgga tcaatctttc     31800
     gatttcctgt agtctctcca agttcatggt tttcaaggct tctgatagcg ggaaccgggc     31860
     gaacgatcca cgattgttac gtcttctctg ggctcgattc agggcgttcc atatgggatg     31920
     tttttggggt agggtatgca gtctagtgat ggtattctgt gcacggtagc gcagacgaag     31980
     gtgcgttggt agtacatgtg cctctacgtc aagtgtggtt gttgccaccg ttcgaaatgc     32040
     agataggacg cggatgagcg ccgctcgttg tacggtgcgg aggtgtcgta gatgggtctt     32100
     gtctcgaagc ggatcatgcc agacggtcga tgcgtagtcg acaactggtg tgacgcacgc     32160
     ttcgtaaagc tgtcgcattt gctctggacg gagttgtcgc aagcccccaa gcgcgatgtt     32220
     gaccttggtg gctcgtttga cggcttgctg tacgtgttcc ttccaccgta gctcatggtc     32280
     gaagattaca cctaggagtt tggcggtcgt agatggtttg atggtattgc cattcataac     32340
     aagctggccc tggctctgtt ctttcctctt gcgagtaatg tgaatgagtt cggtcttctc     32400
     tgcggcgaag caggacccag ttcgccgggc ccaggcttcg atccggggta tgtcttcgga     32460
     ctggattttg gccaggttct cttcagcgct ccagccaact cgccagcgga agtagtcatc     32520
     gatgaaggca gaagccccac cgtgaaaatc gaccggctgg tcgaccaggt cgcagttgaa     32580
     gaacgcaaag aggataggtg agagtggaga gccttgcgcg agcccggcct tgtctagcga     32640
     cgccacctcg gtctggtagt cgtcgaaccc aatgctcgcc tggcgcccac tcatgaagct     32700
     cgcaatccac ttccgggcca ccgatggtat acccttggac tggaggcgga cgtccaggct     32760
     tgtcttgttc accccattga aggctccctt taggtcaaag ggcaccagtg agacgacctt     32820
     ctgtctgtac cacgcccggt cgattgcgtt agcaagcatt aggagggctt gctcggttgt     32880
     tcgtcccgga cgtcctccga actgagtatc cggtagaaga ccgtagtgct ccgcgaagaa     32940
     ggacagccgc cgggccatca ccgcttccaa taacttgccg agtgtgttga gtagcgagat     33000
     cgggcggtaa gctccaggta gcgagtagtc tgctttcccg ggcttccgca ggactatgat     33060
     tcgcgcgctt ctccatcgcc gtgggtggta tcctagttca atcgatgacg tgaaaatcct     33120
     tgtgatgata tttccgagat atttccagag acgtttccag atcaacgtgg gtagaccgtc     33180
     ctcgcctggt gctgttgtgc cttcggcagc cctgagagat cgatagattt caatctcgga     33240
     gattggatgc caccggatct cggttggggc gtgggcgggt gcttcctctt gcgcagacgc     33300
     catagatggg aaaaacgaat ccatgaacgc ctgagctttc tccacgttgt caactagctc     33360
     cacatcgcca accttgaggg cgggaataca gccccaggag actcgtggtt tcatgtaagt     33420
     cgctgccttc cataatttcc cttctcctgc ttcgtctagg aactgtttcc aatgggatgt     33480
     cttagccttc tcaatggtcc gagtccatgc ccgccgtgcc tggcgcatgt cctcgaacat     33540
     ggccatggtg cgggtgtcgg ctcgtccgat ctcagcgcag ctctcttgcc acttgcgtcg     33600
     taggcggttc acatctttct gttgggcttt aaggtcggca gtgaagcacc gtttggagta     33660
     cggggaaggt ctcatatcgg gtgtgtgctt gtcgactgca ttcgctgtcg tgcttgtaag     33720
     tctctacgac tgtgtccagc gcctcggctg agtctagctc cccgggttgc tcgaaaagtt     33780
     cctggatctc ctttccaatc ttctcccagt ccgctcggtc gtacgccttt ctcgtcttgc     33840
     tggtggggtt gcgtcgcgct tggaggtacc attctgaata agtgcctcgg tgatctgaac     33900
     catagttgtc gtggtagagg tggcatttga agagtaggtc cggtctgttt gtcactgtct     33960
     ggtcgatcgt ggaacttctc cccgggtggc ttaacgacca gaaggtcgcg gttccccgag     34020
     ggaggcagct ctgaaggcca taatcatgaa agaaattgat cagttcccca gcgtcctcga     34080
     taaatcgagg ttgaatgtgg ttgctccccc acgctgggtg gtggcgattg aaatctccgg     34140
     ccaaaataag gctaaaggtt ctgctgtcgt ctcgtgtgac gttttgaata gtgtcgtgga     34200
     ttgccgataa ggtcgcctcc gccgatgctc catcaggcgt gtgcatcggc acgggcggaa     34260
     tgtagactga gaagatcagg atttgggagt cggccgtcca gactttgatc gccgtcagat     34320
     ccgggtgatt gcatctcact tgtcggtgag aggaggttga gagtttgcga ttgacgtaga     34380
     taaggcttcg gtatcgaacc gaatcgcttt ctactgtggg ttgatagagt cgccacgcgc     34440
     tgtggttcac gtgtgttcgg taggcagtga tcgacggttc ttggataagg agcacgtcta     34500
     gtttctggct ctgatggtcg ttgatgagag cttccatgcc cgccctcgat tgcatggtgt     34560
     ttagttgtag aattctgagg ttgttgtcta acattgcgat gggggtgccg tggctggcgt     34620
     cgggcatagc aagtctccag tcggatgttc cccgctgcat tccaagcagc gcgctctgat     34680
     gcccggggga catctttctc gctcatgttg gccgccacag tggccacatt ggggtgtctc     34740
     tttacacgac cacgctagat ggccgaatcc ttggcatcgg aagcatcgtt tctttttgat     34800
     ctcacacttt tccactcttc caatgtaccg ttgatcgatc aacaggccat tgtccagcat     34860
     ccattctgct gcctctagtg agtcgaacca gatgcctatt gaggcgaacg ttcccagttc     34920
     tttgtctctt ttcttcagcc aggctatgtt ttcgattcga aatccgcggt cggtgagatc     34980
     gttctcattt gcgatctttt caatggcttc ggttttcctg ttttcgaggt ccaacccaaa     35040
     ggtcgggata tggtgaacgg cgactccgaa acgtggcttc accagtctag tgtcgttgcc     35100
     cagctcggtc agccactcgg tgttggtgcg ggccgtttcg accgacgctt ggtttttgaa     35160
     tcggatcaca tatccggttt tggtagtacc aatccccgca acctgtgcgt cctgggtgga     35220
     tagcgtcttc gacagtgccg tcctgatgtg ggcgttcgca gccggggtgg ggaggtagcg     35280
     gccgaacgcg tctccgttat tgtctgcgcc caacgcttca gtgacagatc gctgggtgct     35340
     gattcggacg cagttcttgt ctttgtcagt ttgtcgccgg gtctcccggg gttgcggatt     35400
     gtccgtgctg gccgcaacgg ccgcccatga tcgtgtcggg gttggagcgt tcctctcctt     35460
     tacctgcgac cgtagcgctg caatctcttc ctgtagcttc tcattctgag tttggagctc     35520
     gttctggtta tctttcactt ctctcagttc ggtcccggtg gcgcgaatga gcgtggtttg     35580
     ctcctcgatg gtgtgttgca ggtgtacgat aatctgccaa atctctctgg ttgtcactcg     35640
     tccagtgctg gttccggtat tggtcagttc cacgggttcc ggggccgcgt gggtctgctc     35700
     gctttccact cgtgcatgtc tcctggtccg gaccgtggtc gttggtgcaa ggttttctgt     35760
     tacgacgatc cctgtgcctc ttcgcgtggt tgtggtggca aggggttcgg gagcccccgt     35820
     gggtgggtcc gccattcgtc tggcgttagc tcccgctcgg cacacaacac aataatttat     35880
     atcgcaatag tatcaaccac aacgtccgcg caatagtgag cttttctttc agtccgtcac     35940
     cttacagata cagtacgttg agcgccacgg cttccgagcg tgccaccaaa agaaacgtgg     36000
     ttccagaggg ggaagggaga cagtcttcta cctctacgta ccccattgta cagtacgttg     36060
     cgaaaccggt gtaaccgcct ccactcttcc agtacctctc aaggctcacc gccaagagag     36120
     actagaatat attaggaata gcctcggaat atcaatattc ctgtttcagt ctcgatacca     36180
     tgatccactt tcattgaata ctgtgccttg tttcataaca gtattggcga cccaacgtaa     36240
     ctagaatttt ccatggagat gcaaaaatgt caaacactgg atctgaggat tgtctcgaga     36300
     acctacaaga tccagcttca gatatcgatc aactacaaag aagacagtgg acctcttttc     36360
     ttcagattct tcagaacaga cagagaggaa agtcatcggt gaccacacga atgcttgttg     36420
     accgggatgc tcagtttgac gctaagcagg tctaaggcca acgttgcgtc tgacgccacg     36480
     tggatcgtgt tatgtgatgt cccgggcctc catatcgcct tgaaagacaa tattgctagc     36540
     aagatctgcg aaaagggccc tcatgaaata tgtagagtaa ggtggagttc tcgagaccca     36600
     tgctgatgtc cctggcaatg ttcgcgagag ggtagattca agcaacaacc ttggatgcaa     36660
     aagttgaata attcaagaaa gaacgaatgt catggggaac ttgaaatatc ccataaatgg     36720
     cttaggtaca tggtgttata gcaaccgtaa tactattggg aacaattgct acgcgaaacg     36780
     caaaagtgta cttaacatga cccctgttcg agtagtaact tgccacccca tatctgtcaa     36840
     tctttttcag gccaccactt ctgtcttcac acgacacggg gaacaaacat aaactagtgt     36900
     cactgtgtaa gacgttagcc agggcaaagg gatagtttaa atcactgcaa ataacaaacc     36960
     ttttagggcc atttatcata cgtctctgaa gacaagaaac ccctgtgttt gcaaactgca     37020
     tatatattat gtgaagtcgg aaccaggtgc atcaacccat gcacacaaca ccaaaagaac     37080
     tctttcctat ccatcgtcaa catctcacca agaagacgat ccatgtctgc catatcaagg     37140
     acagcccgac ccttctcaaa aggcccgctt tctaacgaaa caagtcgctc aatgactttc     37200
     gcatcctgca cgctgcagtt attcctctcc gctgccaaaa taggcagtcc gttctcatca     37260
     cacgccgaga ataccctccg ttgttcaata tcaactgctc cgcacactgg cacaggtgga     37320
     taccatggag ttttcaactc aaacagaagg cttcgtccca ccatgcccat ccgggtagac     37380
     acccatttct ttaccgctgt cgctacaaca ttttcatctg tctcattgtc gatattcacg     37440
     agaacagtct cttcatcggt acgtctggcg tgtaagtcat caatgtattc acgcaatgac     37500
     ccaaaattgc tctgcaattg ctcaaaccac gctcgagatg acatgatttg cggagagtaa     37560
     cacactggat cgagacagag tttagaaaaa aaaagaacct tgtggacttc acaaataaaa     37620
     acaacactta ccttgataat aaacacaaat gcctcgtgag gagcgtgtta agttaaggta     37680
     gaaatcggct gaaaaaaggt ggggctgaac gttcagacac tgatagtcac gtgctaggga     37740
     gcagctggtc ttcagcatga tactgtaaat tgtggactca actcaggtta aatactttgg     37800
     attattttag ttgcagcagt agaagaaaga gcccctgggt atttttagaa actttaagcc     37860
     tcccaggatc aattgaaggt cctccctgta ttatattaaa catggtttgc ttctgctaac     37920
     tcgccacttc tggctgatga ccatgttcac tataggaaga ccactaccag atccgtcagg     37980
     tacgagacaa gacaccgtat ttaacgacag tacataaatt gaagtatcga gactgataca     38040
     ggaatgttaa tattccggtg ctattcccga cgtgttctag agcctcttgg cagtaagtct     38100
     gaagaatcac tcgaagagtg ggggcggttg caccggtttc gcaacgtact gtagatcaag     38160
     attcggttgt gttcgtccgt catataatcg aagtatagac agcccccggt ggcgcaccga     38220
     tagaacttgg accgcggaat tctagtttct ccaccatccg cacctgctat ggctcgtctg     38280
     cttaactgca ttccgtggtc acagaagcat gcaggatttt ctgccaggac acctcgcata     38340
     tcgccaaagc aggcaaattc tccacagctg taacaagcat aatacggacg accgcagttg     38400
     ccgttcttat tgaaaggcga acaaggatat tttttggtac tgcggccaca gtgaagacag     38460
     cggggcgggt tttgaagtgc aggatgtctc attcgaggat tggcaaatgc catggctaga     38520
     ccgtccatcc ctaagagaaa gcacctggtc aacgtcgttg agggattata cgggtgactt     38580
     gtgtgcgatt agcggacacc aaaggcacca aaatgcatgg gaaagtgatg gtgggggaaa     38640
     tgtgttggcc tcagaaaagt agcgagataa gcgtaccatt atgccgcaca gtgattggct     38700
     ggacatggac gtgggtctct atgaatcatc taagtgaggg ttggcagggt ggtgataaat     38760
     cacagtcaga aaatcccgga gaggtcaact tgttagatgg ggaagcttcg attgcccagc     38820
     tcaatttccc actgcaccca tcagtagctg accttgtgaa gcccattctc tcaatggcgt     38880
     ccgaaatgca ttcttcaaag agctataaat agctacctga atgtccacta tcattcagca     38940
     ttcttgctaa atcaaatact taatgagaga tgattcaata agatttcttc gtaagaagaa     39000
     ttgcagaagc ttagtgttga atgaacaatg gaaaaacgag accagatatc attaacgcct     39060
     taacacccga cgccaaattg tttagactat taattctcag ggataggtaa gactttcttg     39120
     acactttcaa cccacttccc aatatcctct acgaaccgcc gagcgatgcc tattttgatc     39180
     cctttctcaa tgaagaaatg aggatcttga tctctataca cctagtcaag atcaagaccg     39240
     ttttcgagca tcacatcaca cacttctcga aatgcagatt tgagggagtc gttctcaaca     39300
     ttcgagacct gccactcacc gtattccttg acagctacat ctctgagacc cggaatctcg     39360
     agtgggctta gagtctgcga attgtctgct gccttcggag ccgaggcatc aagcccatgg     39420
     ggcgcagact gcgaggacga aacatcgatg ttgataggtg gatatgctga cccagcccca     39480
     gtgatatgac ttcctttgtg cttgtctctg cccagtctat cttgctcttc ccggtataat     39540
     tcgtcacgaa ccgcttctgg cacatctttg tggccttcta gaacaccgcc cctctcaacg     39600
     tgggttatta ggcgtttgat gtgatgagat ttaagtgggt agtgcttttt ccccattggg     39660
     tccacccagc aatgggggcc atgctgacat gtcgacgagt cacatcgcat tagactgtag     39720
     acgctgcgcc aaattggcct cccgccagat gtactttcct ctgcgtcgag ctgtgcgtcc     39780
     cgctcgccga gctttttttg cgtgacagat gacttccctc ttttctcccc tttccggcca     39840
     gcagatggag gagaacgacg atcgtctacg tagttgaaac tgattttcag cgtaagttct     39900
     tttccacgga gtaaaagatc tgaccacatc agaagctgct tttcgacggg gttccaggat     39960
     atatcggtat cgtcaaatcg tttagtcaga tttcgcttag tacgatcagt tgctgatgcg     40020
     acgatgacgg tatcatctgg tctcacttgg cgatggcgag tagtcttgcg tcgtaaagcc     40080
     ttctctaact ttttctctaa ggacagctgc cagaaggcgc taggtggcaa aacgacatct     40140
     tcctccgtgt cctttgacac ctccctgtta ttgactgtca ctcgccactc tatacggtag     40200
     tggatgcatg ttggtgggtc ctcatcgtag gctttcccgt cttcccagtc acacagtcgg     40260
     agaaatttga gagcgcgtgg agagcaatta atcgtaggct cgatactgtt ctcaactacg     40320
     ctcgatgggg aagggctccg ggtcgatatc gctgcgtagg ggctgccaca atagccaggt     40380
     gttggggcgt aatccgagtt gtgttcccat ggttcgtgcc cattagactg agatgcatca     40440
     tcgaggcgat attggctcat ctctcacaat aatcacaatc cttgtaaagc ccacattagc     40500
     tgggtgaacc aggttaggtt tggggctggt aacgaatggg aagcgcagta ggagggcaca     40560
     atccatgaag ataaacaaaa catctttccc taccaggttt agctctctac aagataagca     40620
     cagcgttctg acctatgact ggtgagtcga cggttccgct gcatgcggta agaatgagag     40680
     gaataggcaa aacgtggctg acaggaggga ggagagctta gcaggcgatc ttgccagatc     40740
     gccagagcta caaactaatt ctggagggtt ccatgtaata ttactgtact ataacgatga     40800
     ctcattgatg acgatataaa tattacgaag actgtactgc cggaattatc aggcggtgac     40860
     cctaaggggg ctagcgtcct gcggaattat ctccggcaat caagtagtaa gagtatggtg     40920
     gtatagctga tttcgaaaac tactgtattc cctgggaaac acaatttagc tcctggggct     40980
     tttaccaatc tctgtgaggg tctcacgtat acatagaggt ggatagcgtt gaaagatgaa     41040
     taatcaatat taagaacaac tatagttgac tctagataca agacgtagcg cgaggaagca     41100
     aaagaaaggt agcttcctcg cgttcagggg accccatata caccatatgg gtcccgcgta     41160
     gatcatatct ccatccgttc cgtatgcttc atgtatatcc ctgacactga atacacactg     41220
     gccctgggaa catattggtt agttctggga gctgttgcac tcctaggacc atacttctgg     41280
     atcctagagt caatagcttg ccttctgagg tcgcggaacg ctcgcacaag acagcctcac     41340
     cagacctccg cacaaaactg agacattcga ccactcccag aaggcttagc catagcccca     41400
     ggaaccgcac ctgaggttcc aggagtgggt gaagctgcca acaggaacat gactttaatt     41460
     cctcgaagtg ggggtaaaag gccccagaag ttacgtcggg cttcctgggg tctatttgac     41520
     ccccagaaac cgcactaaag gttccgggag cgagagaact cccagggcca agacatgcgt     41580
     tcccggggct gataaagctg ccaacagcaa cgtaactgat tttgtgagtg gggatggaga     41640
     gtgtacaagt tacgtacgat ttcctggggc catatgattc ctgggcggct cacatgttcc     41700
     agggtcaatt tccgaagagt ttacggcaat caaggtagat ggatatttat acagagaaca     41760
     tcgtcagcca tcacctgtcg tttacatcaa gccattcaga atactgctcc aatgttggcc     41820
     aatatcggcc ggctagtcag gtcaagcggc gaacatgctt tgattccaat taggaaattc     41880
     atcgaaaatc atcatataat tatgcaattg ttcttattcg taaatcctct ctgcctctcc     41940
     gtcacagccc taccatagta ggctgttgga ctcgcctttt tgactgtttt gtagctcggt     42000
     ccgtgttctc tgctaatgac ctcgtaagcc gcatacggca aaatgcacga gggacataat     42060
     gatcactaga gatccgaaag cggcctgacc aacggatcca taatacataa tcttgtaata     42120
     tggaatgtgg ctcctgtcaa aaatctcgaa agatgtttgg aaaccgtgga cgcggctggc     42180
     aatccagccc cctaatgaga gaacgatcat gctcacgacg atttgaatgc acccgtagta     42240
     aaaccgagcg gcgcagttct cttgtagcca ctttgggtag atcataagga caaacccgaa     42300
     gatgtaaaac agggctgaga ccagggccgc aatcaccatg ccatcgacga cgtcgtccat     42360
     gagggtttgg aatgtgatgt ccaaaataga gtcgctcggc gtcacgaggt cggatttagc     42420
     acggtctcgc aggaggacag caaagtgtac agtggccgag ttgagactgg caagggctaa     42480
     ccaggtgacg gtaagggagg caatgacaag acgcgtccga atcatggtcg ccgaagtagt     42540
     cagagacatt gtgtccgcag attttccgaa tgcaggaagg tgaggcaggt ctcattcaag     42600
     gaaacagtga caagaagtaa agaacagcag cggaatgatg aagcaggtca acctcggagc     42660
     agagtgaatt tatacgtact atgcgctctt cacacaaatg ctgccttaac aagaaatagc     42720
     gcagttgata gtgagccgtg ccaggtgcct ttttcatgct ttgttgcctc agtggcaatc     42780
     attataggcg cagtaagaat gtttcaagta gaagcactat ttctatctta agatcgacgg     42840
     ccacggaaag tattcctgat acttggtagt aaagcagctc taggaatcac ttcgtgtatt     42900
     cctaggatct actatccggt gaaacgggga cactatatca tcatcatctc caggacgatg     42960
     gattgtgcat agcatatctc aagacaagtg gtgattccag aaaaatattc gatacagagt     43020
     ttgccttggt ctttttgcga tacatcactt tgctatactc gaggaacatt ttctttgctg     43080
     ttgattggga aaatcccgaa catttccaca ggaagacaaa tccccatttt ctgccatttt     43140
     tgttgagctt actgtatttc tttgccagct agcttagggt ctgcttccaa ccataaggca     43200
     acccttactg ttcgttgaac caaggcagcc gattaagaat cgattctgaa ctgtgaaatc     43260
     taaccaaata ccgccaatga gtaggtaact aacatagatc aagtaggtat tctctgtctg     43320
     cacatgctgt tggtgttaag taatcttcat gttcaacgtt gatgtaaacg ttgatctgac     43380
     cccagtcacc acccgtacac cgacaaaggt ggttatccga gaatactcgg taaatgtatc     43440
     agcacgacac taccaagcta tcgtggacga gggcaaaggc cctagcgctc ctggaagcac     43500
     aaatgagact ccgccagtcg cccattttac tgattttact gtggcttttt gcgcggctga     43560
     atcatgacgc aataacaagt ccctagatat aggaaatgca tctcccttcc gtatgtttct     43620
     attcatgacc aacttctgga ggcagtgatg ggtcggcgcc cgtctgcctg ggcactaatt     43680
     agagggcgag cggggcgaac ctccgaggca caactctgca ggtcctatag gtagagaact     43740
     acggagtacg acgaagcaca aaatactaac tctagataca ttcaagctag cagaaaatat     43800
     ccctacttgt ccacattagt aaggtagtga tttgatatag cacctaggac cctagcatct     43860
     tcaaagcgga gaccatgaac caggccctag agcgcctcgt aggcgcagct ggacttgacg     43920
     caattcgagc attccgagct ccctgtgtat tactatatgg aagcctggca gctttcagcg     43980
     ccacgttttc atttattact ctgaggtgga ttacgtacat gggttggcca agtggcagat     44040
     ccaggaaata aaacgcttgc ccagcaatag atgcggatat ggccccggcc cttagcgcat     44100
     tttgtttcac tcgcgggggt atcgtttgct ctgcatcttg attagtgttt aaaacctcat     44160
     aaaccctagg agccagccac aaattacaaa caatggtgac aaattcgaag gcatggcttt     44220
     caacaggtct caattagttt aggcaccccg ggcccttcat tttctgctac caactagatc     44280
     tttcaagtga ctggacatgt ctagagggct ataaattcct cccctacccc ttttcattat     44340
     atgataattt gtggaccact taatagtcga gcaggccttg cgctcaaggc agcctgagaa     44400
     tttctttttc gcaagtttac tttttgaaac gactgcgagc ttctcattgg ttcttgacca     44460
     agatcgtttg ggttctcctt tacatcatct caagctctgt ccatcgaagc ccgattgccg     44520
     cgatggcgat aaagcctacc cctggctgtt cagacatcgg cctcgagttt gatcgcttga     44580
     aggacgtcag ggcaatatct ctcaatgcaa aacttgtggc ttttgtcgaa aaagctcatt     44640
     catcgcttca gtcacgagga atttttaagc aacgggattg ctacaagaga tctctccttc     44700
     attatgctgc tatggggaac tgtacaaacc tccttctata tcttctgcaa agcaagccag     44760
     atgttgattc tcgtgaccag tgggggcgga cagcactctc ctgggctgcc gagtacggct     44820
     cattggctgt tgtggaaacc ttactggagc aaggagcaaa catcaattca tccgattatg     44880
     agggcggcac accgttggca tggctgatac acgccggcaa ccctgaaatg gtagacatag     44940
     cggcaactga ggcttaccta agagagaggg gcgcgaaaga agtcaaattg agaggcatca     45000
     agtcggcctg ggtttgggtt ttgagttatt ctcatttact ccgatacatt cgccctcgta     45060
     tctgaggcgc ccgatgacat ggcgaaagcc cattctatac tataccaata cgtatattag     45120
     atgaacgtca taactgaggc agctggaaag cactgcggcg agaggttgga ccatccgatt     45180
     tcacactatt gttgtctttc tttcatgtca atttggactt gttgaagtgg agacaaaaac     45240
     aagcaagttt atttgagcat aatggatatg cggatatgta tttcattagt aaaaactcta     45300
     gtcttgcctg gcgatacaga gctgtagggt aagggtacac gtactcgttt ccactttagc     45360
     ccgtagcggg gctggtacat tcgaccccgg actgtctact agaaggcttt gagttcatag     45420
     ctcttcgtac tggccatata ttgaccgttt caagtaacac aaggtcttgg aacctttgtt     45480
     taggatggca aaggccctga gcgatgtttg ggagcaggat aagacgacat attgattgtc     45540
     tattctattg aggctataaa agcaagctag cttgttatgt tttaaatatg atgtcataat     45600
     gtcctggtgc tggctccgcg tactagggac tatgccacag ctctctgacg tagggtaata     45660
     tgcagcttta gggccaatct aattcttcga gctgaaccac aatggtagag attctgtaga     45720
     ttctccatca cacttggcat tagtcaagta aacaccatac ttctccaatg tgtttttaac     45780
     gagttactgt atagggatgg caaacacaac tatgccttaa ttgatatttt aaccacggca     45840
     gaggtctacc gtttccgaaa aacagatata gctttcttac tcacgaacac gcatgtccat     45900
     ggtatcgctg gcatcttcaa caaataggtt ggagtgatat cactttaatc gatgcacaat     45960
     gatcttcaaa gtaaagtaac gctcaatgtg aatgaaccaa ccccaaagag ccttgtgcct     46020
     tgtccttgac aagctcgacg gggttgatta gtcagcctga ggtgggtgct attcttttgt     46080
     acatcagaca aatcccggtg acgttccatt gcatttcatg tgggaaaggg ttcttctcga     46140
     gtcagggggt agcgtgcctt tatgggcacc gcagtgcaat cttgccagtt cattcaaaaa     46200
     gtaccgcccg ctcccatctc atcatttaat cggtgcttag cattcttcat cttcttcacg     46260
     ccatgacaga atagaataga agtcgctctc cgtttgctca ctttgtcttg ttgcaatgca     46320
     ttcccgttca atggatccag gaggactata atgaatatac gcactggatc aattccttgt     46380
     caacgagtag gcaaaccttc agagagaata cagagcagtc cacatatgat tgtaaacaag     46440
     agatgctcca tttacttaac acagaagtcg agaagctaaa gttctactat aacaaacccg     46500
     agggaaaaac ttggatgatc ttccgtttga tcgaagcccg tgttgcacct ctcctcgtcg     46560
     caccattact tctcaggtaa ttcattgtag ctgctcgatt cggaccccta cccgcttgta     46620
     ccagccacga caagggtgtt gtgtacatat tgtccatgga attgatctcc gctccattgt     46680
     ccagcaaaag cttcaccgca cgcaatgcac tgtattgcgc ggcccaggag agcggcgtcc     46740
     tcctgttctg atctaggtca tcctttgctg tcccatcttg taggagataa agaaggagct     46800
     cagcacagtc acccattgca gcatagtgaa tgagagacct tttaaaaggt cctcgttggt     46860
     tgtatatccc ttggtatttg agcgttgcct gtgcatcgtg aagaaacgcc atgacgtctt     46920
     catcaaagca tatctctcta atgcctttta ggtgttgaaa ttcactatca atgacagtca     46980
     tggagcgagg aggaattgcc atagtgattg taggtacccc gggatggcta caaaaaagcc     47040
     atataaagag ataccagagg cttgtttggt cgtcagggaa gcggaaagat aggaatttct     47100
     atatatgtcg cgatcgtccg ctttatatag caagtgttca aactgtacac tactcacgta     47160
     cgatagaacg ggcctgtgtg gaatagtcga ttgaataggt gatggatatc atcagtttat     47220
     atggttattt atttgcgtcc gctaagtagg gttttttata ttcaacgatg gatcaagtta     47280
     ctgagggttg ttggcaaccc gaattcaaat ttagggtagt taaaaaagga ggaggatgaa     47340
     tagaaaacca ataaaagtgg cctatcaagc ccgatgaaca acatagctgg tccgatttcg     47400
     aagtttcggc catagtctgg agtctgtaca tcagtgtccg cctcaacgca ggtaaaagtc     47460
     ccggacaatt ctcgccgcac tggacatcag tggtgcccaa cagtcgggtc tgctattatt     47520
     atatgctttt agaccgcatg caagtggtga acctttgtcc ggttatatca aatcatgacc     47580
     agtggcgctc tgaggagttg aggcacgatt cgttgaattt ttctagcata gctcaggccc     47640
     acagaatata atgtatattt ctgatggccg gttagtttcg aaggctaaaa aatgatgaga     47700
     aggtataacg gagtccagca agattcaatc ggaacaaatg gcgatcaata tactcatgag     47760
     ccttccataa cgatacgaga cgggtacctg cgaactgata tcgcctatac cggatacaaa     47820
     ccaacaccca atgcaggtcg ttcatggtct cagtgtggaa aaccaggaga acttccaacg     47880
     ccaacaccaa agcgagtttg cgcgaagcca tgacgcccat catcccgcaa atatactcgc     47940
     actccccatc gagttgctgt atgatgccct agattatcta tccacggagg atttggtctc     48000
     gttcgcattt tgtcgatggg acctgtttca agctctgatt ggcttccttg aacgcaaagc     48060
     aaggccatct ctacaaggtc ttggcctctt agtcacactg ttcgaggaac agtggccaaa     48120
     gaaatggctt cgaattatcg tcccgatctg cgccagatcc gaacagccga tattgagaga     48180
     tcttgagacg cttgtggggt tattcgaaga taatcattgg cggaaagagc agctccgaga     48240
     tatcattata gtatcagcta gacgtgacca accaaccgtg cacagttgtg ttgagcttgg     48300
     atttgaagag ctggcttgcc ggtatttgcg aaaaaggccg catacactat tcgatacgaa     48360
     cattctccac atgacagctt tacacatctc tgtcctcaaa cgttttcaaa acattgtgcg     48420
     ggaaattgga agtatagctc ataacatgcg tgagtttgat cgggtggaat ttgtcaatcg     48480
     gcatgacgac attcaaaaca ctccactcga ctatgctatc acgaccccgt cttcgactat     48540
     tgtgaatatg cttattagcg ctggggctag aatcgacaat acagatcgcc tagggtatac     48600
     tccgctcatg aacgcgtgtc atcttggacg agacgaaatt gtccactgcc tggttgatcg     48660
     cggagctgac atacaagcca caaataattt caacctctcg gccctggaat gcataatgac     48720
     tggtgaaagc cgaacgaaga agaccctgtt gcagcgtata tgtccccatg ctacccagct     48780
     gcaactgaac agagcacttt ggctcgcaac caatgacaag aaagagtttg tgggtattct     48840
     gctcaagttt ggtgcagacg gccaatacgc cggtaactta gaagaagacg gttcttacga     48900
     tgcagaacga aatacggatc caagtgcaac tacaccacga ccggtggagg caagcacgcc     48960
     gttgtcccga cgtcatttaa gtccaagtat cgccactggt gttacatcta gagaagatcg     49020
     ctacatcatc tggaaacaca gaaatgaatc tcaagcgccc catgccagac gatggcttgc     49080
     cccgtttccc tggaattttg cgaggaacgt ggaaatgtcg gatgctgaac ctgatatcac     49140
     caacgagtcg acctctgatg gcacggcggg ggcacaaaca cgtggaatga atgattcaag     49200
     cgtcggcccg caactatttg tggacttcga gaagttgaac ataagtgaag gccgtcctga     49260
     aaagaaagga cgccacgaag atccccaacc aggcgacata gccgggtttg gcggcacagg     49320
     gaaaagtcgg ttcttcattt ttcgggttgg tcccgcccag gcccccaggc acgtgtttcg     49380
     aagaacaagg gcgtatagca ccgaaggttt cgaaaatctg tcccacaatc ggatttccct     49440
     gctcagatac aacgccccaa acggggatcg acattggcaa tatacgagaa gaaatattgc     49500
     cgggtttaga ggcatcgcca ttgatgaaac ggagagcaac cttaagtgtc cacagacatg     49560
     gatcaatgtc gaatggaagg atatcaagga agagcaccgg tacttgttgg tcgacgaatg     49620
     cagctggacc cctaggacgg atgtgattcg gttgtcgggc aggaaggtgg ccagcactgg     49680
     aatccgcgca atctggacct tgcaggagac tctgcacatt aaggcgatcc aaaaagaggg     49740
     taaactggtt tcacctttgc catttccttt ggctgccttc gaggcggaca aaataaagcc     49800
     agagagatct cgcacaccgg ctcaattgcg gtctttttca tcgaccacaa agagccggtc     49860
     tagcacctca cgagacaaca tggctgatgg tatcaaacaa gagcaggagc aggagacaag     49920
     tactgttgtg ccgtcccatt ccgccactca ggacgatcct ggatcgaatg ttgtcgaagt     49980
     cgaaagcagt gggagcagcc aaagcaagaa ccaggcgcct aaaaagttta atgttcaagc     50040
     ttacatggca agtgtggaaa agatggagaa gtggaacgcc atgagcgaag ccgagagaga     50100
     aaagagatac agaatagcct tggcaaatta cgatcactac agggaggaga ggctgaacaa     50160
     gggtgatgtg gaggttgagg atgaactttg aggcgaaagt gaaggagctg gaaataattc     50220
     ccgcgttaaa gatgttatag acttgattct tttgcttttg gttttctttt ttcttttttt     50280
     tttggcgaaa ttttgactaa atctatgtgt caagaaacca gatgttattt tggaattacc     50340
     gtctttgcct ggcgtccaag acttgacgct caagaatctc accctgagcg accagatcga     50400
     cgacatccac tgtgtatttt gttttgccga ggatgaagat cttgcaaatg agagtgtgat     50460
     cttgcgctgt cagtgcaagg cgctttccca cctggcctgc gcggaagagt ggctggaaaa     50520
     acgaagtaca agttttggga cgtcacgctg tgtgtggtaa gtagagctga ttacaattat     50580
     tcactaccca agatgctgat aaatgcagtc gaaacgaagg gcctttagac gccgtgattc     50640
     gcccactacg agtccaatcg tcggataccg agacacgtca tacccacacg gcaagtgaat     50700
     cattatccga aagagaactt gccactatca ggaattcatc accaaatgac ccgggtcaga     50760
     atcagccgtg tcagcggtca gtgggaccac aagggagatc agtcgagcaa gtgtggagaa     50820
     tggcccccgt cgctcggcta ggctagtagg ggctcatcta ccaccgggcc cttcatatgc     50880
     ggatgaaggg cgccgtctgt ggacccggtg attggtgctg attagatgcg tgaaaaaaaa     50940
     atttgtcttt gacatgctct cttcgtatgc tatgcgaaaa ctggcagtaa atgacttgtt     51000
     agacgacttg aaattggtgt aaaaacctcg ttggcgatgg gactgatggg gtggtatgag     51060
     atatgcttat atggaaaaat atatatcata cgacttctta acttcgagat gacttcaaca     51120
     cctagtggtt gaaacgtggt cggttggcct cgaaatgaaa tgaacaacta aatatgaacg     51180
     aactctgata ttccgactga aaatatatgt gataccctat accctgttgg tggtcgtggc     51240
     gcttgtgtga tgtatcacgg tcgcctggga ttggcacccc atcacaagga ttcctgattt     51300
     cggaaccctg taaccatctc tgcatactcg aaacgcctct aattatcttg actatgaaaa     51360
     aaaacatacg gaaatccgag gtccgagtcc agagtccggt atccgatcac gtggtcagac     51420
     ttccagaccc gccaagcccc agcctcccct tttcccattc tctctgggca tttcttcttc     51480
     accttctccc tccaacatca tcatcctgta aaggaagtat tgctctttgc cgttctcgtc     51540
     gcctgtcctg tcatccctgt gacgacatag ggctctccga tttcacttgt ggacttcgga     51600
     ttgggcatgt actcggggcc tggccgcaaa agctttacca ctttactctc atcttcttgt     51660
     tatcattatt catccgacat tttacgcgag tcagggctgc tcaacgctat tcgaaagccc     51720
     gggtgggagg gctactcgat tcattgaggg ttctttttaa tccagcgaat attgcaacaa     51780
     cacgatgacc aacacatcgc caaacggggc ctgggttttc gagaaggcaa tacttgttta     51840
     tacacccgat ttcgatgttt cttgttttgc tgtccttcgt attgcccatg ataaaaaggc     51900
     caacgaagga tctatctccc ttaagattac ggcagatctt gctaacctaa gcgtccgatc     51960
     accgctgatg ttgaacatat ccccaggagt agtcaaagag tgtacattag cccggaaaag     52020
     caacgaccgc ctctgtccgc ctggtttgtt ttccatgctc ccggcgcgtg tcaaaaaagt     52080
     ttcggccgtc tcaacactga gtctgacact tcgcaagacc ggcattgttg tttgtccgac     52140
     tgggatggag tctctaagcc cagccaatcc aggagacttg aattttgatg cattcgcgaa     52200
     aatttgtcat tccacatctc tatgtctata catttcccaa cgacaatgtg cggacgaaga     52260
     acttgatcag ctagaaattt tctcaggtgc cctacgaagt cttcaggcaa agacttttaa     52320
     gaacgctcgg catggtgtgg aggagagaga ttgtggtgtc tttgctcggt ggctcaatcc     52380
     aaatccaccc ccctatcctg aggagcgcgt gtccgagcag ggggatccac ccgtatattg     52440
     caagcattct gaacaggtga ttggaaaacg gcgcacaggt accttgtcat cctcttatcg     52500
     tcctttgtac gttgtcgttc aatagctcat tgatagtgtc tagggtcaat gtcacctgac     52560
     gataaagcac gaaagagact gctccttaca tcccctggac ggctaggctc tacatccccc     52620
     gaagcgctag gctctcccac cgaagccaat acaccgagta cttgctcctc gtcaccgtcc     52680
     tcaatccgcc caactgactt tatacttgct tcctctcctg gccgcacaaa gcgtaagaga     52740
     cttgcgcgcc tcgaagagga gctccgtgga gtttccgatg aggagatatg ccaagtatta     52800
     attcgatcag gacggcgaca tctgctggcc ctacaaaaat atgtcagtga tctgccatcc     52860
     gagtctgaga cagtcggaat tgccaatgtc aagatgcttg agcgccgcct caagcacagc     52920
     ctcaaacaat atgtcgatga gacgattgag caactcaaat cacaagttgt cggtgatatt     52980
     gtcgagagtg ctttaaatga gtgtgatgaa gcgatcgagg gacgatacag aacgcacgaa     53040
     gccgacttag aggaacaggt cgacgactat aaagttgacc taggcattac ggccaatgac     53100
     tgtacgaagg aaatagaaga acaagcgcta cggtgcatgg atgatatcga ggatcaggga     53160
     atcagggttg agaagtctgc gacagaaaga ttcgcagagc tcacgcgctg cttgagtgat     53220
     tctgcccagt ccctacttga tagcaagtca agcccaggcc agcggcgcac tgagggcact     53280
     gaggctagac gcctttccat ttagatttgg tattatatct cctaggattg tcgttataca     53340
     cttgagttct ttattagtcc gctagaaagg caagtgccga acgtactcct aagcgagcag     53400
     gccaacctag aacttgacat ctatgccatg ggggtgtgcc atactaccac gatgggcgtt     53460
     cctgtctagg ggtacatgtc ggagcgtcca gactatcaag aaatcttagc gccaggaaga     53520
     tcagtaggcc accgtctggg tcatcgagga tgccatttaa cgttcaacgc agctcgtcgt     53580
     atgccgacgt ttatttcatc gtggtatcaa ctcgtaccgt atccacattc gacggcccgg     53640
     tccgtcgtac gagcctatgg tccccggccc accctgttct acggggtgct ggagtctggt     53700
     tgactccaag ttagggtttc ctcaactatg gtagaaaagt gggccaaacg ttagacatca     53760
     atctgcacca gccaaagcgc tcgatcaaca tttgcgattc gttccagcag aaggtgcggg     53820
     gctcattcga gcgcgatgga tgttcgtttt gtgtttcgcc cagtacggga ataccgatcc     53880
     tagaacgtgg tcttagctag acgcgtctaa tggaccatct ctggctgtca cgatgagaga     53940
     gtttgacgtg tcgtcggctc tttcgtaagg atgcgacagg aagcaagaca ttataacgat     54000
     tgctcagcga ggatttgtaa cgacggtcga tcagtggaca gttgcgctac caaagactgt     54060
     ggtaagcctc gccgaggtaa ttcacttggc cctctcaagc ctggtcgcca tgagcaggtt     54120
     aataactcca acttgccgct tcattttaaa ttcttgacat gtgctggctt cctaactgcc     54180
     ccttcaacgg tgctttctca tgccacaaga acgttgcagc cggggatgta ttaatcaaga     54240
     cttctttgat atccatctcg ctattgagat tctgagtcta tgtgagcctt ctccctctgt     54300
     agctatcggt cccagatctt cctccacaga cgattatcgg attgctagta tatctgattg     54360
     agctaccgag caaaagaaag tcgagggaat tgtcgggtga ttggactcac cggaaatatc     54420
     ctagatatga tccacaaccc tcctgtgagg agaagagcca acccggccca aagaaggtac     54480
     cacttccgac ctggatgggt ctcgagcaaa ttcacgttca taccaaagag actctgcatg     54540
     ggttcattag taagccccta aagtatggga gcccacgctt tggtcttacg aatttgggac     54600
     atacagatac aaatgtgagg gaaggaaaaa gaagtagaga gaaacgagtc agcactatgt     54660
     atcatacaac tagcttgagt agcgttcaat actgtgatcc acgtgagacg tctaatactc     54720
     gcagcctcgt ttctagagat ccaagcaaac ccctgtcggt ttcggtttaa tatagaggag     54780
     aaagacttgg tcctacgttc gccagctcac aagttggagg agtcctcgtc ctgattgttc     54840
     cgtcccgtcc agagtttgag taacaaactt ttcaatactg tcaatgagat gcgtgggtct     54900
     ctcaatatcc cctggtcctc gcacaccatt ctcaatgtct tcatatgaaa tctcaagcag     54960
     tttcgaagat gagctcgtgc gcgtgcattg ttggcaagac tgtggataaa atgcatgtcc     55020
     tttccgcctt ggtttacttc gttctctagc taaaaccgcg caaagtcagc aacggtccag     55080
     atgatgccta gagatacctg gcattttgcg aagttatcta tatcctggta ccgtgtctgt     55140
     atgactgaca ttcttgtcga ctcttgtgga ctctgctgtc ttgtcacaat tttcttgttg     55200
     cctactggac cctcagtaca attgcacctc tttcagaggt tccaatagtg cccaatctcc     55260
     gaacgtatcg ctcactgtta cacaaacaca aacatggatc gcttcgcaat ttacccggtc     55320
     aggtacatta tcttactcat atcccgtcgt cggaaaaatc taaaaggtag catcttggga     55380
     aagcacatga agaatgtcgt ctttttctgc tcaatccaat ctaatgtctt gcgtactgtt     55440
     tgtaacaaac tcgcagtgcg gtacactgta tttgaagacc agtatggcgt ttcgagactc     55500
     tgaggcagag gatgggttat atagcctggt gactggtctt cccgcctgct gtccagaagt     55560
     cgatacggga acgtgtaata tcggccaggc tgcaagttgc atcacttatt ccttggtcga     55620
     cccacacgac ctgcctctcg gattttgaaa ttgattacca cggcgtggga ttggatgcaa     55680
     gggtattatt tcttaggcgt ctcgtatgtc atagataacg ccacaaggaa aaccaatgtc     55740
     ccaaatatcc atgcaaactt tcacggtaca actttggata agatgtgatc tttggggctg     55800
     gggctgcccc caatcggcgg cgatgacttg gcgcctgcca agcgccttct taatcactta     55860
     cgcgcgcgcc aaaccagact tccgtatccc cctatgccgt cgcggaactg gttaatatca     55920
     cacgaggacg gaaagggtat gatcgaaggc aattcacagt tctgatggtt gtatcagtag     55980
     gcgtccgtga gaggctaact caagaggaag gagtcgagta tgatgtaact tttgcctcgg     56040
     ttgccaagcc aatgagttac aaagccctgt tcccaatcgg agcagacctg gacctagaaa     56100
     tcgagcaaat ggatgtgaaa acagcattcc tgtacggcga cacagacgcg agatctactt     56160
     cgaccagtct caccacataa cggacagaac atcaaagctc tgcaaagttc gaaaggcatt     56220
     ctgtggcttg aagcaagctc ctcgcgtctg gtaccaaacg ctcaccaatt tcctacggaa     56280
     tcttggcttc gaaccaatca gcacttacct tggcatttta gtcgggagca atatgcacat     56340
     tacagtgtac gttgatgatc tcctgattgt ggggccaagc ggtgcagata taaagaagat     56400
     caatattctt agcagaatct ttactttcaa tttatcggcc ttggtctata tctagtgcct     56460
     tctctttcta gggcatgtgc ttccataccg cccgcaacat tttctcggcc ggccatgtcg     56520
     accgctgact gaccatctga ccccactgca ggctacacgg atgcaatata tgctgccagg     56580
     ttgccctacc cctctggggg agtttcagag ccttcggtcg tttcgaaaat gccaggccgc     56640
     tctggatccg cccagatttc cccttcactg gaaaggtgag acacggtgat gctaagggaa     56700
     tgtagattga ccataacagc attccgcacc ctgcgggagc acttcattcg agaatcagga     56760
     acactatgtg acgcatattg gtctattttc cggaacacgt cgcgtgtgaa gacgcgctta     56820
     gcttctttcg ttatacctct accaacgtta ctcaattgct agagctgatg ggagataagg     56880
     ggacaggcga ctgcgattgg atgaagttcc tgctgtttac cggacacgag ggaattgagg     56940
     agtgatggag agagctacag ggaacttcat tctcaattga gatgcagact gtcctccgaa     57000
     ttacagccga gcgggaattc tgtgtgggga ctgccgtcca atccaaaaac tgggtcctct     57060
     ctattcgcaa tgtacgcaca ttccagtgac gccgagataa caggattggg cctttgtcgg     57120
     gaagatcagc tttcttccgc gacgaatggc atcaaaggtc aaaacgtagc ctgttttcat     57180
     gtgaagaccc agaaaccgaa cgcgacctct atgtgttagt gcctgtcttt tcataccttg     57240
     gtcttctatg gtctatggtc atgcaaaaat ggaagcgaag gaacacatcg agcagctatg     57300
     tcgccaaaag ggagttggca actccgactt cgactctgtt gcccaatccc tggataatgc     57360
     gttagccatg ttggtattta ttctgtgagg tagactaaag gatctaacat tcgtcaattc     57420
     taccagttta gccggtggtc tttacaccaa acctactcac tttcttctcg agctaatcca     57480
     aaacgccgac gacaacaact acgcaacaag caccccaaca atcaactttc atatcgagag     57540
     cgacattctc ctaattagct gcaacgaagt tggattttcc tcaaaggacg tcgatgcgat     57600
     atgcaacgtc ggacaaagta cgaaaagcgc atccagaaag gctgctggat acatagggga     57660
     gaaaggaatt ggtttcaaat cgggcttcaa gctcgcagac accatacgaa tatcatcagg     57720
     agcctactct ttcaagtttg tgaaaagtgg tcagcttggt atgatcacgc caatctggga     57780
     agacttccca agcgattact tgcaagcagg gttgacacag tttttgtttg agatatcttg     57840
     cccacgcaat gtccaaagcg tgaaaaccga cctctgcagc ctccagcctt cgatcctgat     57900
     cttcctccgc cgtttacgtc gaatcaattt agaaggggaa tcactgtata aggagataca     57960
     gtcaattcaa tatgtatttg ccgatttggc gggtgcagct gtcaaaattc gcggtatttc     58020
     cgtagatggg atcatatcgg aagattactt cgtgcaacga cacaaggttg gggctttgcc     58080
     gggtgacccc aagaggcctg aggtcagtga aagcgaagtt gcagttgcct ttccgttgac     58140
     ggactgtaat ctcccgttgg tccaggattg ctatacctat aactttcttc ctatccgacg     58200
     atatggcttc tcggtcagtt tacagacagg aaggacgacg caaaaagact gattgaattt     58260
     ttttttccag tttctcatcc aggccgattt tcttctgaca gcaaatcgcg aggacgtcga     58320
     tgagaggcca ctctggaacc tcagtttgct tgatgggatt gtgcaagcgt tcgctctggc     58380
     cgtccatcgt ttcaacaaga ctattctgaa gtacagctgg ccttcttatc tgcaatgtct     58440
     ctcttcttcc atgggaagct cattattcga ctctctccgc aagaagatgg ttgcaagact     58500
     caaaagtgaa cgtatactgg agagtaaaag cagctcattt cgaacacccg ctgaggtgtg     58560
     gtatttggga cctccttacc tagatgatga cggcgagtac ctgttaagaa gcgaggaacg     58620
     acaagatcag cttctatcga gtcaatacaa gatccatgaa ttatccatct tggatgtgcg     58680
     gtattttacc ttccagtcgt tcttgaaaga cttgaaaaat ttcgcttgca acggaaatca     58740
     acgatttaga aaaatgtcta acatgtggca ttccaagttg gccaatgttc ttgagaaggg     58800
     aggggttgat ctccgacgtg aactgagctg ctgccccatt atccctcttc aaggcggcac     58860
     ctgggtcact cctttcactg atcaaatctt tttcgcaagt acggacgcgg gcgtctttgt     58920
     gccaggtggc atagacatct tgttggttga ccaggctgct gctcaagatc atcataggcg     58980
     gcaattgtat cagaggttag gcgtcaagac tctagacctt aacggggttt gcgagaggat     59040
     tcttgaaaca cacaaaaagc catcgtcgtg gcgctgctcc acagatgatc tcgtttccca     59100
     cgcatcctat atgttccgtg caagagacat gttccaaatg gacctctcag ctcatttctg     59160
     gctggtcgat ctaaacggca aatgcgcaag aggtaaagat ttatacatgg agctcccgaa     59220
     caaagttcgg gtaagtgagt tcgcaatgct tggtgaaacg tcaatctcgt tgattcatcc     59280
     tctctatttg cgacaacatc ccaatctggc tgaggattgg attagatggc tgcaaaatgc     59340
     cttgcaggtt gcttgccttc cacgattatt acatgacggc tcttatacca gcgtgactcc     59400
     tgaattttac tctcttatga agcgttcgcc cgcccaatgt ctgctacttc tcagagataa     59460
     ttgggatcat tattttcccc ctgaatacca cagaaagagg gaacgtcagg gcgcggctcg     59520
     tgcaatacag ctcaacctac agacacgctg ctctaatggc aattttactg ccataggtca     59580
     atcattccta ccaagagctc atatgaccca acatgatgga tgccgaacca ttctgccgtt     59640
     tctcgacgtt tcagatcctg acaatattct gtggctacaa ttatccctgt ttggcgttgc     59700
     aaccgacctg aacctagaat tctaccttca atacttgatg ggcatccagg gccgatctct     59760
     cacggcgaca aacgcacatg aaatctacaa gcagatgacc cagatgacta aacggctacc     59820
     aaaggacagt gcaacgctta ggtaaattct taaaaacttg agagcgacac ccaaacctga     59880
     cttttgatag tgattgcaag gcacggttct caaaatggcc attaatcttc gtggctcggc     59940
     caagcccgcg ctggctgaaa gtaaaggatt gcttctggaa ggcacctaat tgcttgtgat     60000
     ctgctacttc catttcagat cgctatcctg attgtgctct actgttcaaa aacactcttt     60060
     gtctgcgaga tgctaccgcg gtggatatag tcagtgaact gactgcactt cggccggatg     60120
     agacacagat accgcatatc aaggatcttc tcttttggtt gaatgatcat gtgagccaag     60180
     atcatgatct gagcctcgaa ttgcttgcga aactggagag gagtgctgtg tttccagtat     60240
     atcagtttct gcatgaacag aaggaaacct ggtttgtgac tttcgatgat ggttggttca     60300
     ttgccgatag acctaccctg cgtcgagcct ttgaagccaa agtgccccta cttgactttt     60360
     cactgaatga gatccgccga atgcatcatc tgttcgctaa gcttgagcta cttgaatgca     60420
     ccttgtcatg caaggtggac gagaccactg agcgcgaggg tgactatgct ttcgacgaga     60480
     tatttacaaa taagctactg gaaaagctgc ctttcataga gcggtaagtg ccttgcctat     60540
     tgtagttaat ccatgatgtc ttctaatatg tttccggccg gcccagtcta cttgcagatg     60600
     tgaaagataa cacctcaatg caaaagctca agaacctcga ggtttttggt gtgaccaagg     60660
     tcacactgaa acgggaactg ggacatatca aaggggagtc tggggatgga gatctcgatg     60720
     tctcggagtc cgatacatgt tttgcatttt acatcaggac ctctgacctt cagtccggtg     60780
     atgtgccata ttcagctctc gccaattgtc tttcaaagat tttgggaatt gatgatgaac     60840
     acaagcgact agtcatggat atcctggtga ctcgaagcca tcgtcgtctt gagacgatct     60900
     tggagcaata tgggttgcac tgtgagctgt cccaagatac cggctcacgt aatgcctcag     60960
     acgcaagcaa cgactattcc atagatgctt catatacggt cccagcaacc aataaagtgt     61020
     caaacaaatg tatcgagggg ataccgggag cacttcttga cgcgagtcag gacgaggaca     61080
     gactaatcgg ccaatcaagg atctcagtaa ctcaagcggc gtgctccttt gatagcgacc     61140
     atgtcaaaat tggacgctct agcatgccgt tttatgctgt ttctggaaaa ggaatagcgt     61200
     atcaccaaac cgggagtgct tctccagcgc tcgaatgccg acttgggccc agtcaacgag     61260
     tttgggatac tgaagaatta ctactggctc tgcctgaacc gggacatggc aaaattaacg     61320
     gaacgtcctc gaagccaccc cgacgttctc gtagtgattt gactgcggga gcgcacaggc     61380
     atccaagaag tgaggcaatt tgggaagaag accaagagac tggatattta ggagagcttt     61440
     ttgtgtgtct caatgcagtc aactggtcag gatgaagaag gctaatcaaa tgcagactta     61500
     caacttcctc cgctcaaaac ttcccactag ttttgctgtc aactgctgga ccagtaagat     61560
     gagggaaaga agcggtcttc cagcctttac gggtttggaa tcttcatatt ctgactttac     61620
     cttgcacgat acagcaaagg agttcttgga gtttcttcgt ggacgaggtt tatacattga     61680
     tcgctgggct gataacacta caacttatca cattgaggtg aaatctacaa ccggggctta     61740
     taatgagcct ttctacatga gctacaatca acaaaatctg gtaagcagcc tacaaattct     61800
     tggaagcagg atataactca ttgtgaaagt gtcgttcttg gagccttgat aggagagaag     61860
     ggattgcatc cgacatctat ttagtctttc gcgttttcaa cctcggagag agtcctgggc     61920
     ttcagataca tctagatcct tggaatttgt ttctggaaag gaaattggat tttaagccac     61980
     agggatcgtt catagtggaa ttaatggatg atgcaggttg tggggaaggc actgggcaaa     62040
     gggaaactcc agaagttatt catgtccagc aaatgctgta actccagttg gggcgagcct     62100
     ggttattttt tgcacacaag aatgaaatag gaggcatggc gattattgtt ggtgcttttt     62160
     tgatcttgtt gtttaccagt ccgcgttgag aagcatgtga ctatttcagt cagacaatca     62220
     ccagatcgcg ttcagcagaa gtggtgttct tacgatgatg ggtctaaaaa tcttcaatcg     62280
     aacgctagtc gcgtcaaaaa cagaaaaggc atatttgcag catcgggcaa gatgtaaggc     62340
     gtcatctatg ttatcaagag actcaaatac ccacacgaca acctcgggag ggagattgag     62400
     aatgcggcac atctcgcgag aatgggaata tattcggagg gtgaagcgta tgggcagggc     62460
     agcaaattct catctgttga aaagatctgc gtatgacaaa taaccgcggc tccaagaacg     62520
     gcccccaaaa aaacagcgac cagtctagcc aggaatgcca tttccgaggt tctattggtg     62580
     accaacatgg gcgcggttcg ttgcacagca gagtactagt tcggggctag taaagatagt     62640
     ttgcttgact agaaatattg gagagacatc tggttggctg gcgtggggtc gggacagttt     62700
     ccggtttccc cggcggaagc gatcaacaac ggcgcgaaga ggtcgtctag gataggctga     62760
     atttcacgcc gggcttggcc tgttatcagc attgcaccta caactgtttc tgacgggacg     62820
     tatttggact caaagcaatg aagatgaggt ctatggaatc ggaatcatcg gactagatag     62880
     tagtgcgacc gaaggaagaa tctgcatcac ctataaattg atcctgccaa cgaggcattc     62940
     atttgacggc tcgcttgaaa ttgaaaacaa aagaaaagaa aggaatacag tcgcaacaac     63000
     ttttagtata ttttatcaga gctgttctaa gaagttgacc tgacagttca aacccaccac     63060
     tgtcatcatt tagttcatgt cgttaatcct cgactagctc ttggataatt gaggtgtgca     63120
     aaacgggtgc ataaaacaag gtatgaccat taatgatcgg cctggcatat gtagatctga     63180
     gaaattagta cagaatgatt gattgggaga atcccaaatg accatgtttt ggttttgttg     63240
     acagcagcta tagtttcagt gtctttgacg ttggctttca ggtataatag ctgtaattac     63300
     gagtgagatt gatctgagtc aagcgggatt gttcgtatac tcatttcagt aaagaccacg     63360
     ataatgaata atgactgttt ggtgcccttc ttgttaaaag tctcgggaat atataacctg     63420
     ctttgcatgc ggtgtaattt cccttgcact gcgtcgccgc ttgtagtatt tcttgtatat     63480
     tttttctatg ttgccaatat aggacagggc aacccgaaat aggcaattcc ttactcttct     63540
     cttgcgacgt ccgtcagccc tgccaaattg gcactgtagg ggtagttcca gtcatcgagt     63600
     aggctaatca gccgttcccg agatgattcc agtgcctgct caaaaaagcg cagtcgagct     63660
     agctgcttgt cgtggcaaag ctgaagtccg tctctctctt ttctcaggtg cataccagcc     63720
     tccttcaagt tctgattgct ctgctctagc ttctggccat cgaaatgctt ggacacacac     63780
     gactcccata gacgtcgata cagtccaaca agtcgagctg ttggaaatgc aaacttggga     63840
     tcgtcgcgtt cgaggtctgc tagcaccttc aaggtgggtt gaaacggctc ggtcgccaag     63900
     gtatgtcttg tttcttcttc gtgttgcgaa ggggaggtct acgatggtca gccaagcatt     63960
     tgaagccgaa tggtttcact taccaaagga gggacatgat cagaaggttc cacattattg     64020
     tccttattac taaggtttgg taattcacag ggccgctgtt ctcctttttc ctggtctggc     64080
     gagctgttcg aggcatccat tttgtccgca ggagaaagcc aaggcctggg cggtactagt     64140
     tccatcaggc ctaggtgtaa tcttatagac tatgcagacg caggtggcta tggactgggt     64200
     tttacggtca ccacatagtc aatcaacgca gtcagcttct gaatagaatt tgcttttatt     64260
     ttcagcgggc gcttggtagt aaatttgaga ggaggaatgt caacggtttg gccgggaaaa     64320
     ctgatcaagc ctgacgatgt tgagggccag atatggacgc ccattggcgt gagagatatc     64380
     tcaactagac gcctcttcca ctttcgttgg aagcctcaga aacccggcaa acagcattgt     64440
     agaacttaga gtcgccaaaa aaaaggtagt tcggatatta atgaaaagaa aaaataaata     64500
     aataaataaa ataaacccaa tttttcttcg aaggttggtg gtcatcaccc caaatttgag     64560
     cgttgacaac gggtcatcct accgtgacct cgctttctgc agtctaggcg gacagaccca     64620
     cagctcaaca caaaccaaca caacactaaa gcgaggcccg aaacaaaggt ccatgattcc     64680
     tagggatgga attgtaggag cttttcggtg atccaacgtt gagtcgccaa catatgaggt     64740
     gactaggaca agaaatatct gcctatcatt gcggattgaa tatctcccac aaagcctcaa     64800
     tttaagaggg acgtgaagga ttcaacagtc agccaacatt gcttgaccaa ctcagcatcc     64860
     ctttctctca gcaccactct tactcgtctc tcgctgggca tctaaaggca tcaagaatgt     64920
     cgctgcaaat agttgcggta aaagaagacg cgggtttcaa caggcctcga ttaaggaatg     64980
     tgtccttcaa cacttccaac caggtcggtg agtgacagaa gccgaaaggc ctataaatac     65040
     gtcctctacc cctgcaattg ctctactatt tactcacttg attctgtaaa gtcgagcagg     65100
     cttgttgtgt ctgacgcact cgataagttc ccccctttga tcgagtactg gaatttatac     65160
     cgtactgaca tttatagtat acatcgtgga ccagcaaacc agacagttcc tgtactgtaa     65220
     gagacgtggt tccaagcaga ttcactgccc catttacgcc agccgatcgg agatacgaga     65280
     tttggattag ctggtcaagg tgtctatgcg gagaggtctc tgctatagcg agctggtcta     65340
     ctgtcgcggc tctggttgac cacagatttg aagtgcaact gctcacactg taggtatatg     65400
     ggcccacaaa tccttgaaac tgcactgacc cgaaagacgc gggacagcca gatccgttcg     65460
     aacacaatgc accagagcaa gggccacagc ttcttgtggt ctcttcatcc ctggtcttga     65520
     ccatcagaaa atgtgagtta tggaattcca cgctggtcta ctggctaata atggacagtg     65580
     aacctttggg agctcaccag agtggccctg ataaccctgc actactgtca gtgcaaagcc     65640
     atggcttaca cactattcct agccccgtcg cttcgaacaa tgcagcatgt cctaggtgga     65700
     agatcgcaaa ccaagatagc gagtcaaaaa cagggtgcgg ccatccacgt gcgaacttcg     65760
     ttgcatagaa ccttgagact cccatttcca tgctaaggtg agtgagatct aacgcctaca     65820
     gctgcgctgt gtctgaatat ccgcgccaag ccttattcct ctaaccacga acaccactga     65880
     catcttcaca ctattgtagg ggcacccctc atcgacggtg aaatatactg tggcgagtgg     65940
     cctaattccg ccagatcgag gataagacca aggtggcggc cgacgagcgt gctccatcgc     66000
     gtcttccgcc ctcgtcccca ccgccttcgc actattgtgg agttcctgaa cctctggcat     66060
     cgcgccacat tcaaccacgg aagtgcaata tttatcgcaa gcgggttcgt cacgcgcgtt     66120
     tactgtctca acaaattgtc ttgtgcaccc cagcgcggct tttttttttt tgaagcgagt     66180
     gcagattgcg atgagcttga atgcgacgtg gcatggctgg tgactgcatt gcagagagtt     66240
     gtaagtgatc tagttgtgaa gccgatatga tcattgtgca aactgatcgt cacgtctcaa     66300
     gcgcactttg ggattcccat gaacaggtgc gctacgacag ctcgtccaag attaatcctt     66360
     gctgactcgg attgtacaac aggagaacac cctcgtttct gtcactcgag tcgaatgcca     66420
     cgcgaacaaa tctcttgttc gctcgagctc ccctatacaa atacgattac atgctctctg     66480
     tcccttccac atgaatacta tcgacgatga gtcacagaag gttcgtatcg cgcacctcgg     66540
     cctctttctc cctattgatt ctgcatatcg ggtcattctt cgatttgtct acatgataca     66600
     actcctgaac tccgatcagc ctataccacc acccgaatca tacctgtggc taagcacgca     66660
     acctttcaaa tatcttcaag tggcgtaggc tgctggtgtc gaatgcgtga tcctcgttgt     66720
     cttcggatga catttggtgg cttcccaggc ctggaaatcc aaaagacaca ggaaatgatg     66780
     atgccaatca ggctattagc accagaccac ctgcaaggag aaggagacgc aaagtcttct     66840
     cattcttagc ctacaattta acattggtca tctcaggtac aaaccgaggg ggtaagaccg     66900
     gggcacgggc gagccaatga gagctcactg cccaagaatc acctcgggca tacaggaagc     66960
     tgcatcatga gggctgtcaa aagtgttgtg gtgtacccgg ttggttctta tgcacgcatt     67020
     ttccatgcaa gccgaagcac tatgtgcaaa gaccatttac cctggatgtc gctgcagctg     67080
     caagttagtc aagttgaccg cgtatccttc atccgttcat atcgtctcct aacatatcac     67140
     gcacttgtca ggcaagctgg attctctaca tcccctacct cgactgtttt ttgaagataa     67200
     attatatatt cgtcgagctg accgcgctgc ggaggatgcg tgggcatgtc actgttcgaa     67260
     caggcagcca ctttgaaaat tttggtgggc tagcccctag gtcccagagc aaaatttcca     67320
     ccatcaatca acgctcatgt gatggttgct tttggaagga tggccgaagt gtctactatg     67380
     actacgagcg aactagcact cctgcgggga tatcacccaa cggaaattcg tttcagatgg     67440
     cactgctaga acccaatcgg gcttcaatcg ggtttcaacc gtgttctctt atctgtagaa     67500
     cgtggttgat tgcattaact tgggacacca cttcccaaaa ggcaattgcc gtcacttcga     67560
     tccgggagat tggttgaaat atgatccgtc attgccgagg catagtagga gccgaccggg     67620
     tattcttgat tgcttgcttg tccagctccc agcaaaacta cattggtcct tgcgctctct     67680
     gggatataag agctgaaata gagtaaggtc gagtgactta aatcgccgcc tgaagtgacc     67740
     actttgactt cgcaagtcgc aaagaataga gagggtgtgc taagggtgcg tgggtgtgcg     67800
     gcatggggcg agaatcctct gggccagcac attggccgct taggccgctt tgcgaggcga     67860
     tggtgatgtg tcattggata tgaccgcagg cactgaaaca attatctctc ggcaccttgc     67920
     acatctacgc gagagctctg ctgattggtt actttcatgg ttcgggcgcc gggactcttc     67980
     tttggaccta gaatcatggg ccccagttta ggtaaggcag aagctggagg cctaatagag     68040
     ctaagccgct gctagttctc ccagctgcga ttnnnnnnnn nnnnnnnnnn nnnnnnnnnn     68100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     68160
     nnnnnnnnnn nnagccatgt gactttctct cacgctccga agaagaacag cgagtgcaga     68220
     cactccagca aggcgttacc aatcgactac ggccgggtgc gggaaagcgt tgtcggccac     68280
     aaactcctcc ggagcagcta agttcggaag tggaaggatc agtcgagaag aaaagagaca     68340
     attaacgtgg gcgttgcagt agtgattttc gtccaaaatc ttcgccgtga gtacgtgaaa     68400
     cggcttatcg agaattaacc ttgtttgtcc gaagaatttc atattttctg tgcggagctt     68460
     atatgttcaa tctgcgtgcg tcatggccta tacaatcaat gttcagcttt ccttgctgcg     68520
     gcgttttata ttcctcattt cagcggcaga tcgctttctc ctttatcaac ccgcaatttg     68580
     caatttcttc cagcccagag cgcagcatga tttccacgct cttcgccgag tataaagaat     68640
     tgctctacct tactatatga cattgagttc caacgtatga ggtatgcgat cacttttata     68700
     cagcaccttt ttagacaatt aatagttcaa caacagctgc aggtttgctg gccgttgacc     68760
     cttatgcttt cacagctagg ggtcttgtac tactcttcga cgaatattag ccttacatgc     68820
     tgtgtttcaa tcttccgata gttttatatc acatacctgg cccaccaatt tataaaactg     68880
     catccgttcg gcacgtaaaa tggatccact ttaacatctt cactcataat agattctatt     68940
     tcaaacaacc tttaggtact gtcctcctgg caacattggc cgtgtgaaca attcaacgat     69000
     tttctagctc cgcagtaatt gggctaagtg aagcataatc tggcgttggt ggacagcctt     69060
     ggccgtattc tctccttcca aaaacaggag gctgggtcta tccgttgcta agtatgcata     69120
     cattgggtaa aatctcggac ttcccatttc ccgcaccgcc tggtggtaag gaacatgaaa     69180
     aaaagtgcgg actcgctgtc tttgcggtga tatactctcc accacagcag tcattgtagg     69240
     attggcggtc ctgaagaccg ctcagtcgcg tctaatttaa agcccttgca ttcttggggg     69300
     catatggttt attggcagcc ccaatctcca cttaatccca ctggtcncca cctgtaaggt     69360
     tgagcgacgt cactgccctg gctcaataca caacaacgta ctgctagtat ttcaatgtgt     69420
     tttggagatg gtcaaaaagc cgtaagcgta tctcttactc tcgctgagag tgccactaga     69480
     ccgaagtagg cagcaccgtg tctgttatcc ctcagtcacc gccatttccc gccattattc     69540
     tacccgcacc aaaaaatcct agtaattctc gaaatagcta atacncaagt gtaatagcct     69600
     cccccttacg tggcataccc tctggtatac cttctcagac gctaatgtcg agttgttacg     69660
     aggcctcctt tgcattaacc nactaactgg ttaacaaagt actcggtagt tgtagttgtc     69720
     gcttactgac aggcacactt ctaccatatt tttgtgaggg ccaagggggt agttgangga     69780
     ttgctgtcac ggctaccgtt gattttcagt taatcgataa cagtttccac tacattaata     69840
     aaatcaaatg gactggagga agaaggaaac cgcttgattg tgagctcaag gaagttagag     69900
     cgaaaatggg gtcactcctg cgggaaccaa cggcgtgttg aagaaatatc cacaaatcga     69960
     tacaatgact tttcagggag tgattggcag cgagctaggg aatcgcgcac gaagtaccgc     70020
     ttanaacaaa gatgggtgag taacactaga ccactcggac cactctgaca ataggcagca     70080
     aagatgttca aagaagtcct cctccccctc gacgcgataa atcctctagg gaattcggca     70140
     aatgttcaag ctctttctga agcgcatctg ggtcgccaca cttccgtgcc gagtcaaaat     70200
     cgattaaaac agcttgtgaa ccacgaataa gaaagttgaa tcggtttgta tctccatggt     70260
     ggatccccag gcaatgtagg cgagacaatg ccttccggca ggactcaang tcctgtgggc     70320
     cagcatgcct ggcatccttg atgcgttcca tcaagaatcc gatcacacgn ccatcttctg     70380
     tcaaatggcc aaggaatcgt ggnccgatgt catagccctc aatccattga taagccgtgg     70440
     tctcactctc taggtattgg atctcccagt cgaagcgagc gaacttaacc acaaccacgt     70500
     cgtcaaacag attgcatttg gcttcataaa tgcccgttcg taacttgttt ccgaccacga     70560
     tttccgtata atcaacagaa gntttgttcc agacattctt cacgccagga aaagcggtcc     70620
     gtatagcata ggcaaagtgg ggttggccat tcgtttcatt tttggccacc agtccatcat     70680
     tccaatctcc agcgggtaga gcgggtagta gtgaaaccag tgaagggccg aaacacatat     70740
     cgtcagcact atagagacca gggtttatag tgacatattt tattctctga ccgttgacca     70800
     ggaggcgaaa gaagctctga taattttcgg cgacctctgc ttgaagcaat tcgatatttg     70860
     ttgaactgcg cgtcatattg tcgagcaagc ntttgaaaga gaaaggagtt ataaatctga     70920
     cggggtaatc gttgccgaat tgctcttgga cgactattta tatttcaatg tcatggatta     70980
     aatgaacgga agaagccagg agaacactcc ctggctaacc cctggccgat ccctggcgct     71040
     aaaaaatact actgnccgtt caacgccctg gctgaacctt attggttgac atcgcatcct     71100
     acttgagtag tgcacgctaa agccacgtct agttgaaacg aaattgattt gatttcaaga     71160
     tttctctgtg cgaacctcaa aaatnccctt attagagttc gaaaatgact cgaattgaag     71220
     aaacctgagc tgccaacagc gctgaggcgt atggccggtc actcgaccag cgcttatgga     71280
     aaggatttga ttggctccgg atgcaacaga atattttagc cagataccca agggtgccac     71340
     atctcgatcc gttcactttg ctttagaagc agtgactagg agaggggttg ggaaggaaag     71400
     catatataaa ccctcagccc atttccgccc aacaaaataa aatctactac ctgttttgtt     71460
     cataccaacc ttcatcagaa tatctccgaa ccagggtgag tctgaagaga tcatgtgcga     71520
     tttncaaaaa gacctactct aaatcgctct aaaccgctct agggtcaaaa aatattcaga     71580
     tatcgatatc aagcccggaa aacgccgccc agatcttcgc aaggtatata atatgccggc     71640
     cttccttttc tcgtntccgt nagttgagac tgatcttatc aagatgtgta cccaattcta     71700
     ccgaatgtac acgtgtgggt gtaggagaaa cgaagagttc agacaatgcg aggatcgcct     71760
     tggcacgaac gtcaagtgtt ctcctctgaa atgggaacca ttggatcctt ccctccatat     71820
     gtgcacgcag cacatggtga agcctggcaa ggacgaaatg cgcagatagg gganagtttg     71880
     aaaatcgtca atggatggaa agagctatcg aggtanacaa aactagcaaa tttcaaagcg     71940
     tttgtcaggc tctgcagctc ctgcgatggt aatcgtcaag ttatgtaact ctgaaaccaa     72000
     cattccattt tcttcagttc actcaggcct gtgcttgccg ccaatgatct ctccacactc     72060
     tctaatatga tctcggtagc tctccttcgt atattttcgg cgccagtgta gtggacggcc     72120
     gtaatgatgt ggtttgcaag caatncaatg aaacccccat tgcggatctg ccatacgagc     72180
     atcaagaact ggcgctcgaa taattcccat aaaacgcagc ggattagatg aaaatccatc     72240
     aaacgagtct ncagaccttg gcagtcgcgg tttcgctcca gtagatgtcg aatttcgaga     72300
     tttgtgtatt tcgagattct tggtaagact ctctgatacg tattgcttca ttgaattgct     72360
     ntccccgtgc acaacgattc ctgcctcacg tgcagcagaa tgatcaatca aagtaattcg     72420
     acggcgacat tgaattcctc gagatgaata gcgacnagga acacttttga aagaagggag     72480
     ttttgctaga tatttgnngc gaagnccaaa tttccggatc acgtcgcttc gtaggagtgg     72540
     caggtagtcg gtcttctcgg taaaacagag aaaacaaacg cgacgacatg tgactaggta     72600
     taggtaacca ccaaagtcac cacagctgtc acaattagtt gtacgcagct tatcgtatag     72660
     atcttgacat gaaaaagaaa atccagttct gatgctgaga caacctcgaa tcgaggctgg     72720
     cgcgtgcaca atgatttgtt tgtattgtgg gacctgatct acgaccagcc ctgctcgtct     72780
     gttgacgcgt cggaaatgag ttattgactg aatatcaagc cgtagaatga tcatttgaag     72840
     gacttctaga ggcacaattt ccaacgatcc aagtccgtaa cacggaacgc gtcgatcatg     72900
     gccgttatct agacgacaga gacttttnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     72960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     73020
     nnnnnnnaac gaccccaccg tttgaaccat cacccacttc actgaaagca atcatactca     73080
     taatctatgg tcgcacacac cgtggagccg atgtatttag tagcctccaa ctggcttatc     73140
     atacggcagg ttctaccaaa tgccatctcg ataccacgca atgtgttgtc gagcccatgg     73200
     tctgcgagga atatcgacag ctttcgattg gcctgataat gctttttctt ctcaatgccc     73260
     aagtgcacga ctgctaccgc aaccgggata tcacacaagg tatagagcga cgagctgata     73320
     tctacaagtc tactggaaga ccacacctac caatacgtgt caaaggatcc cctaccacgc     73380
     agatgacttt cacaatcctg aatttacaac ttttggaaat atcagacaaa atctgcgtga     73440
     gcgcagagcg tggtttgatg tcagaatgga gcctcgctga gcttgaggct gagttattcc     73500
     gcatagagaa actgtgcagc gagatttaca ccaaggtcag tgaatctgac tcgcagcttg     73560
     gatctcaccc agggatccag ggcatactgc actgctatat caactatctg cttcatcttc     73620
     tcttcctgcc tgatctccag cgatacctaa atggggacat cgcacctggg acaagaatat     73680
     ctcagttgaa gtgcattgcc tttgcaaagg cctcattaca gtgtttcaat cttttggctg     73740
     aggacatgca gtccaaatcc tatggatggt atattcgagg tctcggaagt tactatgctg     73800
     agcagtcagc atataccctc agcagaagtc gtgcagcgct acaggaaaat gaccaatacc     73860
     aagaggtcag gtctatactg aaacgtacgt tggaaatatt ttctgcatcc tcggaccgca     73920
     gcatattctc tacaagagga gcgtttgtta ttgaaaatca atgtatgtct cggtcatcca     73980
     aagttatttc tcgagcatgc atatctaact tcacttcagg attccatgcg gaacacttgg     74040
     gacgagggga cggtacttga tctagttgaa attacgggtg aatgggcctt tttgagtttg     74100
     tccaagttga aatattcaat atcttagtgt aatatagaag acccatttat tgctttcttt     74160
     ataaaccact tagtatttcg cttgcttccg aagccatcaa ccttcgaact ggtaaagcct     74220
     atccttgaaa cttctgtatc gcaaacttgt gtatcgcttt gtatagaacg tccggagtcg     74280
     catgcattga tgtagaatgg aacggtttcg taatgggccc aatgggtgga tcctccaatg     74340
     gtcgtagccg aaaagctgcg agctaaaatt tcgagctgac cgtcttttta ggcctgcatc     74400
     actcaatatt tacgttttag ttcgatagta cccgaagaat gtggtattcc cccatgcgta     74460
     gttgcggtcc catcttccca tggaaggcta gtgcggccca cgccatagac tggctgctga     74520
     gtcgcggcag tataaaaggc cacatttccc caacatttaa aggtgatata ggcaaaaccc     74580
     atctcctttc cttacagtga gagcaaggcc tacacctgct gccaaattgg aactaggctt     74640
     catttggtta gtctctattt ctccgcaata tgacatccac ccaagacatg tcgttcgatc     74700
     acaccatccc atactcggcc atggaggtta tgggttacag caaactccaa gccagctcgc     74760
     cgcctgagag tatggtcaga gaagtggaaa gatctctccg gtcgcggcca aacgaagtgt     74820
     cagagactgt cacgtatgga agaggggatc atgatgcatg cgaaagcttc ttgagattcg     74880
     gaatccagga tcatgacgta tgtctttcaa tacagtggtc gatatataga actgaaatta     74940
     tggaagttca ccaggaagat cgaagaagtg atcggaaggc ccgcttttct tctccaccaa     75000
     ggcccggtca tcgtccactc tcccgatctc ccaaccaact ggggaatcaa tgccgcccat     75060
     ccggtccgaa acggagtctc agttttccga accctctcag gcgacagagt gaccttgaaa     75120
     ctctatccaa tctcccacca cttgtcgagc accgaattcg cacagggaaa aggaacaccg     75180
     agatctttca atctgacatc gaacgaggta cttttcgtgc gaggtgcact taagatggag     75240
     atttcactgc ctgctggggg attcttggcg tggcaaggat tttccgagga tccatgggga     75300
     atagatccgt cagcccccga agcctttgcc tttatgagga tctagtggga accaccgggt     75360
     tgcttgttga tgctgcacgt gctgaacagc gtatttctgc ggagaaaacc ttaggtagag     75420
     aaatataagc agcttgaccg tattagctta ccgggataaa ttccatggat acattggtag     75480
     ttgagcctca ggcgagctag agattgagcc agatgcgcga cgtatgcaga gttaccgtct     75540
     cgcaacatct ccattgttcg agcttcttca gcctgagaca gagaacggaa ggcggaaagg     75600
     acgggtaaca aaaggagcgt aattccatgt ccaaattcac gttcaaagcg catcagtctg     75660
     cgtccatgtt ggagtgcttt tttggtgttg tgattgtcag gcaatccttc ttcttggata     75720
     aacggagcca tggttccgaa gcgatgggac cctgaacatg gagtaggttc attctgtcca     75780
     gtccgttgta gccagtcttg ctcccacaaa gctaggttgg tccactggtg aacttcttgg     75840
     agtcgctgta tccagcactt ggtgttcttt cccggggcca agagctcggt ggcccgccga     75900
     gttttccctc gtaccaagtc accctctaag atggttgagg ttaaatcggc cttgagaaag     75960
     cgaatgaaca tatccagttg tggtgataaa tctgccagaa gcgtttccgc ggtagctggt     76020
     ggcatgatgg ttgctgggaa tgagcgacga cgcgtgcctg gaatcagttg gctgagagga     76080
     aagctctctg gaaacagtat aggtgagacc gcgccgcagg aatttaacct gagctttagg     76140
     cgctcgggtg gaatttcaat gtcagcacat ctgactagtg cataacccct gggtacaaat     76200
     gacacaatag tgctgcccta tccatacggc gattacagct caaatcttaa ttccatcttg     76260
     gtgttctgtt tgctcatgct ggagcggact ttccatcttt cggccaatct tccggattct     76320
     ccacctgcca tgtatatttt acgattccac taatttttcg gtatctcaaa ggtatggaaa     76380
     ctggatgttc cgttgtgacc tggcgcgtgc tgaaattcgg catagagaac agctgtcttt     76440
     aaagaacgta gtggaacccc ggatatggga agtagctcct cttgatcaat catctaggtt     76500
     gcccgtaggc ccgacatatt atatccacaa cgagactata agatatcggt ctttttgaac     76560
     acctgtactg atgtgaaaaa gtccgcttag agttggccgg atcgccgtat tgaacggata     76620
     ttttaaaagt ttcaccgggt acccggtgtt ttattagcat tctggggtat gaaatctgaa     76680
     ccatacccta gagggaatgt cccgggcttc cgcctgtaac tgcaccgccc cgtcctcagg     76740
     tcccagtact gttccccctg atcttccgcg gatgcaccgt actgacactg tgattgaatt     76800
     ggcctgcagg ggaaagtgct agccattggt tgatagcgta gggactcagg ttggaatcca     76860
     ccgcctcgtg agtatcgagg gccagtggca aatgatggcc aagccgtgct ccacccaccc     76920
     caggtgaatg tgtggtctaa tttaccatac tctgcccata gccttagtac catgcctgat     76980
     ggagcaactc gggtgacatc cacaagcaca ctggaaacgt caccactaaa attgcagcag     77040
     ggcggtgcct atatccacac aggccttttt gctcgattca ctcgggacta tgttctcagg     77100
     gctgatccct aagcaacggt aaattaccgt tttaccaaat gcccacacag ggcctggctc     77160
     tgtgtgtcac gcttgtattc tacctcctgg gatctagagc ctcagagagc actacctctg     77220
     gaaggaccga gaaacttggc acagcaggct gtggtatagc ccgggcttca ccgggtggtt     77280
     gactggtccg actttccttt tcctcgtcta tttaatcgag accctacctc ttccattttc     77340
     cattctatcg atcagattta catccacatt ttatcacaat atacagaagc ggttagtctt     77400
     gtggtacaac ttctcgtctt gctgaaaagc cggggtagca ggaactatct aacatgcttt     77460
     cagaacggag attcacgtcc aatttcccct taagcgtaaa gaacagtcac atctagggcc     77520
     atagcgggtc tgattctgag ccagcttaac gaaaacccga cagccctgcc aaatgacttc     77580
     acgcttgcta ccatcgacat ctcgaaatga gggggttact ggaagtatcg accaaacaaa     77640
     ggccgatata gctactctca gacagcaata cacaaagctt atattgtggg aagaaaagtg     77700
     tatttggttt gacaagaaac aaccgcaatc caaaatccac atacctttcc acagatggca     77760
     agcccttctc gccatacaca agcatttgct tcaagagcat gaacacttct tctccatgtc     77820
     ccagatgcca tctgctagag ctgctatcag agatgttcct tacgactatg ccatgtttaa     77880
     cagaatgtgg cgttatggaa tatattcacc cttagagctt ctgcaccaaa accttccagg     77940
     atctttgggc cccatgctcc atttcattta ccacgtctca tcaacgctga accgattctt     78000
     agagttcgat ccagctcttg gggtgatatt atatgagcag cagggtgatg tgacacgata     78060
     tcatatggcc gcgcaaagac agcatcggaa acatctggca ggcatatcgc gatattggta     78120
     ccgaaaggct gcggaccaaa atcccaatct cgtagaatcc aacattctct tgcagtttgg     78180
     tcacactcct acgctcttca aagactgttc tatcttacca aagcattcgt tagtgtgcag     78240
     ccactctgcc acagctgggc gaccattggc attttcttcg accactggga gggttttacc     78300
     tttcaacgag atatggccgc tcactttgtg attgcacacc gtctcctact cgagaattgc     78360
     tcgggagggc ggcttaaggg atcgacaaat gacttcctgt cgctcttccc aatgcacatt     78420
     caacgcccca gtagccgaaa tcaacatgag gtgtacataa tgtcctgcaa catcgcctct     78480
     gcacttggtt acggtacacc tatataccca caggtggccg atctgttttc caagaagcag     78540
     agtagtggtt ctgcgaatga gtcagcaccg gcaatggaga cagaatatgt acgagacaga     78600
     atatgtacaa tagccctact gaactgtgta gcaatagccc tactgaattg tgttcgcagc     78660
     tcaaactgaa tcaagcattc caggaaatcc gcctcacttt tcaaactctc ttagttcttc     78720
     ttaggtacag taacttcccc aatgcaatcc cagggattca tatctctctg gcgttcctct     78780
     ggcgcgtctc ctttcatcgc tccattatgg aaagcctgga ggccacggtt ccctggcaag     78840
     cagtcgctgg attcctaaat agtttgtttt cgcacaatac tgttttctcg aggatccaag     78900
     acgagaagtt cccaattggc gaatatgaaa cagctccaca gctaccagaa gactttttga     78960
     taccgggtca agtgtggagt caattctatt acccaaacaa cttcttcaaa gatacctcag     79020
     ggtacagcat ttcaatcgat gaaatggatt ctgaggaagt agtgagaaga cacaggtgcc     79080
     tctggctagg agtgcaaata gcaaaggtca gttggcatca cttgggatat gattcatttg     79140
     agggagacgg cacaggtact gacttatcat acagtctggt cgctggataa cgtacagttc     79200
     aacgagaacg aggaggttcg aattagcaca tagtttcgcg gagagatatg gccattgaag     79260
     gacgtgtctg agctagttta ttttatacgc gccaatggaa tgcgagttat gctgcattac     79320
     tttcaatatg gggtcttcgg agggaaatag atcatacttt tagaccatag ttgactttca     79380
     cataaccacg ttatgctttt ttgtgtcgac cactttcgta tacaagtggt gatagagcca     79440
     aacaatgtac tgcagctttt aacgtctttg agatggtaca ccgcaaacaa gaattgaaag     79500
     cttctagaaa atgctgacta gtgtcatact ttctttaggt tgagcggcac ccatatggtg     79560
     catatgggtt cccctgaacg cgaggaagcc tgcctctttt gctttctcgc gctacgtctt     79620
     gtttcaacgg taaactatag tcgctcttag tatttattat ttacctctag acactaccca     79680
     tccttatgca tctgttatac cctcacacaa aacctacgtt tgtccttggg actctttgat     79740
     tcctaggagt gccatcggtg ctcctaggat ctgtaacaaa gcctccagga ccaagatagc     79800
     ttccaggacc cagttgtgta tttccagttc ttttatattg acggaataat catgtggtgc     79860
     tattgcttta aatctggtcc acaacttgag ttcgtaagct atcaacaaag tagtaaacac     79920
     cctccgcccc atctactact tttttaagct ttcacccctg gttcggtcat tcttcaaata     79980
     ttatcatccc gctgcaaaaa catgtattag cgttatgata aacaacacag acccaaaggt     80040
     agcttaacct ttccgtagct gatacagaca gagtttgcct tggtctgcaa tacctcactt     80100
     tggtatactc gaggaagcta ctcttgctgt tgactgacta tattgcccaa ctgttcctta     80160
     aaaatgatgc tcaacctatt ttctgcccct tgttgattct gtgctcgcca tcaggtttac     80220
     ggtgtgtttc caaatcgtga tcctaccatc acgggtcggt gaatcaacgc ggccgattcc     80280
     attgaaaata catcttcgat tttgaccatg atccactaat aaacttatgc aaccaagaga     80340
     gctgagataa atttatttaa tgggggaggg ctcacttgca ctggttttct ttggtttacc     80400
     atgttcaatg ttggtatcta tcaactttgt gataccatta accactcgta gatcgccaag     80460
     acgcgaattc ggcggatatt atcatagaaa gagtgggtga tgcgacggaa ttaaatgttc     80520
     aattcgcact gtcggttctc tttgtttgct agataaaaac acctttggcg gcttctttga     80580
     aataggacca tttccgttct tggccccaac gctttgaagt gtcagaggca aagaacactt     80640
     gaattggagg catattattg gatgttccca gccatcttgg caggggcgtg gtttaattgg     80700
     ccgaaccgcg ctctcagcct gtttgacgga tattgcgacg ctagttatgt ggtcaatgat     80760
     tagaactcgg gatagcacgc ctcatgcagc cagcaatccg tgcaatttga tagctctgcg     80820
     ctaccgatga tgttatgtat aatttagtgc gtcgaagggg ctactactat tcagacgtga     80880
     cccctcgttc ttaataaaag acctgcgcct actaagggtg gtttgctctc tatgccgccg     80940
     aatcttcaaa cgagcaggca tccgtctgtt tggtttgttt gctgtatcaa catccattgg     81000
     ggatggttgg ttaattttca actgtatgaa gatttcacaa attttggctg gcattgaatt     81060
     caaatccaac gaactagccc aatcaggcca agctaactcg acccggagta aagtttgcag     81120
     atcaaatctg aaattgaaac cgatattttg aacccatttc gaaatggcct ggccaatttc     81180
     gaaattacac catccctaac atgggctccc tgctcggatc gcaatgcatt gaggtcgaag     81240
     atgcggtcga tgatggttgt gggcaatgat atattgtgac cggtattgtt tcgagccgtg     81300
     atcagcatct ttattgtagt agatagaccg aattatgttc acttcccgtg gtaatatgaa     81360
     taaataagta aatcgaacag tagatcttgt acgtaattta aaatagttac ataatactcg     81420
     tgcaacaatc caaaactgag taattggcat gattgattaa tccaggaatt tccatctcag     81480
     cgaggacgct tacgtatatc cctgacaagg ccaagtctgg gtcctgggag gcacgacttc     81540
     aatcctggga gcagacttgg aggcatgtcg actcccgata ttctatagct actcggtcta     81600
     ggtataaata tccaagcgca gtcccatccg tgacatgtaa aacccatatg agttccgact     81660
     gttggtgcac cgcaaaagaa atctgcataa tgaccaccaa caaagacagc gtgtcatcca     81720
     ctgcccttgc ctccggtccc ggttacggac accatcgtga gtctactgtg caaaaacgca     81780
     aatatcctta ctaagttggt atagctttgc ttcaccaggg aagagcacgt ttctattgtt     81840
     cacttcgtga gaccaaggag ctggtatcgc tgcttgaaca cgatcgggaa aaccttatct     81900
     gcgaacttga aaggctgcgc aattattcat gggccctgta ccatgcgtat gataaggccg     81960
     tgggggagct ggagcaggga aaaagccagt aatggtctgg gcgctgagga taaagaggcc     82020
     gagagtgaag aggttaccca ttgcgcagta aactagagcc tatttgaggg ccatgaggca     82080
     ctatacatgc aaatcccaaa tcttctctca tgtagaccat catccgtagt ttggagtgag     82140
     gctttcttgg accgcgaatt ctggcagcct tgggtctaga aagattgcgt acaactatct     82200
     gtgctgctgg agctttgagg ccgacaatga cagtggaaag cttagtgaag atgttcctgg     82260
     cctttacttg gccagaagtc gatcttggta acctcattct cattcttaga ggaatctcaa     82320
     ttgatttggc acacttgcgc gttttgcacg ttcgtttatt ctgatcacga tagctaaatg     82380
     gagctccgag gcccaacagg ctttgaagga gctcggtgca atctcccatc gcggcgaaat     82440
     gaatgagaca ttttttgtac gagcctttga ggttgcatat actcctggat ttgattgttt     82500
     cgtacgtatc accaaggtat acattccatc catattcatc ccggctactg aaggcagtaa     82560
     cattcccagg cgaggcggtc aaaaagctaa cctttcgcat agaacggaat aatagtcaga     82620
     agggtcactc agtaaatgaa gctcgttgac agagccaatt ttcgaggcga aaaattcgat     82680
     gacgcacctg ttaattaaga ggcccgcatt tgactggtta ctgaggggaa atctgctcat     82740
     ctgctcaagt gagggtggtg tagagttgct gttgaatccg aacctaggtc agaaatttcc     82800
     actcgaccaa agtgtaaatc atatctgcat gatagtgaat taacccagtg gatctgctgg     82860
     gaatcatgtc tcacagatac tgtctggctt gctgctccca gatgttattc tacaaatgtc     82920
     agtcgagtgg aaaaataagt gctggttcaa acgggaataa cttatcaagc gccttcaggt     82980
     acaaggcctg cgactttgcg cagccgagtg attgagttgt agagcaaatt gctgtgagga     83040
     aaggacttgt ttatagactt cccggctcat cgtgtcacgt atgtgctctg attggtagca     83100
     agcattggat gatacctatc taatggaggc ctgtcgaaaa ttgtcttcgt ttttaccacg     83160
     actattggtg gcaaccttct cgatgccatt ttgcatgcgc acctagaaag agctagggtc     83220
     gtgttgagaa tgtatgacgt tgagtcgctt aagaaacttt ggctggcttg tagaatcctc     83280
     cacagtattt aacttgcggt cttgccgtgg actgggagct atttgatttt gaatggcacg     83340
     ctcaggtttc atgatttgaa catctcatct gctaacggcc caacgttgaa tggccaagga     83400
     gtgtctaaca attcatcagt aaaaatcatg gccactgtct tcccaacctc gctttagtgc     83460
     tggctgcgtt gagctgtggg tctgtcggta attgagtgtt gacaatgtat ggccaagcct     83520
     caacggatta acgggtcgag cacctgtaca tcctaccgtg acctcgcttt ctgcagtcta     83580
     tatggacaga cccacacagc tcaacggaac caacacaaca ctaaagcggg gccaggcaaa     83640
     aagaccacga cttctaggga tgaaattgta gtcgcttttc gatgattcaa cgttgagtcg     83700
     ctcacagacg aggtgaccag gacaagaaat atgggcctgt cattgtggat agaatatctc     83760
     cctcagggcc ccaattaaga gagccgtgaa ggattcaaca gtcagccaac gtttcttgac     83820
     caactcggcg tcccttacac tcttactagt ctctctcgct gagtatctaa aggcaaaagc     83880
     agctgttgct ggaaataatt acggtgaaaa ggagacatca caggttacag gcgcggtaag     83940
     atagaaaata ggacaagcga ctgccaccca ctcgtgatag aacgtggtta gatactcggc     84000
     actgtggtca gcaacagagg aaatagcggt aatgttttcg gagcaagctt agtaagaaat     84060
     taagtcctga tcgtcccaga gtacaacacg gccatttctt ctttgcaagt gctggacacc     84120
     attagacctt agccagaagc tactggctgc tccacttgat ttggaaaatg atttagcgct     84180
     aaaaatgcta gttaagtttc ttcttttacc atgctaaacg gtggcacaag gagacacgga     84240
     tttatctcag tagagccagg acggaggttg ttggcagaaa aacacgactc gcgagctcga     84300
     ggggcgcaat tcgagggccg aaaatgtgac ggaacacggt gaacggcaga tcccgacagc     84360
     caagggatgc agtttattct tggcgcacga aaagacggtc ctataatacg cacggttcct     84420
     gagctcgagc caagaatagg aatggcgtca catctaaacc gtaggtcaaa caggaaaata     84480
     aaaggtcatt cgtagttaca ttcattgttg catgttggtc ggttaccagt tcccaactga     84540
     ttgctagtgc acacttaact tggcatgatg tatgtatggg ccccgtgcat agaaatgcct     84600
     agttatctcg cacctcgcaa gggttggact tgggggaatg tttacttttc caaatcccag     84660
     aacaaatctc cccaagatct ggtcctcttc gaattcttgg ggtgaaacaa catcatttta     84720
     tttattgtgc gataacggcg agctcccatt tctgctatgc ttcatggcca acctggcgtg     84780
     ggtatggctg ctcatgatct cggtgtccca gatggcacaa agtgcaccaa cccgaactgt     84840
     ttggagaacg cctagcggaa acaatgaaga cttcgttact acctattaca tcgggtctac     84900
     gttaaccatt gactggtctg gttgggattc ttctatcctg aaccgtgata tgaacggcac     84960
     gagcaaagcc gatctgtggg tgaatgcatg gaacaccgat ttctccacat ggtccaaaaa     85020
     gatttcgagt atgtgatccc caaacaaaaa ccatgagatg ctagactgac aatattgcgg     85080
     aatagctagc acgatagatg tttcgtactc ggggactttt gtctggaaag tcgccattga     85140
     tgaggaagcg ctatcagata ccaacgagta cgggctcact tttaaaccaa ccggggaaag     85200
     ctttgctccc tctaaccctc gtttatactc cccgggattc tacgtgaagt ccaatgagac     85260
     gacatccaca tctacctcgg cgacctcatt tatcccaatg tcctcaacta ccccgacaag     85320
     tactccaacc tcggagaccg catcatctga tacgggcgca ctttcgactg gcgcgaaagt     85380
     agggaccggc gtcggcgtga gcgtcgccgg actggcggtg ctgtctgtgc ttgcgttcgt     85440
     ccttttccaa cggcgactac ggtcatcacc gcaagagatg gctggaagtc gggatcaagc     85500
     accggacggc agctcctaca tgaagcctca gccagcgccg caggagcttt ttgcgccacc     85560
     gcccgagata gaatcgacga ccaacacccg aagggagatt atgtgatggt atactgttga     85620
     cattacactt tgggagtacc tcatgcctgc ttccccaaca cggatatgta gaacaagtgc     85680
     agcctgtttt gcgaagcgaa tttacctttg attggagttg agggtaacat atagcgaagt     85740
     gattataaga gctgaacaat aacactggtc atacagaccc gagtagggat ggggatagcg     85800
     tgggtgcata cctcgagcct attatttata tccacaactt gcataaacca gtccaccgtt     85860
     aaatgggtcc acagagtgat ctgtcatatc taggcctagt ataggtcaga ttccaccttc     85920
     agctgggaac tgttcggtta cagtgcccga atgatttcta agtaattcta tcgggaaact     85980
     gacaaataat atgtaagcaa aacgatttat ttcgtatatc cagcaccaag gggtccccac     86040
     aaatgactcc cagctttctt cagttcaatg tcacccagcc agtggcctcg tcgacgatgg     86100
     tttcgtgccc tgctagccgg tagtcgtgtt atttcatggc ttgcccttgt agcagtgata     86160
     agtagtatta acattggacg gctgcaatct tgccgtgaac attgtttgat ggtcccacaa     86220
     caagtccaga atcacatcca atggtagttt tactggtgta aaaatggtca tcgtgagatc     86280
     tgatcggact ttcccactcg cagaaagctc aatgcagaat ctgtagattg gccgttctat     86340
     ctaattatct ggaactcttt tccaaaagta gacttctact agagattggg agatcacaaa     86400
     tcgtatttac tgacggagaa ctactcatga agttgcgaca cctcccatat aaggagccga     86460
     tcggatattc ctgagccaaa gctctcaatg acatggtcgt tctcgaggca aagctacgtt     86520
     cattctcttg tgactggcga ctatggaggc ctggcggctc agctattgct caaacccttg     86580
     acattctcct gcggataacg tggatgcctc acataaagcg atatgaataa tctttccgtt     86640
     tcacggtagt gtgtacatgt aggtgttcca cgagatgagc gattgtatgg caaatgtgtt     86700
     ggcggtaaaa cttgaacaac ctctcagacc tgtttctcta ttttgggagt tctgtcagga     86760
     acgcacggcc ataattaata tagttgaagc atgaaaatag ttacattggt gatttcccca     86820
     tctggaccta ctactgtatt gattcgcggt cgttgctggc ctaactagca gcatagtctg     86880
     gtttgcggtt tgcgtccaac tgtcccagca ttacaaggtg attggtcggt catgtgtcaa     86940
     aggaggtcag aggtgcccga taggggattg ggcattatca tgatgccgac atcgcaaaga     87000
     tcatcgcgat tgttatccat attatggcgg ccaatcctcg gccaaaatcg tttcgtgata     87060
     tcgtgctcta ccaccgtgat tccctcatca atcttctgca gtggacttct taccacctta     87120
     atttggtgag atgtagattc gaggatgtcg gaactccccc tgtctgtgca gaatctactc     87180
     aaaacgacca caggaacaat gatggtcgaa agccttaccg gaagtcatca aacgatgctg     87240
     aagtagttgc tatgaaccta ttccctatca taaagcgtcg tcatctcatc aacattttag     87300
     tgagcaagga gcgtcatttt tcctactcta ggtacgagct actgtctgac aggaccgctt     87360
     ccatgggagt tactgacaac actgctgagc agtaaggagc accattttat tttcaaggtc     87420
     gacctgtgaa ctaaccaggc tatattgtgt tttatcgtca tgaagcaacc atcgatcacg     87480
     tccataatgg ctcaccctgg ttggtgggct atgtacatta cacaagcgtc aacggagatc     87540
     gaaggagaca gtttgagcct tgtccaggac caatgggagt tatgaactcc gttggagcga     87600
     gtatctgcca ggagcgacta gttcagacaa ccccaaagaa atggaccgaa gatccgtatt     87660
     ttatctgtca cttattggct cttgcgcagc ttcaggagcg caagctccat ttgtcaaaac     87720
     caaaatttta caccgtatgt ttctggcctg ttcgtttctt catctatctg tcgggcccca     87780
     gctgattcgc ttcctcttct cgtgaccaac gtattagacc gggaatacat attttgttac     87840
     gaggcgtaaa tcacccccga gctactgaat gggcttagga atccgaaggt tgcaacaagc     87900
     cccatgaaat ggcctacaat tcggcggaga aaagtcccat acaagcctta tcttaccttc     87960
     gccggccgac tcgtcgccga gcttgtggcg cccggcccct tcaatccgac aggtgatgtt     88020
     aatgctgcct ttgagtacgg taggaaacga ttacgcgagc aaggagacaa aggatcgtac     88080
     agggccagga aaggaatgag gtggtcgttc atgagcggac tgaggcgcag gtgatttctc     88140
     cgcatattga gggtttccaa tggtggattg tcagaggcat ttgggggtaa tttatcaatc     88200
     tttcgcgtga gttgaggatt agtgacgact atggattggc cagcgagtgt caaggatata     88260
     ctcgacccat ggctctacgg ttgttatacg aggatttgga gttccgatat tgggagatga     88320
     aagctaataa tttcctttcg cacttgccag caaatatctg aagtacgtac atcgcagcac     88380
     ctcgctactt tgctgttgct tatgttgtct tttactccta agaatagtaa ttggatttcc     88440
     tgtacttggt ccggcattac gtaggcccga gaggagtccc ttgcgtcata gacaggcacc     88500
     ccttgtaact tcagtaactt catctttccc tgatcacagc ttcgtccccc tcaatactcc     88560
     agtaattgcc cacctcagcc atgactttcc gaaatgtttc tccgggggat gtcatctccg     88620
     gaggcgctag atttgtgcac gcggggttga aaggcggaga aattgtcgta acctacggca     88680
     agcctgccct tgtaaagtcc gccaacttgg cgactcaggt tcgtatacaa cttccatgta     88740
     ccgggaagga tctaatctct agtgcttaaa tatgccaggc agccagctgg ggtgctcaga     88800
     accctattct agccacctgc gcggtcgtcg gcactactgg tgctgttgtt ctcgctgccc     88860
     ctggcctcgc aacagcccca attatatcga gtatgggatt cacagcaggc ggcatccagg     88920
     cgggtatgtg caaccttgca ggagaaataa aatgagtcct gtttcccgcg cccggaagct     88980
     cgaatgaccc ttctttacga agtataggtt ctgcagccgc tgccgctcat agttggatcg     89040
     gaaatattgc agctgggagc gcgatgtccg tagggcagag tgctggtgca ggagggagtg     89100
     gccttgtaat tgtcaacggg gctgcacagt tggggggtgc tgcgatgtct gtgggaagtg     89160
     ctagcgtagc gtgggtcaaa gctaaactat gagcatacca tatattgggg attttaccat     89220
     aaatgaaaat ggcctccggg gctctttttt tgtgaccaca gttgtcttct tggtctccct     89280
     gcgattgcta ctagaggacc gcaacgctcg aatctgttac ggctgcatcc aagaggttct     89340
     gagcttaacc gtcgactttt ttgcaggctc tatcgctagc agcgctcacc gatctcgatc     89400
     tgtcgttgag ctttttgaca ggttcccata ctgtgcagtc atgtactatg gagctgttgg     89460
     tgaagccacc tttggatctg tactgattat catggcgctg gtacatattt ttgcggcggg     89520
     atgatattat ttggagaatg acaaaatgag gcgtggaagc ccggaaaggt agtagatgtg     89580
     gcggagggtg ctcactactt tgttgctaac ggataactgc atctgttgac atggttattc     89640
     tgccgatgga acacaaaagc cgcttctagg aatcaaatag cctcaggaaa accgacattg     89700
     cttctgtgta agcgtgtaac gtattatagc tggttgccct gctatatacc ccgctgcttc     89760
     tcaagccttg aagagtgtta cccacgcaga atatctacat ctagctccct atgtggctta     89820
     agtcatctct ggcataattc cttcagctgc atcgaatttg tacaatggac tgtgtcccct     89880
     gatcgcccat gcgggaccag catgctgcac caccctaggt ctatccatct gaaagttggt     89940
     atattcctta gagatgtggc ctatcagtga aataaccata caaagctcct ctataccttt     90000
     agacggagac caggtcgggg aatcagacaa cctactccta aaccatgtct ttttcactag     90060
     ggatatctcc aattggtcac taggtcctcc gttcgcagaa aactattttt ggctggtaga     90120
     tatggcatga taacaaccga tagggtaatc taactgttgg agtattgttc tttaatctac     90180
     atgaattatt tgtccgagta tctgggccac cctggcctcg gtctccttgg tatgccatat     90240
     gatattgcga ttatcaaacg atgtgaatag ctttgaacat ggtaagcatt gcttgtattg     90300
     actctgctca tctcaatatt acatatgtca aatctgttca tagaagacca gatggagggt     90360
     tacaggactg tggtaaagta tttgtaggct tgtagctcaa aaaagcccta ggggaaacaa     90420
     atttcaacgg cattcaacct atctgttgcc ccgtccttgg caacagggga gcgccatcgt     90480
     acgtctcgga cgccaggatc agtcttggcc agcgtggtct agtggccatc cttcggaagt     90540
     taactgccca cagaattcag ggttatagac ggatgctgtc gtatccaggg tagccacata     90600
     gcgattgcgg cccttacgtt tcccgtgcgt tgtatagtgt gctttaaggt tgtcccgacg     90660
     caagaacctg cgctgacacc caggtaccca gcagatatga ggcctctccc ctgaatggct     90720
     tgccatgtga cgattaaggg tctttcggag tttaaaatga ctcttgcatc cctgaacacc     90780
     gcatttgaac tgccgtcgag ggacgttggt ctgggaaccc ccgaggctca aattggacgg     90840
     atcccgtgag ccatgtagaa gattgacagg ctgcccgaag gcctggcagg gtctcgcaac     90900
     agtattctgg ctgtcgtggc gcagtgcctc aagcggccat aggtaggaag aattgatatt     90960
     cgcttggttt gggaaaaggc aagtttcaaa taaactcggc gcatagccaa aatactcagg     91020
     agatggccct agcaggaggt ggttggatgg cactgacgta ggcagatatc cgagccaaca     91080
     gattacaggt cgtgatccgc aatagatgga acctggatca atcgagcaac ctgtttgtcc     91140
     atgacaatga gcatcccaac tgccttcgtg cttttgcacc gagcggggtg acgcctgaga     91200
     aatatcttgg cccccacggt tttgatgaaa ttccatgcca ggccactcgg cagggccagg     91260
     agcaccgttg gcttttagtt cgccgctttc atggaagagc atttgtatgc catttgtgaa     91320
     tgccagatca ttatcaacac atatttgcga ggatggtggt gtgatttgtt gttccatctg     91380
     tggattccca tccataaaca acttatttac ggacatcttt tgcagacagc cgaaggaagt     91440
     aacaagcggt aaagtccgac acagcactat agatgtgttg tccgtgtgcc acgcctaatt     91500
     agtctgggtg cgagcatggg atgccggata gaagtatcca aggagttatg attagctagg     91560
     caataatcga ctcggtggta gcaaactttg acctttggaa ttcccacaga atcacgcttt     91620
     aatctgagag ggcgaaaagt gtggccgact taatgttccc catcccatgg acacagcgtt     91680
     gaataacgaa atcttgctat attctgcgtt agattacgcc ttggatagat ttgttacaat     91740
     gctagggagt tgatagacga aaagcccgtt gggtaaacag tggtcagcgc ctgcgaggtt     91800
     tacttcaaca tggcgttatc gctggccgca atcttaaaca aggcgtgatg aacgccaggg     91860
     gcttaacatt aatacggact ctcaacaacc gttaatgacc ctcccttcaa ctcctgcata     91920
     ccaaggctgg ctacccaagg atggcgattc aatacaacaa ttatcaccaa aatagagata     91980
     gtgatgtcca acagctccgc tggctactga atattgctcg gctagctagt gatattgatc     92040
     tttagatcat tttatgatcc aatatacgga ctgccacgaa attcaaacac gatgacaata     92100
     ttgtaaatcg gtgtactatt tatagtatca cttatagact atattagact atagtatcgg     92160
     taagacaggt aaagctagaa cgccgagacc gaaaccagcc gtaccagtaa tcgtccgaga     92220
     attgggtgag agcgactcgc cgtgctgaaa ggcaatcttc caggccaaag gcatacctaa     92280
     ccataaccaa gtccactgga ttatctctct tcatctggcc aacatggtcc ttgcagcgtc     92340
     aactagatgc tggtcgcata gaagttgcga gtgatcatta catggccatg tacgtggaac     92400
     tcccactgtg caacgcaata agtactggca agtttgccac ttaatgagca taccaattat     92460
     tgtaataacc atacgatgtc cgatctggtg cgctcattga ctcatgagcg aaacatgagg     92520
     ccgccactac aaagaagctg ccgcagactc tggctcgttt gatagcttcc gtctctttat     92580
     ttgggcgcgt tgtcggtcaa aataagaaag taaaattatt ccgacaatgc agtagagctc     92640
     cttaacaggc tctaccgaga ttgctgttgt gatcgggata tactcctgcg caaccactgc     92700
     ttgttgacct gcaggcgagg ttatgggtac cattatttac caatacacag ctcctagaat     92760
     tctttttggg gtttccagga tcagtgtatc agttcccagc acaatatttg tggatggaat     92820
     atatgcacga gctggttttg atacgtcgag agacagaatg gatataattg tcgagaactt     92880
     gccggcccgc gagctgtggt ttccgccaac aggtccttct tggcgctcca caaggctcca     92940
     ttcagctgat cccgttgcct gtatttcttt cgtcgccgct gttaggcgtg tgtgctttta     93000
     tctaccggca atcgggttcg agcaaagaca tatctataat ctagaatgaa gcatgcggcg     93060
     gataacatat ctaggtgcat tgatatctag cacttgcaga tatgaaacgg ttgtgtagtg     93120
     ctccgaggga tttaaatatc agaatttaac tcattttgtt gctaagcttg ctccaaagct     93180
     ccacatctcg gctaggctct ctattgctag tccgaatgca gcgtgactag tcacgtgtgg     93240
     tcacgtggag ctggccatcg cttggttgat ttcccatctc cgtcacatct ccgctataaa     93300
     ctgtgatcac ctacgctgaa tagaatctgc tcatgcgggt tggcgaagaa gtgtagaggc     93360
     agaagggtct cgtgatactg taaatgagcc cctgctagtc tggccgagcg acgggggccg     93420
     ttctgcacac tctgctcgac agacatccct tgggatccta ctaaccgcgg gcgcgactta     93480
     ctctggtgag agtcgtttgg tgttggattc ctgataatgg caagctctct atcaggaaac     93540
     gattcgcttc cgagtggaca gaatgggact agaaatggct tgcgaaataa aatcaatagt     93600
     gatgcgacta attgcgtcta agtatatatt tgacaacaaa agatactgaa cctacaaaac     93660
     cactcacaat ataatgccta ccagtcgcat cagtaagttt ataataaaca cgacatatta     93720
     gttatactat ataataggat ctttattatg ttcaattatc tgctatacta gtggttattg     93780
     ggggtaggtg acaagtgata gatttccaaa agttgaaccc cctattcagg aaacttacat     93840
     aatctgaggg tggcatggac cgatggcaag gtctagacgt tgaccacctt tttcaccgcc     93900
     cgaccattca ccaccacgct caccaccacg ctcatcaaca ctcatcaaca cacatcaaca     93960
     cacatcaaca ctcaccatca acactcacca tcaacactca ccatcaacac tcaccatcaa     94020
     cactcaccat caacactcac catcaacact caccatcaac actcaccatc aacactcacc     94080
     atcaacactc accatcaaca ctcaccatca acgctaacgg ttcaacgcaa caagcattcc     94140
     tagacaacac ccatctctgt ttgcctacat ctgaatgaaa tatgctaatt tctattgtag     94200
     tgaggaagct attgcatcac aagctaccaa gggaaaggaa tgtgaaatac gtcatttggt     94260
     actgaagaag cttcagttgt tagtttatga ttttggctat tgaattggca aagatctaac     94320
     tagggcccct tctatgtatc caatgatgac ccttcggaac aacgaacaca cgatgaagat     94380
     gttgtgcagg tctttgcttc tccgaatact cttggaacac tcgaaaactg gtccctagca     94440
     ccacgaagag gtgcctgcac gggctagagg ctcttgttgt agcagatgtc cctgcgaggc     94500
     gctttattga cgcagggcct aggctgcgga gaaattggta atgcagcggt ctcctgcggg     94560
     tctcacttgt catcacagcg tccccctgcg aagttcattt ggtaacgcag cgcccccctg     94620
     cgaggcatat tgatcacgca gacctatcct gcgaggattg ttgttgacgc agacctatcc     94680
     tgcgaagcac tcttttacat acacaggggt cattggctgt gagggagcgc aagtcttaca     94740
     tcgctgggct cgtggcagcg acagccgtgg tcatggaagc tctcaagccc gtaggcacga     94800
     gaggggcacc atgacacatc ggagtgtgag gaccggagtt ctgatttttt ttgggctggg     94860
     aatccggctc cttttatatt tttttcggct acgtctctac caaggaacca gttgcgcagt     94920
     tagtagcgag aaccactgtc tcgttattat cgttgaagac atttgaagaa cgttgaaatg     94980
     gtgttagcag actttgtggc ctacagactc aagtttcaac ctggattcat tgctttcaaa     95040
     aacctgcgtt tagtatggtg aaccactttt tcgactgttg aaaagacagt gataccgcaa     95100
     ggatatgatt ctcacatatc attgaatttg caattaaatc gctcaacgct gtggcagact     95160
     gactactctg cccgttttga ccatggtcac tagccacggt caccgtcttt ttcatgaggg     95220
     ttgaagtgct tcagcaggtg ccgcaataat ggggtggaga ctttgtgtac ccgtggttgg     95280
     ccataagacg tgcctcccat tgctccctct acaatcccct ttgcctagcc tcgcgctaac     95340
     ggtactttct gtatttctcg caaccaactg atgttgcctc tactaatact tctgctacct     95400
     gtcggtgcag atactatgaa gatactccca aatccagagt attggctgtt ttcctttgac     95460
     agagaatcaa aaatcgagac ctttttggaa agcctagaat agaaacccga gtctaggttc     95520
     caggacaatg aagtgagtta tttcagctcc catggctcac gagctaggtt ttcgtgatcg     95580
     ccactccctc gcaagattgc aacgctacta tcacacactg gcgagaacct ggacagaagt     95640
     aagaccgggt ggaccaatta aacaccacac gttaatttag acagacgcag gtacggttct     95700
     gcgacgcaga tcttagcgac gacccacggg atagtagatc aaggaggttc tatttgtggc     95760
     ccggagagaa attggaaaga attgccaagg tccagacatg atccacaagc ccaaagtttt     95820
     cggccatcag tgcccgatga cacggggctt ttttgcttaa ggggtgctgc tggggcaggt     95880
     gagtatttgg aatatcacac tgactttggc gatagagtgg caggctaaac cccgacccgt     95940
     ggttgtgttc ttttgtgttc tcttggtcgt acggtcgaat tcgaaatcag ttttaaactc     96000
     taaactcttg cgactttatt cccggaactt gggtggggac acgctaatct aattttagct     96060
     cttcacctgg taatccttgt agggctgtat tgtattctct agtaacaaca atgactcatt     96120
     gttatagtac cgtaatcgct cgtagaaccc gatggaatcc ttcctgcaaa ctgaccgaac     96180
     aagagataat cctacactga ttttcgaaat ccattctaat tccgtctctc ggcggacata     96240
     tcttttattt tccatgctcc cgcattcaag cgtgctagat cccattagta gatcgcgtta     96300
     tgatatcttt ccgcaggcct ccaatttgtc cttcgacaat tcgtacagtt atctgatttc     96360
     tgtacagctt ttgtttgtgt cgtatgtccc aatgtcacca atgtcccatt tgtttcccag     96420
     actttaaata ctggaccacg cgatcttaat gttctacgga atatctctgc tagtgatacc     96480
     tatattggta attgaaagca gtcactgaaa aactagctct acttccacct cggagcgctt     96540
     tgcgctcgag ggagccattt ctgtagtcga gtgttcgtgg acacttgcaa tcatgatctg     96600
     tccctcggga agttgtccga ccacatcgtc atcaaccacg acttttaagc ctttgctatt     96660
     gatccagatg atatgaggga tgaggcaagg gtcgatatgc agtttcgccg caagttcgac     96720
     tttcaaattg cgagaagtgc ggcctgtaag gtatattgca tgataggtgc cctcgggttg     96780
     ctttccgctt agggcgaaca ggatatagaa gcatgcaact gcgaaataga agtgagcgta     96840
     gaacgaattt gattttctgt ggtacgaacc ggattttgaa gaatgctttg caggagatgg     96900
     agaactcttt gatgccccaa cggaacaata tgggactttg ggcggacgtt cttgacaaac     96960
     agggctatgg gagtgcactt gtatgttggc cttgtttgga atttgagccg ctccttctga     97020
     taccaagttt atagcccctg tgctatgtcg atcgtctaag agcctatcct tcatgttacc     97080
     gcgaagagca agtacactca ctagacgggc cgatgaaaga acctcgactg ttgtggccag     97140
     ctcagcgcgg aggacttccg acgtagggct tttccgagga cttatcgacg acttgcgctt     97200
     cttgtgagac gggacatcga attttcggcc gtttatcgca ctctcgttgt gacatcgact     97260
     ggcaaagttc gcatttgcct ctcggtccat aattcttttg ctgagctttt cagccctttt     97320
     gcttatacgt atcttatcgt tccataattt ccgttcggca ccgtggtctc taagtacctt     97380
     aaccaaagag taacaccttt ccggctcgtt cataacagac ttgtttctgt cgttcgactg     97440
     taacatttcc gtttttgtac acagcctgac tggtacccct tttacccctt ttgcgcgagt     97500
     gaagtcggtc ggtacaaaat tgaatttcag cagaatcact gcctcatagg ccttcgcagt     97560
     tggatcagct gtccaaatga cacaaaagtc attgacagaa gcttcttcaa gctgtacctg     97620
     gcagtgtccc tgaattcgga ggccgctctg ggaaggctcg ataaattcga cagctaaaag     97680
     cttgcctttc cgctcattgg cttctttcag accacggcct tctttccata gctgccacga     97740
     tgcaaccgga tttgatctct ggtcttctcc ctctaaagac acatacacaa atgtcctgta     97800
     ctcaaagaat cccccgttat tcgtgggtgg ggtcgaatct gccacagtga ggctgtatgg     97860
     ttgacctttg ttgagatatg ttacaggctt ttcgttgcca ggctggtgca ttgccgtcgg     97920
     ggcttgcagt gtcgcattgt aacggaacct atgaagagcc tcagcaaaca ataaatatag     97980
     cgtgcgttgg gcataggcgt acttttctct gtgcccatat atccaatgtt cgttgacctg     98040
     tgccgtgggt gtggccaact cagattttgg gtttgattgt ccactgcaac gactagtgaa     98100
     aatatcttga tagacatcat atagcgtaga gtatccagaa ttgtgatgaa cgagagttgt     98160
     cgatatacca ttcgcctgcc caaaatgtgt atcatcatat ggccaacctt gggacttagc     98220
     caacgaagtg aagcaaggcg cattctgagg gtcttgcgga ttgggttgga ctggctcatc     98280
     aagaatgcgc gaaatgtctg tgctccactg actcaacgga gagagtatgt ctcctacgtt     98340
     attgtataag acagcgtccg accctgatac attgcgatcg tgaaatgtct cgtacttttc     98400
     cacgtcaatc atcgaagaga acgaatctgg tgcatggaaa ccgcgatgct ttgagtaacc     98460
     gctcgccttg atgtttgatc ggtatttgcc tcgtctgtgg gcgcaacatc aatagggtcg     98520
     tctccattga cacagctatc agggagcatt ggatctccca tgtcggtttg gacgcctcta     98580
     atttcccttt cagcttgacg gctcaagaaa cgatcaccat atttctcccg aaactgatta     98640
     atgaactcat catatggtct ccgcatgatt tatagttgtg gcgctgggat gccaaaaaaa     98700
     gaaatattaa agcacaaaaa aagaaaaaaa aagcggcatt cctaaaagac agagcaaatc     98760
     tgcgttactc ccacccttgt tgccgtctgc actcagcaga aagatctcag cccagttacc     98820
     ggctccaccg ctgtgcgtgt tgtactcttg tttctcccgg cactggccat gatcaccgtg     98880
     ggtcttcgag caagacatct tcaagaaccc aaactggcaa cgggatatta ggcactcgag     98940
     atgtagataa tctggctagc tatcacgtgg ttcacaccaa gttgaacaag gatatttaga     99000
     ataattttgc tcctcaacct tcggagtatt gtcggataat tgtgaattcc tttttcttct     99060
     atacgaattt ataataaact caagaagatc ggtgaaaatt gaaatggcgt ttaggagaca     99120
     atgcattggc gatgagtata aagtgtgggg cagaaacact ttcagtacat cttctatccc     99180
     tttttctttt tccggggatt cttaacgaga cacgataatt ggtagtgggt agatcattta     99240
     acttccataa gtaaagggat caactcgaag gagaaccgtg tgattgctgg gagtttcctc     99300
     cgggcccatt gtccagttag tctgtgtaaa tcctcgtaga tggaggtaag ccccaccggt     99360
     acctcgcggc caccaagttt tataaccggc cttcgctggt ggctctacat cctccaactg     99420
     ctctagggtc agcaactcgt tctcattcga tctgtcaagc ctccttggcc cagtttataa     99480
     tgaaattgat acactgcttt caatcgacct gaaaagggtc ctcaaagcat atcatggagc     99540
     atcacacttc tctgtcttag catatattat cggaacaaca actactgcta tagcaatcgc     99600
     gttagaggct atgtggatgg tttcccaatg gaaaagcatt gttggtactc ctacggcttc     99660
     ctggtggcta aggctagtaa caatttctct ttcatctgta agaccgacga tagccaaagt     99720
     caagagttat atattaatga aagctcagct tgcctccgtt ttcctggtat gcgcttccgc     99780
     caccataacg gcaattcacg tgtccattaa gtcggccata caggacagtt tacaaagttt     99840
     gggagcgcat gcaagcttgg gtgggctttt ggtcgcggct tggtttgtag tactactttc     99900
     cgtttctgcc tctttcatgt tatggttcac ccgacttccc tgaattttct gcacccgcca     99960
     acgctgcact atatcctgaa ttgaatgttt gcagccaatg aaacgtcgtt gtagtccaaa    100020
     acaataaact tagattttct ttgttcacac aaatccgagt taattccact gggggagttt    100080
     ggcctctgat ctgtacaata ctgtacgcag atgatagacg actcattcac cgtagcgctt    100140
     gaggaatcca aaattgggcc tcttcgccgc gttgactggt aatggccctg gtacaagaat    100200
     attcggctca cgaaagacgg aagctggcgc tcaacctttg tatcccccaa ataactcatg    100260
     tttctggatc aacaagcagc cattcaggtg ttagcgggct acgcatcatt ccacgaacat    100320
     caagaggagt aataggtgaa gggtatgctt gaaggctgca ggaattacgt tggagttatc    100380
     aaggaatttt ctgctcctta ccgctttcag aacttccagg gtcggtgtat atattcttag    100440
     agtggacttt aaaacaagaa aacaacattg aaggagttgt cttccaacct cttgaggttt    100500
     atatttccag cgaggcccat agccagacaa cagggttcca ttcacagtag cctgatacct    100560
     aactgcaaat tgtgtggttg ccggcaggtc cccagtaccc ttcacttgcc aaaaattggt    100620
     ttcgcttgaa gcaacggatg cagatcaagt gatagctgca acagcttttg gccagagtag    100680
     aacgatagtc caagcagtgt tggaaagatg ccaggtaacg ccagaacgca ctaatcaaag    100740
     cctttacaga ctaaaggaga gttgcgcaaa tagtggctca agcctcggtg gggtgaggtc    100800
     atactactga ggtaagggcg ccattttaat cctgatgggt gagaccagct ggtaccaaaa    100860
     caattcttat tgatggcctc ttttacgttt cgtgaaattg ccctatttaa agaacatcac    100920
     tgatattgcc acacttatga acgttctcca gtcaccgtat aaattccagt caacgcattc    100980
     actgcgattt gagaaggata ttttctgatt gagtggccct acgaagaatg gaagacctag    101040
     agcgtgtggg aaaattaatt gcattagcac tttgggccct agccctcgtc gctattggta    101100
     tcttgttcgg tggatgcaca tctacgtctt cattatcacg cttctatttt gttatgacct    101160
     tcatctcgaa ggctgagtct aggtgtaatg gcaaagagct gtcacgggga ttcggcacac    101220
     acgaagattc ggggtcgtcg acttcggact agacatgaac catgtatcca ttagacttcc    101280
     ttcaatctgg aagacaaaat aatataccgt tgtttgtatt tctggcgaaa ttgattcctc    101340
     gggagcctta tctttggctg ttccagttcc atcagctact gacgctccgg gaggttgatc    101400
     tatcaactcc gacttgtcgc ttcttttcct cttctttttc ttcttctttt ccgtgctggc    101460
     catatcgctg taggttgttg gaacgtcctt tcctgtctgt ttcataagtc gataggaccc    101520
     gcgagtttca tgtggtggag tcgaaggggt ttctataatc gcttccttag cctgagaaat    101580
     aggctcggtc gcacctccag caatcacgag tcgagctttg taaactaaag cgaccgttaa    101640
     tgatccattc tctcagacgt tggcgggggc taactcacca tgatcggcag cgtgggcgat    101700
     aaccagatta aggtgctcct cactgtcctc aattccgcaa attgtgaata cctctcgtat    101760
     ctcctgggct gtcaggccca aaatggcttt atccatggcg ggagatgatg atggcaaaag    101820
     actaagactg cgtcttgtca atgaagacag aaacccttct ggaacgatcg gggcaacggt    101880
     tgccctctgg cttgggggga gggaagaatg agccaatcaa atcaaccaca ggcgaggctc    101940
     acaaaaatag catcaaccag gccaggcaag acttgaccgc gattgacccc tctttttgtt    102000
     gtgtctgtgt cggccattcc atataaaaaa caaatcaaac catacaacta tgtaaatggt    102060
     tctttccgta accttcaccg tcaggatagg tgcaacgccc atctggtata tgacttacgc    102120
     gcaaggacag gacagagctt tagagaatat tcgctttctt aggtcttgat ctggcaatgt    102180
     tgggaaagac aatcggatcc catcccttga gccagcggag aacccatcgg tgggtgcgtt    102240
     cgtcgccaat gaggtcggtg aatttccggg ctcggtattt ctcagtccac attgcatatg    102300
     ttgctttctt gctcttatgg ctcatattat tcgattcaat ggatcgttgg acagcagggg    102360
     gcggcggcgg cggtcttgaa gctttctcct ggctttcttg agcagcttcg tcaagaagtt    102420
     tatggatatc aattccgtag tagctcttct gagcccatcc gggggcggtt gtagatcggc    102480
     cagcaacaag tctctcgtag ggaatggcag gtttgctagg tctcgaagcg acattatgcg    102540
     atttgcccga gcacgttttg atttgaaata ccccaggcgg ctttctcgac ggaccgggag    102600
     attcaacaat aggctctctt gcgacaggag gattggccaa aggcgtcgag tcgggcgact    102660
     tttgcggcgg tcctaggata atcggaaact gtgtgggttg cacggtgggt tgttcttgaa    102720
     tctcgaattg gctcatctgc gcatcgccaa acgcatccaa tgcgtcttgg tcctcgtcct    102780
     cgtcctcgtc gtccaggaat cctcccatga ttttctgccg cttgggctcg gaggattgcg    102840
     gcggttcgtc attctttctc ttctgcgggt ctgtaggcga ggggggtcct gaggggaagc    102900
     cagcgggcga agacatgaag ggcattttca ccgtgggagg agaggaaggt agtagtggta    102960
     ataaacgagc aggcgaagag ggtatgatgt gttgaaactg tttagatttg gttttggttg    103020
     gagtgtctgc caattagtat aaaccagttc aagtcttatc tgcacaacca acttaccagg    103080
     tcttatatcg tcgtcactgc gaaaaacatc cgagagattc caggcgcgat gctggatcac    103140
     aactttatcg cgagtttgtt caatgcgctg gatgttcaaa gcctcgaggt cgtcggagaa    103200
     ggactctgag gggagatcta ggatatcgga gtggaggtgt aaggccggat cgaaggaagg    103260
     gggaactgat ggagacgaag tcgtcatcaa aggcgtttag agagtcattt ctgtcgtgga    103320
     tatggttact ggaatagtca attgtgtctg ctgtggttat tgtgagtctt gagattgaag    103380
     ttgaatcgcg aatcttggcg cgtcaagacg cgtagaacac gctagtcccg atttgtcatt    103440
     aatgtatact gcagcgacaa cgacaacgac atctcgactt ctactcacca gactcgtctt    103500
     aaatatcgac ttttgaatag cagatttctc aatctctaaa tctctcacta tgtcttctct    103560
     tacgatacat gataatacag ccaaaccagt cctataacgg agaatctcat ttatatcaga    103620
     atatatcatg aatccagtcc cattgaccaa ttcaacctca aaccctctgg attgagaata    103680
     cccgggaccg ctcaaacatc cccgatgaag ggaatgtcgg tccaatttcc atgggcaata    103740
     tggatgccaa ccttggtggc gatcaaagta actgcgattc catacgatac gtacttggca    103800
     atttcagcta caaattcgac ttctggctgt gtgtctagaa tcgtcgttag ttctgcgaat    103860
     ttgcaaacca catcaatgag agagaacatg cctttgacga agcgctcaag cgctccgctc    103920
     caggacccaa ggaggagaaa tgtatgagtt gcaatgtcga gcccactgtc agtgtcattc    103980
     ttccctttcc aatgcggcgt cttgatttcc aagacactcg ttgcgacgga aagagaatag    104040
     acaatggctt gaaggattgc gtccatcaca gcacgaacct tgtctaccac catcttcgag    104100
     agcgctgtca caaaatgcag taggatgttg aatcccgagt tgaacaatga aacaaaccag    104160
     ccgatcatct gcaacgtata ccctggattt tccttattct tgggaatgct gtgcaacgta    104220
     taaattaaaa caacagcatc cagaatatgt tcaagcgtta ctttccctcc accactggac    104280
     cccgacaagt cggcaagagc caccagagat gcagttggtg aaggctgttc gactagaagc    104340
     tcctcataca agtcagttcc agactcaaag gcaagtggcg agatggaatc tgggacactg    104400
     agaactaggg atattccaaa cgtagctgct cctgtgatgg cagcaaattt gttgaaatct    104460
     gcatctttcg cagattgacc gtctgccatt tttttaatta tggcagcgta ccgacccctc    104520
     ggaatggccg gcagcttatc accagtcgct agctttgcaa tgaccgtggc gggtatggcg    104580
     ataatcaacg ccaaagcatc gagaatggtc agctcattcc caggcgagat ccacatcttg    104640
     tagatggagg agaagatggg gacgttgatt ggagtggtga ggagcccatt gaacttgttg    104700
     atgatggttt tgatgatatt caaaagcagc tcggtcagtt tttccacccc gtcgatgcag    104760
     tcggttagaa acgtcttttc ggtctgctca tgggcatatt tggcatcgag tgagcgtttc    104820
     ccctggggtt gatattcatc taccagcttc ttttggcgtg ctgtgacttt tccatggtat    104880
     ttgtcctcga agtttttgaa ttcctgatcc aaattcccaa ttgcctggct ttcctctgga    104940
     gttgccatat cggaactgaa cacggtctgc agaaacgtgg atgcatctcg agcgcctcca    105000
     tgattgaact tggttcgtgt cagcaatcga taaattcccc agagatgctg ctgcgtactt    105060
     ggtactgtgc ccagtttgag gccatagaat tatgaatttt gctcttagac tgatctgttg    105120
     accctgtttt atcgtctgcc ttgataccaa gcttctccat gtcgtgattg ctgggccgac    105180
     tgtctgagac tgatttcttc atcgattcaa agagaccctt agattttccc ttcaaggaat    105240
     ccgtcaaaat gggtccctct tccaaggcat ccttgacaat gttcacaatc gagtcttttg    105300
     tggctgtgat gtccttccag ttaaaaacga atcctaacca atcgatgatc tttttcccaa    105360
     tgtcaagaat tttgttgaaa atgacagaca agaccttgcc cacttgatca acagttttca    105420
     tggcccattg atagactgtc tctcctatct ggaccagaac tttggctcca ttcacgatga    105480
     acgaaatgat cttgtcgccc tgtttttcca accagtgcca ggctccctaa accagatctg    105540
     ttagtgagtc atcaatatca agaagagact actttcccaa agcatgtcct tgaccccgct    105600
     gccagctccc tggattatgt gctcggcatt aaatctatag caggattcga gtgccaccga    105660
     agacggggtt ttcccttggg cgatcgaatc tctcgttttc atgagttgat ggatgtttcc    105720
     tgccacttgt tcaatctgct ccggggtcag cttggtaccg tcgagtagct tccctttgcc    105780
     gggacctaaa tcgatgttca aatcttcttt gtgttgaatt ttagacagct tctggttgat    105840
     cttatgagct ggatcaacaa acttttgcgt tgattttgta gaggcctttg aagcatcggt    105900
     gacagtaaac gtgtgtgttg aaatgtcatc tgttggcaca gtgagagtga gcaggccagt    105960
     ttggtctgtc ctgactgata ttcctttttc agtggcgaga acactgcgac cattaacaat    106020
     cacactcgtg tccccagacg ctcgcagaat caccggatga ttgaccaaag gaccaccaga    106080
     ggcgttgagt ggttttattt gggtcatgta ggactgcatc tgaatcgtct tgtccaagga    106140
     tggctgaata aggggaattg ttttccaaat ccctgatttt gcgtcctgct ccaacatgga    106200
     cagattgcca acattgttag caaagacaaa tgtctcacac gaggacgatg ttgctttaaa    106260
     cggagcaaag taacctccct gatgatccgg gaccacctgc actgggggat cgggcgattg    106320
     gaaatcgaga tccgtcatga gatatccaat gccattgtca gtgttggccg cccacagcga    106380
     agcttttgaa ctagaccttg tgacttggac ctccttgact gaagagaaga ccccggtatc    106440
     tgcgatttta tcggatgaag ggtgagccaa tccctttgct ttgaacctat aaagaccaga    106500
     acctccaacg aggagatcag tgaagccatc ggcgttcggt agagctgcca gagctcgagg    106560
     atctaggtct gttaggaatc acactatacg ggggtttatg aatctcatta ccggatggag    106620
     ttgtgtctgt ctgaagtcag ttatgtatcg ataaaccctt cagaagactc accagaggct    106680
     tgcttgagag gcacttcaag ctcgtgaggg acattgatcg agtaaaaggt aatagctttt    106740
     ttgcctgggg tactgattaa cagagttcta cactgaatgc tgctctattg gggaatatta    106800
     ccttgaatca agtataaaac ggcatgaccc gggattatct tggagccata cttcattacc    106860
     aaaggctgta ctgcgatgat catctccgca ttctctggaa gcttcacatt gtcctttttc    106920
     atccaggaat agctgtcctc agacctggtt acagccgcag acgcaagatc ttgagagtgg    106980
     tagttctctt ccttgaaagc gaaaacaact ggggggtagt ttttgccaac ggcaggggcc    107040
     tgaaggtcaa cattggtata aaatacattg aacaagactt accatgaaaa tgtcaaacac    107100
     cctggggtta tcctcaccac ttccagccat gacgaacgac ttgagatcta ccgacgagga    107160
     tgaaaggtcc acctcacgag gttcaaaggg ccgaagcaag catagcaagc ttcgagaggc    107220
     attcgagtca tgcgcaatgg ccactgcgac atacaacttg gacgctgcgt cctggaccac    107280
     gtcgaacgca tgaccggtgt aggaggatgc aaagcccagc ataaggccca gatcacgcac    107340
     gactcgattt ccagacttgt cgagggagga gacgtataat ttggagtcgg ttcccaagga    107400
     gaagagcatc aattggccat ttttatcatg gacggccacg aagcgacggg agtttgggac    107460
     agacacagcg gcgacatact gggtcatcaa ttcggaatca tgctgaatgg tttccatggt    107520
     gttggaggtg cttgaattct tgataaagag ggcagtaatg gttttgacag atgaatgaat    107580
     tgtgatattg gttaagaata gctggatatg gcacttttat gtctgaaagt tcacatatta    107640
     tttttgaatg tcaatactga tgatgtctaa aggtactttt gcatccaact cgtacagctg    107700
     tcaacctggg cagaagctgt actcgatgca gatctaaatg aggggatcca acacggacca    107760
     atgatattgc cttacggtat atcaatccct ctagctaaga tgttacacaa catggtctga    107820
     catttaagac tcgttattgg ggttctgtgg ctggctgagg ataaggagca catgctacct    107880
     attttagccg actccacatc tccatgcacg ataaagtaaa tcgggaaatg atatgccatg    107940
     agtctacgaa cataagcggt gaacacagcc tttcgagtct cgattcggtt acatttgtgg    108000
     gcgctgaaat aaatgtctcg tacttcttga atgtgaacct tacatcactg tctcacttca    108060
     gctgaagcat ccctgctttg ggcaatggat tcagctggca tgtgttgata catcacggcg    108120
     atcatgttca gctgaaggaa tacttatcct aggtggcaac atggatttgt atactgctac    108180
     tacacatggt agacagtatg agggatttag agagttgtgc ttgacgctgt ttgggatgat    108240
     gaggtaatag taagtacgat cgatgcatat aagacttgca ccttctttcc ttctcaacca    108300
     tcaacatcct tgaattcacc cttggaaata tccccaccag aacagacatg gcatcggaaa    108360
     aagacaaacg cctccagtcg tctctcaaga ccgcgactgg ggctttcgac caagccgtag    108420
     cagtgtctca agacgcgctc aacgatggcc tgtactacct gttcgacaag tacgaggact    108480
     tgcagaagat gaaggtcaac aagaaaaagt ttggccggat cgatgcgatg atggatcatg    108540
     ccgaggtgtc tctgccggtc aagtcttcca gttatcggac gctcgttttt tattgcattt    108600
     ttcaaacggg gaagcttgtt ctcacggatg atgatgggta tggatcgatg caattctgag    108660
     tgtatgatgg cactgacaat ggatccagaa atgacaaaaa gccaatcgac ctggcagact    108720
     ggcggtttgc attcgaggtg gactatacca ccctcgatgt accatcggat accaccgagc    108780
     atcaggaggc gaagaaacag atgaaccagc ctggcgacta ctccatcaag agacttttct    108840
     tggactttaa aagtgagcga tgaagctgcc tattcgtagc aatcactaac actcactagc    108900
     ccacaagatc agaaatttca acaaggacct gagcgatttc aagggccaca attgggacag    108960
     tgaagacttg caaagtttcc tctcgctgat aactttctgg ggcgaccctg aaaaaggcgt    109020
     tatgaaggac aagcaaaagt cgacactggg atactttttg acgactgcga agcccgaaac    109080
     agtcaatccg cccgcaccga cattcccacc cacctccgtg aagcatcagc attacaaata    109140
     catcgcacct gggaagcaga cacccgacga aggaccgaaa gatggcaaga acaatatgct    109200
     tttgtacttg gagatgaccc agaaccgttc cttccccagt gaagacatcc tggagtattc    109260
     gggcaatttc gtgactccag gcatgaaggg aacaacgtgc atctcccgag acatcttttg    109320
     ggattcgtat cttctccgga acccgtctct cagtggtccc tatgggccac agcctcctct    109380
     tctgcgcgag ttcaatcgac atgtctacgc ttggcttggg gaattccacg tctgggccaa    109440
     gaactattcc accgatcttt catggagcta cggatttgga cacacccggt gggagccatc    109500
     tcgaagccca gactacttcg catggaagaa ggtctctgca aataaatggg agtggaagaa    109560
     taaagacaaa aagagcggcc atgatgaagg aatatggcct gtccgtttgg acgcaaaagc    109620
     gagcagtaag cagtggcttt ggcattccat aatgaatctt tctaatgaca tcttactagg    109680
     tgatacgttg aatgaattga ggtttgaccc agggagtaac aaaatacatc tcgaaggctg    109740
     ctcgaaagtc tgggcagaaa tgaaaaggag cgatttccag aatatagaag aaaagtgagt    109800
     gttctgacat atatagccta tccgtacatt atgttgatat atgtgataga ggcggtgttg    109860
     ccatcaactg ggcgctagat atcactatcg actcagtcag cgaaggaggg ctgaaactga    109920
     acatgaatct tccagccaat cccaaggaca ttttccacac cactgcactg acaaagccat    109980
     ttgctacaga ggccgaagag acgcaggatg aagccgagcc cgctgagaat gaacccgctg    110040
     agtccacccc gaaaacagga aagactggta agatcagtgt ccatgacatg acagaggcgg    110100
     cgaatgatgc agctgcaaag ctggatttca aaagcgtgac gagcaatctc cagactgcgt    110160
     tggagaattc agcgcgtttt gttcttcctg gaggccggca gttcttctac aacaacgccg    110220
     tctttggcaa taatggggat ttgttggtgg aggccaagta caagtcttga tggactgtga    110280
     gctactatgg tgtacccata tctatattca tatagttata aagagtagag tgtccataaa    110340
     atcaggtata catctcagct cgatcctctc gcattcatcc acagatccca gcccaaagct    110400
     cctccttcca ccctgccagc tcaactcaat catctgcttt gcaaagattc gtagatcatc    110460
     ttcatattct ccaataaccc tctcatccac catattacca gcagcagcaa gtctccgtgc    110520
     tagatccgct gcatctctta aggccgtgtt ggcgcccatt ccagcagtcg gtggcatggc    110580
     atggattgca tccccgagca acgttactcg tgaggatttc caaataggca actctggggg    110640
     tgctgatgag atacgcagag tcgatgtttg tgctctatcc tgcttttcga aaactgctcg    110700
     cagcgcagga gtccagtgct gtgtcagacg gagcgccaga tcagccgatt catcgttctt    110760
     cagacgtagc ttatcgctgc gtggatggtc cggacgagga ctacttgccg tcttgtctcg    110820
     acggggttga cttccaggtc atcctcccac aacacggcct tccttccggc gtcactcagc    110880
     agcttgctga tgctttggca actgctcgcg agagtacgac caccacggag cctttcacgg    110940
     actggcgtgt aagcccagag ggactcgtcc tgctccgtcg tttgccacca aattcccgaa    111000
     accactggca agctgttatc ggacaagccc taggccgaaa cgatgaggaa gacggcactt    111060
     gctgcagtcg gtgcgagact taagtgctga cagtgctctt ctaggctttc cgaaaacact    111120
     aggatgtcgt ccagataaac gaccactgaa tcgccgagga agtcgcgaag tgtctcattc    111180
     atcatcgtct ggaaggttgc tggtgcatta cacaacccga atggcatcac acgccattga    111240
     tatttgcccc agattgtgtt gaatgcggtc ttctcgaccg catcttccga gagtctcact    111300
     tgccagtatc ccgatgttaa gtcgatcttc gacaagtact tggctttccc aacaatatcc    111360
     agtaggtctt ggatacgggg aagcgggtag ccgttcttgg cagtgagttc atttagggcg    111420
     cggtaatcga tgcacatccg ccacgcccct caggcttctt gacaaatata actgggaatc    111480
     cccatggact cgaagacgtc tcgatcagtc cacgctccag caagtccgcg aattgccgct    111540
     tcaattccgc caatttgtcc gccggcaagg ggtaagcttg ccggttcacg ggatctgcgt    111600
     cccgtgtgtc aatgtaatgt tcgtatgacc tccttggagg catctctttg ggtagttctt    111660
     caggaaacac atcctgatat tcctggagca acttgaggat cctgggttca cttgaagaag    111720
     cttccggggt tgttgccttg gccgtacaga gtagcatctg tgtctgttgg tcgcgaaggg    111780
     cgcgtcggca atctttcttc gacagcaagt taagactgct gacggattta cgctccagga    111840
     tgcgcgtatc aatcccatga acctctgtac gcttatcccc aagccacatc ttccgttcag    111900
     gaaagctaac atattggcta tgttctttca ggaagtcgtt ccccagaatc acatcgtacc    111960
     cagcgatatc gatcgcccat actttcttcc tcccactcca ctcgccaaga tgcagattta    112020
     cggcacaact cccttgcgtg cgtaaggtct caccattagg gagggatact ggaagggatt    112080
     tctttttgtc ccatctcccg ccaacgcgct ttgcggtggc cagcgagacg aatgtgtggc    112140
     ttgctccaca atcaaggagc atccgcgcga caatggccgt ccgcgcttcg ggtcgctgga    112200
     ccttacgatc gaagtaggtc agctcatctc ccagggcgtt cagccgcata gaggcttgct    112260
     catccggcaa tggtaattct cccacttgcc cggcttcaac cctgctggat tggatatcca    112320
     tctcgacgtc atcgagtcga ggatcatcac tttcttcatc ctctaagagg tcttcaacct    112380
     gaacaggttg ggtctccatc tcgatatttg ccaatcgagg atccttattg ctgtcagatc    112440
     cggcgactct atccgcactt gctccgcttc cacgtcctta tttatccaaa gcatgcttcg    112500
     gatcgcccat ctgccttccc tccaggtgga gggaaccagc ttccgtactc gcctcaaaga    112560
     acacgatcgt cgtcctggat gtgggactat gtacatcgtg tctgtgccgc caggaagctg    112620
     agataccggc gaacagaacg tccacactag cagcatgtca tcgactggag cgctacattg    112680
     ctatgtcgaa gaaacagtgg ccaactattt cgatgaaata gtcctggtgt atgctattac    112740
     cataaaggct gtgcttactc gacaatgaac actcagcacg agagatataa atcactccat    112800
     ggatttcgta taggaaggag caatcaccct tgtttggaat tacaacagta gtgagaaagt    112860
     tccaaagtca aaggtgaaca ttcgagcatg gtcgtggtgc ctctgagcag gcccagctac    112920
     acagtttcgt ccttgtcatt ctaaaccagg ggcatggccc atgtggcctg caaaatattg    112980
     cggacagtgt ataagaattc acggtactat gcgcgttccc atagagagat aggacagggt    113040
     aggaaggggc tctggcactg aaattttctt agctcagtaa aatatacctg gtggggtttg    113100
     attgaatcgg tggtcgaaaa cagtgtgatc tgtggaggga agcgtccgat ctgctttcga    113160
     cccacacccg agtcacaagg aaatttaagt ttgacacaga ctgcggaacc acgagcggga    113220
     ctgccgatca gtagcggaac cgcaaatcat ttcgaaagct cgtttgggtg aaccatggaa    113280
     atgcttgcac ggtgagagaa tgcggctgta attaagaatt caagcctggg tttctgccta    113340
     ctttctttct gggttgctcg tgattaagcc ttgcagcccg aaggaaaaga gaactagagc    113400
     agaatcacca caatctccgt cggctggtat gtaggataaa tttatttcgg taaggccaat    113460
     attttattag agattttcat taaattcagt atcatgatca agatgtgcag attgattgaa    113520
     ataaagttta gggccgcagg agggccggtc cacattgaaa tcttgtccgg ggccaatcgg    113580
     ttttagtaaa agggaggcat tttatttaag ctcatgtggt tagtccataa atggcatagt    113640
     tctttacaag ccgtctgcta gagttattga aatagcggta gatttgaaga gatggagagg    113700
     aagtgttgtt atggcctaaa gagagcaata atcatggggg aaaaggctta ttgcaggaga    113760
     agatacgtag cttctagaac gttctacaga ccagataggc aaagttctgc ttgccacttg    113820
     acaggggaat ttactttctc ttcactgcga ccaagtgaac acaaccacgg atcgagttgt    113880
     agcctaccat tctgtcgcca aagtctgctg ttattccaaa tactcgcccg ccccagtacc    113940
     tcctaggcaa caaagtcccg ttccatcgga cactgatggc aaaatctttg ggcttgtgga    114000
     tcgtgtctgg acctttgcaa ttctttccaa tttctctccg ggccacaatt agaacctcct    114060
     tgatctactg tcccctgggt cgtcgctgag atctgtatcg cagaacccta cctgcatctg    114120
     tctgaattca cgcgtggtgt ttgattggcc ggtcgggtgc ttttcgtctc cagggtctcg    114180
     tcagtgtaat agtagcgttg caatcttgcg agggggtggc gatctcgaga acctagctcg    114240
     tgggccttgg ttgcatcagt tcacatggtt gtcctggaaa ctagacccag tttcttgtct    114300
     gagcttttca aaggtctggg ccctttggga agccaggaga tgcgaccccg gacaaaatct    114360
     cggagggaag tgaggttgcg aagaggataa ccgacccttt ggcatagata ctggaggaga    114420
     atagagagaa ggagtcagcc catgatgcga cacatgaatc tcaagataat acgaggcacc    114480
     catctacata ccccgtgaat atttgaagag ccctataccg gcctaggcat ccatcgacca    114540
     ggatggaggt cggtagcggg agaatattca ccagcacggt gaacgccaga ttcaccatag    114600
     tcgctcgaga tttgcctaga cccattgctc ccgggactaa gtcattcggt ctattctgca    114660
     gatagttttc tggggttgtg tttcgtcagc ggaggcagtg cccatggcgc tgagacttgg    114720
     agagcatata ctgacgaaaa agagtttgcg ttccatagta tgagaatcgc gcggccattc    114780
     ctatagtggc cgccaaccag actcgcatgg gaagaggctc tgacacatgc gtaagttaca    114840
     aatctcgtcg tcggacgcca gactgccccc tggagcgggg gccgtaaccc cagactcaat    114900
     tttaacttca acctttccta cggctcatcc atggcggggt ttcttttgtt ttggaaaccc    114960
     tggacgtgag tttgtttcag ggattaagga gattggaaat ccgaatatag gcaagagagc    115020
     aagatcggtg ctagctcgat gaaggtttat cggcatgata tcggagtcga agccggagtt    115080
     cggagtattg acacatcatc gatgccgaga aagctccgta aaatgacgag gagagattta    115140
     acttccagac actctgactg gtatccattt caaggagagg aaagctgtaa cgtatcagca    115200
     ccaaatccca gcgacaatgc ctcatgaagt gtgtatattg attgatgaca ctcaaaatgg    115260
     tagtgtagac tcttctcccg atgagccact agaactctgt gcctgacatt tcacagtcca    115320
     cgtggagatt gtagctacca gtcttgagcc gctgcaaagg ggagacataa atgagtgcag    115380
     tgtgctaacg gctttggtgc agcctttgag acgggaggta atcgataaaa tccgaggctt    115440
     gtttccaatt acccgatcaa tgctggtgat ggatgccggc tcggacacac ccgtcaaggc    115500
     cacactggac ccagccaata ttagctccat ctgcacatgt gtgggcgatc aaaaaggcca    115560
     gcaaaccgtc ctttttatca tcgccaaccg agaagggtat gtggttcgca gtgacctatt    115620
     ccaggatcga ctgcgcggtt gcccagggat ccagaaggtg gtcagcctcg tcagcccccg    115680
     gcaattcgtc ggttttcttc cagccacggc ccatggtttg gcaaaactcg tcgggttggc    115740
     cgtttgctgc atcctggccg atggtatgga cgcagcctcc tattgacagc tgtcagatca    115800
     catgcaattg cggctgcgag agaggctctc attgcagtga cagtcaccgg cgacaattcc    115860
     cctacacagg cttgccgtgg tcggtgaggt ccgcccggct catctctctt cgcgattctt    115920
     ccaggccgct cgagccttgg gggtcgagtt agtagcccta gggccccgcg gccattggct    115980
     acaggatcca gaatcgcgga acgacccaga ccgagaagtc tttattgaat tggatctgac    116040
     ggtggatcct ggccttccgc atcggattgt gactactatt caagactacg ctggcgaaat    116100
     cgatggacta agtacagtga ctgaatatct tcttatacct gtcgcgcaag ccgccgagcg    116160
     actgggtctc cccacctcac catccatgtc gtttagcaag tccgtcaata agtaccagac    116220
     gcgcttagag gacagcccga gctcctgccg tctggtctcg ggtctggatg cttttcaatc    116280
     tcagctagca tatgaggagg aaggaatact tcctccgggc ccgccgtgga ttgtcaagcc    116340
     ctgcaatggc tggcattgtc taggggccac caaggtagcc acgaaggagg ggctagtggc    116400
     ggctgtggag agagtcgcca aatatgccgc ctacagccga gatggaccaa atgcagaaga    116460
     tcctcaatgg cagaccaacg tgttgattga ggagtactgc gatggactgg aagtcgactg    116520
     taatttcgtc ctatgggacg gtcagatcct cttcttcgag gtgattggta actttccgtg    116580
     tgccggtgac accgtggcag agggcatgca aaccacggag aatttcaaag aaacacagct    116640
     agtgttttcc tcggctctgc caccatcgga gctgtacacg ctgaaatcct ctctttacga    116700
     cgctattacg cgtctgggct tccgctccgg ggtcttccat gtcgaggctc gggtgggtga    116760
     ttcgagtaat cggtaccgag ccgcggaaga cgacgagacg ctggacttgc gtcccagacc    116820
     gaagcctgcg gcacgccgtg cgacagtctt cctgattgag accaacgcca gacctccagg    116880
     ctatgtggat acctgcgcca gttactatgc aaatggggtt gatctgtttg cgctccaaat    116940
     cctgatcgca ctcggagacg aatcaggtca cgagccttgt cccagccatt ccattctcgt    117000
     ccccacgttg tggtctcagc gatccaagca acaaaggccg ggattatcgc gtcggaagac    117060
     ccttggaaag atattgtcca gaagaatccc acgttgatgc gcagtgtggt gcatcatgtc    117120
     atgagttttg gcgagggtca tcggatccag aatccgcggt tagacactac accatggctt    117180
     tcagcgttta ctacatactc actaaagaat cgtgcggacg cattgagatt atgttcacag    117240
     gttaagagag agtctgagtg tgaaattgtt taggtagact gagccttgct tatttgcgcc    117300
     cttccattgc gaaccctcca aagtaaaaca aagttcttcg aaagtcttaa atcttcttta    117360
     acgaggtcat cttcgtttct ttcaacactg catttgacca aaagatgccc caaaatctgt    117420
     attctggagc agttgaatcc catccatatc caaggaaaaa agcctatcga agtcgacgtc    117480
     gaagttgcgc tcagaatctc tataaggcgc gggaatcttc aaccgcggct ccaggatctc    117540
     atctagaata cgagtgaaaa cagctgcagt ccggttaaag taagtagagc tttcctgttc    117600
     aggacgggcc gtgagctcca gatgcgagat gaacacactc aggttgcgaa tgagagacgc    117660
     ttgggatccc gagtagagca tcggccggcc tgtctgggcc tgtttttgca atgctcgaat    117720
     taatacgctg gcgcctggaa tcccataaag aagaagctag ccagactcgt acgttagtgt    117780
     aagtaaatat ccacgggttt gaaagagacg ctcactatcc aggtgaggtc gcgttgaatg    117840
     gcaaccgatt gctcccactg tcggcccaag atcaagacgg tggagagtat cgttgcactc    117900
     agtcaaggtg ggaggcaccc gtttctcctg agtccttgct caaaaggctc tggaccagta    117960
     actcattata taggtaggcc aagtaagaga tgagaagcat caatttcaca ctggcaggca    118020
     gatctgttcc ccagcaccct agtgtgtaat gaagatgctc gggcagcgaa atccaggctt    118080
     cattgtagcg acgagataca gtcctaacag gcagtcgatg agtatgacaa cacaaccgct    118140
     tgtgctcgga catcggtagt aaacttacat caatagatcg gtccgttccg ggcttgactt    118200
     ctgcaaagaa agctccgagt tttcttctcg aaatgtgccg acgatgaatc acaatcgtat    118260
     ccaggtcgct ctttggtaag cctttcccat attccacccc tggggatcca gggaggtctg    118320
     agcagcatcc agaatctcgg ggtctcctgt tagtacatga tcgccaatgt cgagcgggag    118380
     acaacaatct gagtgtcgcc atgaaatttg tggcggacgt ccaagaaagg tcgcaatacc    118440
     tttatcgaat tgataggcgg ccgcgaagag ccttcgtcga gattctagaa tgaagagcgg    118500
     cagtgccgtc gagctagtcg tgtctctatg cacgcccaat tcaaatatat tcgtcgcgaa    118560
     ctcaccaaga cgctgccagg tgatcgaacc tagaataagc tccccgtcag tggtgactgc    118620
     ctttgagcgg aatccgaaaa tgggacccac tggaatcact gaacaataaa ctcgtccgca    118680
     actcttactt ttccgccctc cagccataat ggaaagttac tcttgaccag aatagccatt    118740
     ccctacgttt aacccatagc atgttcgcgt tcccgctcgt caaagatacg ggggcgttac    118800
     taaatgcgcg ctggcattgg acgacgcgcg tgaactgctg gatctgttgc tcggtggccg    118860
     atgggccatg cggtgtccta cgaccactac gattgaccgg tgcgacccag caatgccggt    118920
     cacgccagtg cttacgtata gtcctagctt tcctagcgat aaatcgataa tactgggtct    118980
     tctcacataa aatgtaatct agatgaatcg gtaaattggc gatcgggctc gttaccgcgg    119040
     tcggagcttg ccattcgtta cattgttccg tacggtccca acgttggatg atatcgccga    119100
     ttcggccggc gtatgtaaat gacctttcgt ggttttgcat tagaagcctt gaacccgatt    119160
     gggtcccaga cataaatcga cgttgtggcc cggcccatct gcggccacta aagtctaact    119220
     atttcaagca ctttacgcat cttaaccaag acgctcaaaa taggaaatct ttctagattt    119280
     ccgctctttt acggtatcct ttatattaat aggccgagat tgcggtgatt ttgccccgat    119340
     tctcgtgact tttctcgtga gctactatag aggcttaatc acgagcaacc aagaaagcaa    119400
     gtggggcaga agcctgtaga taaactttcg attatgttcg agcccaaaac cttcataaca    119460
     accgcattct tttccgatca ggcggttcca tagctcatcg aaactcattt gcgaaagatt    119520
     tagaggttaa ctactaatcg gcggaatcat agttccccgg tatttgtgaa gttaactttt    119580
     ccctacaact taagtcaaag ggtcctatca ttattatttg gcaggggaaa actatgcatc    119640
     acgccaaaca ttggtagtgc atgcatcgaa aatcaactgc aagcctcaac cttaacacta    119700
     gagagaactt ttcttccgac ccacccatcc aattctgtct aattcccccg ccgccttcac    119760
     cattagcaat actgtacgca tctaattcgc gttccctaac caaatctcgt tttgtttcgt    119820
     tttatacgcg ttattcttgc tacttgtttg cgatccttca gaatgtctga cttacagttg    119880
     agagaggatt cgaaccaccg tggatcgcgt cccaatccac cacctccgac tggcccgcaa    119940
     caccctcccc aacctccgtc cccagggctt caaaccgctt aacgacccct tcccgatcac    120000
     ccttacccat ctcctgaatc accttaatct tgacctgcaa acgcccaact cgaatctcaa    120060
     taccgataat attcttcttc agcatttcaa cttaagagtc tggcgcctcg ggccccgtcc    120120
     tcccctctct tcccttcggg gttagactcc agtcacctcg atgcctcctt gtggtgccag    120180
     gaggatggca tcaatctttc tctttctgta gggcaacacc gaacaaggcc gatcaattcc    120240
     aggcaaaaag agtcggaagg tccagggtct tcggagtatc ggcgttcgac cccgccgaaa    120300
     acgccagtct ggaatgcgac ctggctagtc atcgacccta cgagaagaca tagagagtgg    120360
     acatatagta cacagtttgt tttacattca gacaaggaga aagagactgg aacgaaaaga    120420
     aatccggttg ttgcttagcg ctaaaagata gtgtaacttc gaccttttcg aacctttcac    120480
     tcgaaatctc ccaagctaaa aaaacacccc atctaactag aatctcagat tgatatcagc    120540
     gccgcattcg accaacgcct cgaccatcga agcgtgcccg ttttgaactg caaggtgcat    120600
     ggcggtcagc ccgtgtccat ccgccatgga caccgtcgcc gccgcaccat gcatgagcaa    120660
     caagcgtcct acccttgcgt atcccagagc ggcagccacg tgaagaggcg tgcgtccgtc    120720
     gttatcctga gcttttacgt ctgcaacatg agccagcaac accgaaacta tatcttcgct    120780
     attcataatc acgccctgat gcaacaaagt tcggccgaaa gcctgcccat tgcatgccct    120840
     agcgttcgat tcaatctccg atgacgggga gaggaggttc ggatcaagcg gaaacgacgt    120900
     gtctgaagga gggacggcct ttgttcacag attggttttt cgtaaattca gaagacgagg    120960
     gaagagagag acaagggaag ggtaattacc actgaaaagt gctcctcgac tcgagagctc    121020
     actgttgaag agtctccatc gtgtactgtt gacggggaac tgtataccct cttggcatat    121080
     cctgccgagg gaaggaaccg gtgagagaga ggatcattag gttccgtgga cggtgggtct    121140
     atcggttgat cgacttcgac ttctggaaaa aggcttggta atatcgattg agggtgcata    121200
     caagggttta caccggctga tggcaatggg caaaattttt gttggccgga ccgtaggtct    121260
     gccaaatgtg ttgaggggtt ggtgtcattt cctgggtgtt gaagactttg tcgcagccga    121320
     tcatactttt ccaattgctg cttgacagac tcacctgcag atcccagatg aggtttgcta    121380
     acgaggtgaa atggagccaa gagcgaaaat aacaggagaa ctcacgatgt ttacgctgtg    121440
     cctgccgatt gcgttcccgt cgctggtctt ccttggacat ttgaacaagg acccgcctcg    121500
     ctggacggat cggtgtttga gggtatccag acccaggaag atcagggaat ttggatgagg    121560
     gcatcgccat tatcactcga gtggtggctt ctttattcga atatgaccgg aatgattcct    121620
     atgctgtccg gcgcggatgg ccgagcaatg acgagaacaa acagtggtta gcactttcct    121680
     gggcttaagt cgggagaaac ctgttcttag aaggatttta tggtatgtcc taacagccga    121740
     gggccttgtg ctgcggccgc cttgctagat tctccaggcg tggtgctatt ggagcatcta    121800
     atacccactt cattaacaag caccgttact tccactcgac gagatgaatt ctttccaagg    121860
     agatatgggt gggagcctcg gtgtacgaag ccaaagtaca ggaaccatcg gtaaatggta    121920
     ccttttttta cccgggtagg catggactat cgccccgttg tccgatccgc gcagaggtta    121980
     gtaccccatc caccaacagc cctacgatgg aaaatgcaaa atctgaccga tctggtgtga    122040
     tacgacgtca caaaccagga actgatgagg ggtcaacatc ttagctaacc aattatagac    122100
     tagccccatc tttcacgtgc gggctattgg gggcgggcaa ttatgccggt gcaagtgcga    122160
     cgtgcttttt gttaattgcc cttgcggccg cagcttttcg ccatccgaag gccagaatcg    122220
     taagtcacgc tttgaccaag aatttgtctc gtgaatattt actgtgttac tgtgtcttgg    122280
     tcctagagca tagacaaaat ataatgttac atttgatgtg aggttagtca tgttactctc    122340
     caacatctgg ccccataatg cgggtcccca attgtagttg gtgccccgcg cgatcaccct    122400
     ttaggttcac catgggtcgg agacccaaat actcacgcaa tattccctag tatggtcaca    122460
     cgcatttcaa cggcatatcc ttgcatcctc tgagacaagg ctagaaccac cttcggatag    122520
     gaaagttgcg aaaacctgtt cgcgccagtc tcatctgtct accattttcg atatcaacat    122580
     cagcccatct cctaacactc ggagaggcct acctacctag atacctagga actacatccc    122640
     gtagttcgaa actaccaatg aacaactaca accctgccag tttatctgtc tgataaatgt    122700
     tcgaataact atcgcgctcg gattttcttt tggcaattgc gcccatagcg ggtaacaaaa    122760
     tctcgggttc agtttagttc taccaatcaa gaagctcaat tctcaaccgc acgcgatgta    122820
     accggaccct ggcttagacc tgaattcttt ccttggtaat tatcttctcc aggaatcctt    122880
     gacttgctcg tgcttcggtt gaggcgttcc tggcccccag aaaaatacac aatggatgga    122940
     tgacgtcatt taccctaacc cctcgcagaa taacgtgata tgtgagaata caatggactt    123000
     ttgatcctca cgccttgttt ctcggtccat acttggaaag atgctaattc atgttgagat    123060
     acacagtaaa taatccttat ctactgtata aatagatctt tatcaatttt ggaacgaccg    123120
     ctttaggttt aatactgtat acactgtata aggaactcct atccaccgct agctcagcgc    123180
     cccccagtct tctcatcact aatatccaac agctattaga gtctctgcgg aatacggata    123240
     tttcatccca acctaacgct actttttatt cgcgatatga tagaaagcct gtcactattg    123300
     cacccacgtc ttgaaaggct gacacggctg gatataggaa cggaactaat tcaataatct    123360
     gcaaaaaaag ccctaggtac atatatttgc cttggctcgt atgacaaaaa aaggagcata    123420
     aatgcttcaa accttgataa actggaacga aacagggttt ccgttcagag gcttgcagtc    123480
     cgttccggtc tggtcttgat caggattgaa ggtgtcgacc tcttggccgg cggggcaatc    123540
     agccgcacca tagaaaacaa gcatgccgtc agcatctaga gccaaaagct ggagtccagc    123600
     accgccgttg ccgagaccat tgtggcaatc ttcgtcatca ccagagtaag ggatagcctc    123660
     gccggtacat tgaccattct gatagactgc gatgcggtaa tcatttccag ctcgagtatt    123720
     caaggcattg gtgttgttgc gctgttcgac gttcggaata gacgctcctt gcaccagggc    123780
     ggcgcttagg aagaagccga gggctaggtt ctggaatgat cccgagtaca tcctggtttg    123840
     cagatttgac tgacgataaa cggcactcca agagggtgac gctggttgat atgggcgtaa    123900
     gcggttctga gacgttgaga ccactgatcg gagttgtcga gatcgagact ttggaaatcc    123960
     tcgatacgca cacgaaaatc gtgatttgaa tcaggtactg gggtcaagta caagatgtcg    124020
     tattctgtgt cgtttcgatg ctcgaggata tcttgttgga tacgatcaac aaaccggacg    124080
     tcgagcgttc cagcgatctg cctttgcatt ttgtgtgaga cggaaattga ataaattgaa    124140
     tatgaagaca ggtagtcgaa agattccgag agtagatgca acggggatgg ggcaaccgtt    124200
     taatgtttga tgctaggggc ggtggtggca aatgtgacga taaggcataa ttccaggaaa    124260
     cttacctact tgctcagagt atgattgacc ttaatgaaca tgaatgcgcc aacaagacca    124320
     tgaacattga cgctcttata cccgaacatg tcgttccttc gatggcagac cgactgcaca    124380
     gtcatacgct agtcagcatg aagattaaag cagacattgt acattcctgc ttgaatgccc    124440
     agcttgcaat aggctgctaa tccgaagcac tagaccacag cgggacggtg ttcaccggta    124500
     cactcgttat gatcaggtta taaacgacgt cgatgactgt gcatgataat gacatcataa    124560
     caagttgttc cacagcaaag ctctcgatca ttgcgtggtc cgcaaattcc cctctgtatt    124620
     cctgataaca tcattctttg acggccttga gtcgaggaca ttggagttgc ctagaagcta    124680
     ttatcggttt tactcagggg accggtgggg caactcagcc tcgtgccccg atgtaaagtc    124740
     taaccaagct gagatgacca cccgggggag gagggggggc gcggcgggcg cggagagagc    124800
     acggttcttg gcccgtgact ggaccccgta atggaactgc gcagtacggt tggcgtaata    124860
     acgtaattgg ccaactttca taggcttgag cgagcctttc atgccagatc tagttagtca    124920
     actggagaga cttcctatgt agcggaaatc ctctgctgag tgggtctgat cagggcggat    124980
     catggtttct ctttcccaga gcataggata ctgcacgtga tctggtgaca gatctgtcgg    125040
     ttggctctcg gtggcccact gtgttcccgg tgggtcgcca tcgattggtg acgggtaggt    125100
     ccgtaataac cagctcaacg gttggcggtc caatattgat tttaacgacc gctattcacc    125160
     ccgttttact gtcggcattt gccgtagacc tataatacta ggttggattt aatcttatcg    125220
     atgcctagag gttggtggtc ctaagctgcc cggatcccgg gcagcccggg atccgggtca    125280
     acgcgctgac ctcccacgag ccccgactca tcgtaccaat catcatcgga gcagcccgca    125340
     tgtttcaacc tttcaagtaa gagaattgta actacttata atggatttta gcaacttgga    125400
     gcatattgct gtccgtgcgt tgctctaaga ataacccgta aaggtaccgg gctccctctt    125460
     cgttttccgt cttcgaaatt gcttgatgtt ctactatgcc acctaagagt ctacaacttt    125520
     attgacactt atttggtcac ggaactcaag gacctggcat ttaagaagtt cacagcggtt    125580
     gtgataaact taggaaagcc aaaaaatctg gataagcagc tcgcggttat tgattgttta    125640
     tcgttagcat ttccgaagtc gtccctccac gataagcttc ctagatagct aggtcagtac    125700
     gctgcttagt gcctagacaa tttacgtctt tagaccaagt ttcataaatt gcttcaggta    125760
     tttctatcac taagctatcg tataatagac actttgaacc cagctaataa ggctccttag    125820
     aatatcaaat gccctaaata ctatatccct cctacgatac tcgcacttgt tttaagggga    125880
     acgactacta agataaggga aagagggaga gtagaggagg gcattacaac ccttattatt    125940
     tcccgcgttt tcttttatct actttttgga ctagcccgaa tagctctagg atatatatat    126000
     aatgatttgg tgaatacaca gaagccgcta taagtaactt aactcgtcta ccgtatttat    126060
     accttatagc aaatccttta tcttccattt atccctacct agctatcatc cgatattaga    126120
     tagcttgatt accctatcta ctctcaccaa ggagaaaact cgttccgtct cgagcgcttt    126180
     ataaggctcg gatctataaa ataaatgact tcacggtatc taggtttcta gagcggagtt    126240
     taaccatagt gtagagcagt gcttaataca atatagacga ctcgatacta taagtctgcc    126300
     caccaattgc ggtttttata tcagctgtta gatatccagg actgactaga gcgtgtagaa    126360
     tccacgctgg ctggaaagcc tcgtcgaaac cgtacgtaag atctgcgtct tcgccgtctg    126420
     acttatcgac ttggaggaac tgtttggcct tttccaaaag taaagacact actttctgtc    126480
     ccagcctttc cgacgtagtt caagcgctgt aacatgaagc ttttcaacta ggaaagaggg    126540
     ccatgatcaa gctcgttccc ccatacagta gttcctctct gcactggatg gtccttgtac    126600
     ttggccttga ctgctcccga tcgatcaaag atatggaagg ccacatcgca cgtttcctcg    126660
     ctgggctctt ccatcctttc ccagaattca gagcgtatat cctctcgata aatataccgg    126720
     gctagagcgt tggcgacagt gataccatcg caagtgcatt tagcgacaaa gttttttatc    126780
     cacttgaaat cgtccattcc ctcatctgtc aaaaagagcc gaatctttag agttcgtgcc    126840
     ttattaccgg agatggtgta ctcgtgctct tcaatgtcct gttcacgatc caaacattcg    126900
     ctctcatctt cgctccacca ttcttcttcc tcggagttat cgaatccatg gtactcaaga    126960
     gtcatcttct gtcaattcat cgtatctggt ttctatccct gattgtcaaa gcaatatcag    127020
     tatagctcac atctcttatg tgttagtggg atgggaaggt gagcgcactg agggatcctc    127080
     ggtccctttc cattttctcc ccagtatttt ccattcttct tatcaacctt ggtccctggc    127140
     ctaattttgg ggcgagattt atgaggtagg agaagaaagg caggcgggcg gcgagacaaa    127200
     aagtgggatc agccaacaag ggagggaatc ttctacagtt gtacttagta acgcggtcgt    127260
     aaaaggtgac ttgaccatgg attccaaact catgtcgaaa gacttcatca tctcgcaacg    127320
     ccttgataac catttcaaca aaattatcca ccgtgtctcg ctcaaaattt cgaagggacg    127380
     cttccgaata aatcggcctg ttctggatat tcgtaacgac ataatctatt tgggtatcag    127440
     aagggaagag ggggcgcgag gtaaaggcag ccgtgcggtc gaatttcctc cagacttgct    127500
     cctggagctg agggaaatca agccaatgga ctatgcgctt ggggtaaagt ctgttcactg    127560
     ggtcggtcgc atcgccctga gtcgtgaggg tcgcatccgt ctcaactcgg atcgcttgag    127620
     atagagtgtt tggttggagt cgccgttcag cctctccctg gaggcgctct gcttcttctc    127680
     gcgcctttct ctcttttcct agcgcctgtc tctccccctc aagttgacgt cgtagctccg    127740
     cgattgtttc ttccatcgct tgttgaaatc actatacagc agataatcga ctgatgcaaa    127800
     tggaagtcaa tatagtaggg gttcgctgtc tggcggcggg gagtggcccg tcagggcgga    127860
     atgcgtccag atgtttacca gcttactcac ccccttggct cgagtcgatt catgcctcag    127920
     gcacggatga catcaacatg cttttggtct ttcggtaggc tgacgctcag aggtcctttt    127980
     gtttcgtcgt atagagtact agtgaaagtt ctcccgtctc gtccgagggc tcggaatgga    128040
     gaggaggtgg ttcttgcagg ttgaaatcat ttcttgccag agactggggg tgcgagggta    128100
     ttatggaatg cacggatctg cgctttaggt ggggaagggg ctctcaacta gccaattttt    128160
     ttagtcctgc tcggatatgg gcttcgtccc cactactacg gaggtgaacc cgatcgctag    128220
     aacctcggct ccatcttcac ctagcaccat tcggaagccc aacagtcagc ggccaacaac    128280
     gaccgccacc cagctcaata acgcgcggaa ggtcagacaa tcacccatta ttcgggcgca    128340
     gcgcaaacgc agcactttgg ctaccatttc ggaggaattc tacaatagcc ttacccaggg    128400
     gatcaactcc acaaagccgc aaaatcagga tatccgctcc ctctaggtca gcagcaataa    128460
     gggttctggc taggactcgg tgtcccccga gccattatca gaaccgatga tgccccctcc    128520
     tactcttcct ccccctcgga tctctcctgt aattgctccc catgttaaag attcttcgcc    128580
     tagcactgcg gccacccctg cgcttttgat acgcatacag cggaatcaac attcgcaaga    128640
     ccccgtaggc cagttccgcg gtcaagcaca gctcgcgggg cctgagtgcc cagatggagt    128700
     aatggaagat ataccactta tagaggcggc cgctcctttg cagctgcgtc cgaaacccaa    128760
     ccgtatcgat accgctgtac ggaatccgtc ggtctctaca aatgggacac ctttcttgga    128820
     tccttcgtct gcgacgtacg ataaacctcc cagtgcctct ctagctccta gtccccgcac    128880
     agatgcaata ccgccttcca gtgggccggt tcctcgaaaa tcagaatcca gaactgcgtc    128940
     taatcggaaa cgagccagta tgagttccac tcaggctagt ccacagttac ggcccaagat    129000
     tagtcccagc atccagcccc ttataaaagg cagcgatggt gagtcttgaa tccgaattga    129060
     attccatggc tgttgtacta actatatact agacatgtca taggatatgc tttacctagc    129120
     atcgaaatct aactatcaac acattctcaa tggcactctg ccatcgggcg tgagctgccc    129180
     agaggcccta gcagagaaat ctgagctcaa agcggacgaa tcacaagctc gcatagcagg    129240
     gacgccggaa tcgaatcaac aatacgctca agaaggttga gcttctcgtt ccgcaggagt    129300
     ttatcgatga ccgcaatgct aaggaagctg cagaagcctg tagaaaggtc aacgagaagg    129360
     aaaaagagaa agaaaaggct aaccaggcca tcagcaaggc cacccctgtg gagatagcca    129420
     ttgattacat caaggccctg aaaaaaaact tagacacaac cactgctaag ttggctgccg    129480
     tcgaggccaa gttttcgggc gagccctcta cggagagctc aacctcaact tccgcttaac    129540
     ctgaggagac tccgaaaggt gtcgccaact ctgaaacgaa gagttcggcg tgatcagact    129600
     atattacctt aataagacca gatcttctgc ttgcccgcat agtgatgcaa tctatgcaac    129660
     ggtggaagat cgaaaaacgg gatattccct ttccggggtg gaggtttcgc gcaattgtgt    129720
     tatggatcca tgatctaatg gggttttctt tctgtttatt tttataacgt gatttgatag    129780
     cgccggtgtt tgaactacga gggtggctca tttttgcttg tactagttct atttttacta    129840
     tgtctaccta cttgataacc actgccagtt cttcaatttt cctttcttat cttcatctta    129900
     gatcgatttt agatgcatga ccctagtatt tgcttatcat catgttccat ttaagatcgt    129960
     gcccatgaag tcaattgact gtatgcggaa tcagaatcgg gagtttgcgt ctgctccgta    130020
     ctcaattaat aacctgacaa aaggagcttt ttggttctgc accgccagat gaataggcgt    130080
     caacccatct ttatctgtcg aggagatcgt cctatccgcc ccgtttgaca gcagcatatt    130140
     cccagactct acatgaccag caagggcagc gtagtgtagt ggagtctgac catttctatc    130200
     ttgtgcttgc acatcagcgc cgtgtttcag cagggtggaa atcagctttc cgttatcaag    130260
     gagcacggct tgatgaagga gggaactgcc agaaagtgac tgctttcgaa ccgatagaga    130320
     gctttcaact agctctgttc gatcggtgca gttatctgaa ggagaagcct taggtagtgt    130380
     taatagttgg tctagcaatt tggtggattt taccctcact ctctgatgtg tcttgtgcgg    130440
     accatgaccg gttaccgaga acggaagact atacccccac ggggtgagct ccgatcccat    130500
     gtcgagctcc aaaggaaagt atgcttcgtt gtttggaggg gatatatgag gttttgcggg    130560
     tgtgactgtg acttccggag gaatgccgca cgggcttggg agcagatctc tcgttgtgag    130620
     aacatttggg ccttcggcgt gagagccgcc aacattcaag cttttacttt gtttcgtgac    130680
     cctgagccct tcttgtatgt tggcattttg aagaagatat tcatcttgtc gcaagcggtg    130740
     tttgacggat tctcctacgg aaagacgaaa tcgattagtt atattttgat atgaataaac    130800
     gcgtatgtgt taacagaact atacgatgca tagaagagtg acttaatttt aggtattctc    130860
     acggtagttc cgctgtgata cgcaattttt cgcgcgccgt tgctcttctg tgaggtcccg    130920
     aaccgatgtg tgaggccctt tagtaatttt tccacgagga tgatgcatcg tgtttttcgc    130980
     tcagaattgt aaagctgcta tggtaaaaac tgacttataa aaccccaatg cgatgaatgc    131040
     gctcgtggta aaagaaaagg gttgcatcct gttattcttc tggggcggct gagcaaggtc    131100
     ttagcgaaaa gcatgtgcta gtcaagttgg gagtagttgc ttctttttct ctagtgccat    131160
     taatctgcgg gaaaatatag atcccctcag agaataaaaa gggctaagct gggatttggg    131220
     ttacattgca gggattgagc cgtcttgatt gctgaaacag tgcccctcta ctccaacttg    131280
     agccggacat tttcaagaca ggtccacaag ctgccagtta taagatggtt attcaagcat    131340
     cttttagaca gtaagtaaac agataagatc gtgttgtctc gaacaaaggt aattcgtaga    131400
     agactagttg cttggccatc attacacggt ttgtgtggca agtatcatac catattggtc    131460
     gggtctcacc cctggtggat aaaattcagt ttggctcggg gggcgaaaaa ggtaccaaga    131520
     gcggatacca atatagttaa ggcatgtact ttggctccga ggggacaatc aagtgtgctt    131580
     ccgagtggac ttgcatcgac cagaatttgt gagaattcgc atgcctgttc tgtcatgtcc    131640
     tattgcgata ggctcttggt gcctaggctc ctatccctcc ttaaggactc atcgcgttgg    131700
     gtgaatgtaa ctaaaggtgt caataaagtg agtactgtac tgggtgatgc tccaataaca    131760
     cccgctcctg gagaatctag caagggagcc acagcaacga ggcgtcagcg gccagaatca    131820
     tacacgtaca attccactaa tcaccaaatt ccccgccttg acccgccggg aaagcgatag    131880
     ccacttgttc ccctcatcat tgctcggtca tttgcgccgg gaagatgatc gttgccgata    131940
     atgtgcctag gtataaatag tataaatagt ataaatggta taacctaccc taacagacaa    132000
     agattcagga gcagcactgg atccgttctg gtgataatcg aacaaaggga gcctctacta    132060
     gagtgataac cgtgatgcat tcgtccaggt tcccagacct tccggggtct ggatacccac    132120
     agatgtcgac cttagcgagg gagatcccta tccaattgtc caagaaagac caacaacgag    132180
     aacgcaatcg acaagcacag cgtaagcatc gtgagttctt cttcttttcg acttttcgtg    132240
     aaagagacct catcgagaat ctctaggtga atctgtcaag cagcagttgg aaaagtttga    132300
     tcggctacga caatgtctcc aagacctaga tagtggccct aaagcctcga aggatctggc    132360
     aaacctaccg ttagatgaac agcaaaattg cccgtcgcca tcggctggtg aaaattcctc    132420
     tatacccgtt caatcgatat taccaagcgt cttaccggaa gtcgatgagc ccataaactc    132480
     acagtgcaga gacccaatta atatactcac tcgcccattc attgcctcaa ctggatatac    132540
     caatggattg tgcagtcaac tatcaaaatc acacgatgga gactcttcgc tagcgagctc    132600
     tcgagtcgag gagcactatt taatggtaag cccccttccc ttctccctct tttcccacaa    132660
     cttctgattt cactagaagg ctgatttgat ttaaaaaaag gctttccctc caccagatac    132720
     atcgttttcg ctggacccaa accactgccc tccgctagag ttagaatcga acaccagggc    132780
     atgcaattgg cgggctcccg gtcggacttt gttgcaccag ggcgtgttta tggatagcga    132840
     agacatagtt ttggtgttgc tggctcaggt tgcagatgtg gaagctcggg accatgacgg    132900
     acggacacct cttcacctgg ctgccgctct aggacacgca aggatagggc gtttgttgct    132960
     catgcatggt gctgcggcga cgctgtccct ggaggataga catggactga ccgccatgca    133020
     tcttgcggtt cagaacggcc atgcgccgat agttgaggat ttggtagagt tcggcgctga    133080
     tgtcaatttg caattctaag tagatggtag tgtgagggat tcggagtggg aagttcaaaa    133140
     acagtcgaag ttgaatgata atttagcatc gagcgacaat caggtttctt tccatcttgc    133200
     ctctgatgta tcgcccggtc acaaattcct atttccgcag ataaactcaa gttgctcact    133260
     atgactcgga cgaaagaact tgttgacttg tctcaatata tgtatttctc gctccatatt    133320
     tggatctagt tatgtagctg cgcagtcaag gctggtagag tataacagga ttcttgggga    133380
     tcagctatcc acaatgcatt atcgcggttg cttgcctggg ttcaggtaga tgcagactta    133440
     aggagttctt gtaccatgtg tatgtaggtt gtattattga tggagttatg tgggtcacga    133500
     cccagtatta catatagata caggtctaac cctaatgcat gagtagtgcg tatcagggtg    133560
     acaggacaat accatcggta caggggatcc aacaggagtc tagttataat cgcggattgg    133620
     aagaacgttg atccagtact tcacaacacc gagaatcccc ttggcattgg cacccaccac    133680
     cttcacatat ttggctttgc ctttgagacc atcaatacga gcgccctggt agtgaaaaca    133740
     aaagacatta ttgattgaaa gaaagagggg gcgaacagat aagcgcatga gttgcataac    133800
     atcaagaaat gtctccggtt tcaaatatac aagtcttgtc cctgctaata ccgtgacagg    133860
     cattctcggc gtcggaacgg aaagcttgct tcctgtgagc cttgccgcaa agataaagtg    133920
     cggtgcgacc atgcccagcc tgtgtgtaaa cgttgccaga aacggggatt caccggtcgg    133980
     tgtttctacc atcctgcacc gttgaccagc accagaagac aaccagatag ggatggtcaa    134040
     attcacttgt atgtccgcaa ttgcccgcag taggaatatc aactgagcgc aaaaaaattt    134100
     ataggtcacc ttcgccttcc ttgggaaacc tgggcaaccc catgtctgac tctgaaacgc    134160
     ttgacgctgt ggcaccatgc ccgtctgtta tccagccagc acttcgaact gaacagatgc    134220
     tgccagcagg gtacttgggt ccgacaagct tcatcgcggg gcttgaggag agcgttgatc    134280
     tttttaccca tggtgaacaa tccaatacag atggacgaga gaattcagcc atagctccat    134340
     ctcccgcgtt agtcaagagg accgcagagg ttcttcgctg cttgcaacat ttccctgcta    134400
     ttaaaaacct ggtccataaa tactacagcg tctctcaaac cgctgtcatc ccgtcaccat    134460
     ttatcctcaa cgcgctggac gagctggagg tcactgttaa cggaagcttg tttgggtcag    134520
     cgtccgatga acgactgttt acattcagca cattcgtaac acacaatact agcaaggcct    134580
     tgcagatccc acagaatagc gacgggacag tgtttcacaa atattttact ggaccttttc    134640
     ttcgcttgga gatcattgga gttatatgcg ctctagcagg ccgggccagc tacttcgggc    134700
     tagccgacag tacggttggc gataccgagt caccaaccca attctctcgc aaaatgttgg    134760
     ttatatgtga tctcactata catatatgca agagtctaac ggctttgaat gatctttctc    134820
     tctggcttgt ccacgaaaac ctcctcttgt cgaagctgct tcggggtgat tctagtcagt    134880
     catatttact aaccctacac gaatcccacc gctgacgaga tgttctacag gttcagtgac    134940
     atggaaccgc ctaggtgaac ttgccacggg tatatttgag tttggtgcgc atagggacac    135000
     ccctagctta gtaccgcttt tcattcttga atcccgacgg cggctctttg cagcttccta    135060
     tcagctcgat aaaagtattg cgactttcct tggacgaccg cctcgcattt catggaggca    135120
     ctctgattgc cttcttcctc ttgatatcag cgatgaggat ttagctggtc acccccatac    135180
     actggaggct gcccggcgct ctttagatgc taatggatgg aatataaaaa aagtctatca    135240
     gccagcatct tggatacgac tacgatttat tatcagtaca ttccgagaag agattctgga    135300
     gctgtccctt caaaagttaa gtccgaatag aacggaaaaa ttgcggtagg ttgaagtcga    135360
     tgtctgcctg gagtcatttt tgtctacttg atgctgatta ttagtactag tgaggtttcc    135420
     agtcgctgcc accaggcttg gggtttgtta cctgaacatc tccaatatac ctctagttgt    135480
     tgggagtccg accttcctat aggagtgaag ttgatatcga tcatttctta tatcgcctat    135540
     ctttacaatg agttctcaat ccagagccta ttgtaccagg attctaaaag aacggattct    135600
     gcgctactag acgtcagctc tgaaatcctc tccactatat tgaccctggg ccgacagtgg    135660
     gagcgatctg ttgacatcaa gggtgacttc acttggatcg tgagtagatt ttggctacct    135720
     aatggatctc aacttatctt cttttttagg ctcttgttta tgggttttca tgcgccgggg    135780
     ttttgatccg agcaatgcag gagcaagctc gaacgggcca gccattattg tattctggat    135840
     ctcgatcctc cctcattcgc aacctaagcg tctttatctc gcacctagag tccatggccg    135900
     gtccggaaca ggcgacatct ccattgttca tccgtgcaac gtcggtcttc tcgagtatta    135960
     tcgatggaat attggagccg agacgagaag ttcccgtcaa cagtactaac cccgatacta    136020
     tattgaattc tgatattgaa acgcccttcc tttttgatct tcaggggatg gacttgtttg    136080
     agactcaaga ttttcgagtt gcctttgatg atatgcttta ctaaagaagg ctgtgagctc    136140
     ctagcaaccc atttagagac ttttgcaatt tcctacaaac agccactttg ctctcaaatt    136200
     cattatgttt tcttcgcaga gtcttcagcg agatgccctt cgcttcactc tgacactgtc    136260
     aggtgatgat taggaccagg agttataaat aaactatata taactgtaac ctcaacaatt    136320
     tctttattaa ttctttcatc aatttatcta ctttgttacc atgccaggca ccataccaag    136380
     cgatagaagg caccgagtcc cttagacgtg gacgtaggaa gacgctaccg aaatttcaga    136440
     taggagggat cgatgtagca caaccctgta aaactacata tgtacgcagg gagagggaga    136500
     gagaacgctg acagaaattg gtcaagtctt cttcctaatc aatcttgcac tcgaaatcgt    136560
     ccttgacctg gtcgcatatg ctcaacgtct ctgcacgact tgtaagtgag tacactgtga    136620
     acgcggcaag ccatggcgtt gtgctgagct gtgggtcttc gataatgtcg ccttttccga    136680
     aattcatgat aggatccatc acacgggaca tgagggttgg acttctttcc gcaaggtctt    136740
     tccacggatc atcagaggca accacaccgg acttttctgc ttgaatggct gatatcgcga    136800
     catgacgacg agcctgatga ggttgcgaca aggcgcgaag cctatattcg tccctaagtg    136860
     cgatcagaat gtgaagtgcg aacaaatcga ccccatttgt ataagcagta gcacatgtgt    136920
     ctacatagcc tggcggtctg gcgttaatct caatgagaaa cacgctggca tcatgggcgg    136980
     ggtggatagg gttgggacgc aaatccaggg gttccccgtc gcctcctggc tggtattgat    137040
     gactggaatt ccgcacccga gcctccacgt ggaaaacgcc ggagcggaat ccaaggcgca    137100
     atatagcttg atgtagagcc ttctgaagag tagcaacttc tgacggtgga agagtagagg    137160
     ggaacacatt tagggtctct ttgaagttgt cggaatctgc gttaccttca ctcgactcag    137220
     cggtgcaagg aaaattatcg atcacctcaa aaaatatgat ctcgccgcgc aataagacaa    137280
     aattgcagtc tacctctggc ccgtcgcaat actcttcaat cagaacatcg gtctgccatc    137340
     cagagtcttt tgagatttcc ccggttctgg aaaatgcggt ctgccttgac actttcccca    137400
     cggcttcgat cagtccctgc aaggtagtaa ccttatggac gcccagacta tgccagccaa    137460
     agcagggttt gacaatccac ggcgggccgg gaggaagcgc atttctctcg tttgatgtta    137520
     tttgtgagat gaggccatcg aggctagaga ccaaacggca tgagtctgga ctgagttccg    137580
     aacgcgtgtt gtgcttattg acagatttgg caaaagactc agatggagat gttggcagac    137640
     cgaggcactc tgctgcttga gcgaccggaa tgagcaggaa ttcagtcact gtggtcaatc    137700
     catggatggg gcggttgtag ccttggatgg cgttactgat gcgacgcgaa agtccgtcgt    137760
     ccgccgtcat gtcgatttca ataaaagctt ctctgggggc tagctttaca gctcctcctt    137820
     ttcccagcca atgtccgcgt ggccctatag ccacaacctt cactccgagg gcatgagccg    137880
     ccttgaagaa tcgccaagaa gcatttatct gacgcacttc gccaaccacg gccagtctgc    137940
     gcatgttgat agactttggg gaagtccatt gaagtgacag ttgctcgatc agctgtgatt    138000
     ggatggtatt ctccagttgg gtatatgagt ccccatcatc atcgatcaag atacaacaca    138060
     cggctgctct caggagttgc gagagacctt gttgagggaa ttgaggccaa tggacaaact    138120
     ccatgggttc gaccagccct actaccttat gtattcctga gcagccacgg agtcgttcct    138180
     caaaaatatc atttcgaatc atgtaccctg cttcattggg tatgatgaat ttgagcaatt    138240
     tctgctcgct ttgaacatgc gataaaaagc ttgagtcggt attcatgcat gcaaatatcg    138300
     aatcaagctt cgtacgcttc atggcaattg tgatgggaac ggagttagtg ctcatcacta    138360
     gtagcgactt tgctcctgag accacgactt ggcatttttc aatgagctct ggaggggcag    138420
     gctggacaag ggcagtaaga atgctgcatt ttgtaccgct ctcgttttgc atatgctgaa    138480
     agcctatagt tgtgatcgtc atgtagacta ggaattgtta gttatacagg acgaaacaaa    138540
     aggcgaaaag tacactacca tcccgcacgc gatcaaaaag aatacagaaa tccgaagaca    138600
     ttgtggttat tcccttggac gtgttttttt tttcaaataa ttattcatct tctgcatcaa    138660
     gggcttttga agttttgttc tctgggatct atcaacaccc aatgtgacgt cgccacgata    138720
     tccgaactcc gagtttgatt ccgatcacat tttcagcaaa tcccaaggta ctgtcaggtt    138780
     atgtcatgtc atataatgac tgtgcattaa taaagtccct gtgccccata attcatttcg    138840
     tcgttttctt catgagcgaa aaaccccgtc attgatgaaa aacagagaag ctcagtccgt    138900
     atctatgtct tcaccaactc tgcagggtcg catagccaca gaagacgaaa ttcgcgattt    138960
     acagcatgtc ccagcgcatc ttcctaagcg agtctggttg gcggcgacta ttggaatggc    139020
     ggagcggttt gcttattatg gaacacagac cctcttccgt cagtatacaa ctctcaatta    139080
     cctttgatct ctctgttaac caggataaac agaaaactat ctccagaaca agccaaccga    139140
     cttggtacct ggggcgatgg gactgggaaa gtctacagca accactgtga atttagcgtt    139200
     cactgtgttg gtaaacatcc taccattgcc gacatccgtt cttgtagatg gagtgttagg    139260
     ccgatatcga tctcttcaaa tatttacgtg gttagttgat attcttctgc tttgcgctct    139320
     cacccatttt aactgactga tcaatgtctc ttgtacacct gcagcatcta cgcagttgga    139380
     tccacagtcc tttttgcgac ctcctttcct tcggaaatga agacaggtat ctcgactccc    139440
     ggatttgtgg ttggggcgat tctcattgct ctcggcctcg gaggggtaca agcatccatc    139500
     cagcctttca tcggtatgag ctagaaagca gaagcagagt gccttggctg attgacttgc    139560
     agcggatcaa tacaccgaat cagatatgcg aatcagaaca aacaaacaag ggcaaaaagt    139620
     ggtggaagat cgcgaactca ccatccaata catctacaat gtatattact ggtaggtagg    139680
     aaggagagac atatgaaggg gtttagctaa tggacttcgc cggtaggatg gtcaatgtcg    139740
     gttcattagg tagtgtcgcc actacgttga tggagaaata tattggcttt tggtcagctt    139800
     acttgctgga tctttgtgcc gtggctattt gcgtgttggt ggtccaagtg gcgaggccaa    139860
     aatttggtgc gtttggtggt ctatgtcgca aacgctgaca tgtatctaat cgctttcacc    139920
     aactagtaca cccgcctatc caaggctcaa agcttcccct tgctgctcgc tgcctatggt    139980
     gcgcagcgaa aggaggattc aaactcgatg ccgctctccc ggagaaacaa ttggaggtgc    140040
     acggccgagt cgttccctgg gatgaagagt tcatcgcgga gcttcggggt gctttgtcgg    140100
     ccttcaaaat ctggtgagtg gtactgagtt acaatttggc ggtctatgtc ggtctactga    140160
     catgagtagc attggttggc caattttctg ggtttgcatg ggcgaggggt cccaggtatc    140220
     aatctctcaa gcgggtcaaa tggagacgca cgggatcccc aacgatctca tcaaatctgc    140280
     caacccggta gcctacgtct tatttggagt tatagttcag aagcaactat atccgttctt    140340
     gcagaaacgc aagattgtct tcagcccggt caatcgcatc acgcttgggt ttgccattat    140400
     ggcaattgcc atggcatact cggccgttgt ccagaatgcg atataccagg ccggtccgtg    140460
     ttactcacgt cctcttgcgt gcgacgcatc tcagggaggg caaattccaa atcatgtcca    140520
     tgtgctccta cagcttccca cctttgtgat aatcgctatt gccgaggtat tctgctggcc    140580
     aaccggctct gagtatactt attcgcacgc ccctaagagc atgaagtcaa tattgcaagc    140640
     gtgctatatc ggaacggcag gattaggata tctcttaggc atggcgttgt ccccactcgc    140700
     caaggatcct ctgctagtcg tgttgtggtc tttggtcgct ggaatgatgt tcctgacggc    140760
     ctgtgcattt cgtgttgcct tccgcaaata ttagatgaca atcaggattt ggagtcgaca    140820
     gaacggcagc aatagcaagt gcagccaaaa ggcatggaaa acatagcatt tggttctagc    140880
     ttctgtggat gatagaccct ttgggaagca gtcttattag agatagaaca tatgtggcaa    140940
     gcttggtcct ggcacggtga tggttgagct tggttcagag tgggatgaac agttggcaca    141000
     tgtattgaac cccattttgc tgcagttttt gattgcgggc agtctaaata atgaccgacg    141060
     tgtgtgatat tatttttcat ctaattaaac ggaagcctga agtaaagata tgcaatctac    141120
     acctaattcc tagactccag gagcagatcc tgctctggag gtcgtggatc atccgctgag    141180
     cgtacttggt ggtgcaacca atagtgctga tagatgaaga ccatatcaaa agggatggtc    141240
     gcattaccaa gatcgaaaga cccgccgtag actgccggcg ataattcatt actgcctacg    141300
     gggtgtgctt ggtcgttgcc agctgtaggc ctacattgaa tgactcggcg aaagtccaat    141360
     cagtatatga gaaagtgata ggatgcatgt acttgctcac cacgtcaatc cattctcgtc    141420
     aaggtcctat aggaataaaa atctggcaac atccgaggcg agcacggcaa gataactccc    141480
     ggattctacc aaggtcaatc gacttgcccg ttgcgattta gatttgaagt tctaaagcca    141540
     cacctatata ataggtgact ggagatcaag cagcagatca atgacccatg aaggacgtag    141600
     acgaaatcgt tcgattgaac agccagtatg ggctctagga attacgatac gcgtactatg    141660
     ctcaaacggt actgggcaaa agaagcagcc attgaatccc gtatatgcgg ttagaccgga    141720
     aaggcattaa gctggacgaa gacgaatgag aagccgtcgg ttgaccgtcg gcgatggttg    141780
     tggatcactt gcgggtagaa gaaaaaaggc catagtatga gaaagggcat gcaacctgct    141840
     gacagccatg tctcggaaat tgacataaga gaaaagtaca tttgaacttg tagggagtca    141900
     acgtttcgga ataaacacgg ggttcggagt ccggagttcg gaactcgtca aacttggtat    141960
     gcttagctac gtaggtacct aggtataacc aataacggac ttaataaaaa gccatcagtc    142020
     acgagtggat aatcaagtga ctagtgacta catgcgtctc agagagatct acgataagac    142080
     aaatttggcc aaggctgcac agtcatttgg ccattataaa attggtagct tatttggcgc    142140
     ttacctacag aatcatatat cataacttct tcgagttctt tgagaagaga atttacgccc    142200
     atcaaacctt tcctggcgcc tcaaacttac ttgcacttag cagcagactc gaataagatc    142260
     attttcatca tgctagaaaa gccagcattg cagcgattcg aaactttaca acttcacgct    142320
     gggtacgaca ctcaggccac tagttccaaa actagcttac tgatgcgttg aaatatagag    142380
     cgtttcccga tgctttgaat agctgctcag ttcctattta cacgacggca gcatttggat    142440
     tcaacaatgc cgagcatggc gtgcgtctct tgaatgttag cgaattcggc aatatctaca    142500
     gccgtattac caatgtaaga aaatatcacc ttcctctacc tttaaatcgc agtatcagtc    142560
     taagccctac ctcttatttc agccaactgt tagcgttttc caaaatcgca tggcagctct    142620
     tgaaggtggc gtcgctgctt gtgcagtcgc atcaggctca gccgccgtgt cgatgacact    142680
     gatggcactg gcagggattg gtgacaacat tgttgcctct ttccatgtcc atggtggcac    142740
     attgcatcaa ttcaaagtgc tggctccaca attaggtatt gagtctcgat ttgtcacctc    142800
     aaatgacccg gaagactttc gatccaagat agatgagaag actaagttca ttttcgtgga    142860
     gagcattagc aatccgaaat atgttgttcc ggatctcgaa gcactcgcga aaattgccca    142920
     ctcaaaggga attcctctca ttgtcagtat cctcctatta ccctcttcgc aaactcgcac    142980
     cagactaaac gagattccag gtcgataata catttgggtg tgccggttac ttctgccgac    143040
     caattgatca cggagcagac attgtgctcc attcggcaac caaatggatc tgtggtcatg    143100
     gtacaaccct cggtggagtt atcatcgatg cagggacatt tgactggggc gctcaagacg    143160
     acaaattccc gcagttccat gtgaatggtg ccgaagaggg cagtggcgaa ctaagtttgt    143220
     ggaatatgtt tggctcacgc gcctttgcca tccgttgcca gttcgaggtt ctgcgtgaca    143280
     tcggtagttc aatgagccct caggctgctc agcagcttat tatcgggttg gaatctctgg    143340
     cggtccggtg tgaccggcac accagcaata ccagggctct agctacttgg ctcgagcaac    143400
     agccgtcggt tgcttgggtc cgatatctgg ggaatgagga ccatccgagc cacaaaaatg    143460
     cagaaaggta ccttcaccgt gggtatggcg gggtcttttc atttggaatc aagggtggca    143520
     agcaagccgg attcaaattg tgtgatgggc ttaagctgat cattaacacc gccaagtatg    143580
     ttccatctgt aaatccccca tctaaggagg ctttagctga caaatatgta cttgatagcc    143640
     ttggagactc aaagaccctc gtggtgcatc cctggacgac tactcatcaa cagcttactg    143700
     atgccgagag acttgatgcg ggggtggatg aagaccatat gcgtctttct gtgggcatag    143760
     agcatattga tgatctgaaa gatgacttct gccaagcttt tgcgtcgatg aatgagacta    143820
     caaaggcctc tgccaattca gttaaacaga attctcacat tgaagagcag aagcgaatgg    143880
     tccggacttt atttgggtcc cgcgatcctt tgcccctttc cgtacccagc tagatgatag    143940
     aatggatatt tttgaccgac catggtctgt tggatttctc ctactttgta gactcaaagc    144000
     atccgctaaa ttcaatactc tactgttggg attgaggtca tatgaagaga ccagggtgga    144060
     gactcaggca agcacatggt atatagtatg tgagccaatt ttcctaatta ggactgattt    144120
     tacagcattg gtgaccaatt gtttcatcca gcaaatcctc caatagctcg attggtaccc    144180
     aatatcagta gaggttcgtt gtggagaaat cccagaggtg ctgccggggt ttctacactg    144240
     agcgcacgag tattttattt ttatttttat ttccatgctt aatgcggcct acacaaattc    144300
     tttgatattg tcaaatacga cgtctgcgct cgaaataacg gcaactaacg attttgccct    144360
     ttccttcaca tccagggagc cagtcgtcga agcaaatctc atcatgcccg ctaccgctaa    144420
     tgccccattt agatcaacaa tgcctcgtgt ctcttggaac gtatctctga tagcactttg    144480
     aatctcacat gctttcacca tgatcacatg gtccactaca tgcggattga ctcgtgaaat    144540
     ctccgttgtc aacgttctgt cgaggtgatc gtggctgatg acaggtagat tgtcctgtcc    144600
     tgttttcaaa gcgtttggga tatgtgtatt acattccgca ttcggtaaat caatcggaaa    144660
     cccgtagagc ttcgagagct ccactgaagg tagaacgtcg acgccgataa ccttcacatg    144720
     tggtgcaaat tgtttgactg atagaccaat tgcttcgagg gcacctcctg ctcgggcgct    144780
     gcagaatatc ccttccagct gttggtcgtc cttgacttgt ctgagaatct ctaacgccac    144840
     tgttcctagc ccggccagcg tgtaggggtc attcagggga tcgatgtaga gagcctgcac    144900
     gttgaacgcg gcggagagtg gacctgatgg ctcatcggaa aggtgttcca cgacagatcc    144960
     catttgttgt agctcgtgca cttcatttgg gcacatttct ggaccaacta aaataactgc    145020
     tggaatatta aggagacgcg cagaatacgc gattgcacga gcatattgtc ctggaagagt    145080
     ccaattggtt aggtttaagt catgcaaagt agcatagatc ttcacctttg gaaggaatga    145140
     caacgcccct ccatcgattc tcaggtgtga tgtgactcat agagttgtat aggccgcgta    145200
     catgcgggct gaaacttaat tgctgatcct cgcgtttgag gtagagctgg aagtccacat    145260
     gccgactgag gttgtgtgct gggcttaaat ctgtgcttct aatcatgtca tgtaccctag    145320
     acatgactat taattgagca tactatatgt ttcattaaca tctaagctat agttctggac    145380
     tggcatacat acatctggat ttgaacaaca cgcgttgtgg acttgcgatt tctgtagcat    145440
     ggtcgagagc aagacttcac ccgggtcaag aagacctcaa gtcaagactg agagcgtgac    145500
     aacaattctt tttttaaaaa ataaaagaaa taaaaaataa aacgagagca tgtaagaagc    145560
     aatattccca aactaaatta gtcgcgagta tcgaagtgat cctcaagtca ataatggaat    145620
     tagggtccaa tacaatcaat tattgaagcc agtgtaagct agaaaagtcc agctagtccg    145680
     ggaaacaggg gcgtctcagc cgtacttact gtactgccca atgcccctcg gactagctcg    145740
     atattaactg cacagtcagg tgtggaccca ttgaatttag atgaaacata acacgtgaag    145800
     acttggctaa ttgcaatatg tgcgattttc tattgctact ccgtacagta cgatattctt    145860
     cctacctcat gatagctgcc ggatagcaag tccatacgac aagagatttc agggctatta    145920
     tgtgcagcgg gtctcgaggc aaaccctcat aatgggatat gcaatgtcac gtcggaacgt    145980
     gatctttacg tttataaggc gcttttatgt atattaggtt aaataaaata tccgctatta    146040
     tacgtggccc atatgctcaa ttgcaacttc aagaggtggc tgtgtagcat caggattgtt    146100
     tgtggttgca ctggcctctt tcctcggact gcccgaatgc caggcctcgc gaaggtacga    146160
     agatattcct atgccgggtc agatggcgct tttgaaaaat cttgttgacc taccgaggag    146220
     ttttgtgaga gcctttacac tcctatgggt atcttgcgct cccacacact tgaaggctgc    146280
     atctggagac acctcttcgt ggcgctagag ataagtactc gataatcgac ttatgattat    146340
     taaggattct aagaggtgca taaaatctgt ttactgcctt ctctcatggc ctgcatgcgc    146400
     acctcggact ctccgtatag aagccgaacg gcgtagcttg ttcctcttcg ctgtttgcgt    146460
     ctattgactg ggtggtgata taatcataca tcaaggaaag ctgtccagat tccatatcaa    146520
     actttgttgt acacataaac aacacaagat cctggcccct catttacctg atattctaac    146580
     tagcacttag aaaatccctc atcataacta aatgaaacct aataggtctt cctaggagct    146640
     ctcagaccct ccatgccacg acaatatgat tggtgagatg agtatagatc ctaggagctc    146700
     gagtgctggt gcccatttgc ggggactgtg gccgctaatg ctgagagtca aagtatataa    146760
     aagaaacact gatccctcct agagtgaacg tatccaggtt tcaagcattc tcctcaagac    146820
     tgctgctcat aagttcaagc aaccgtcggc attccgggtc tgtcccctca gccagagcaa    146880
     aagcctaacg agtatgcaga tttttttaat gccgcaaagc aaaccgacaa cctagtcgat    146940
     atccaatgta tccatccgac gagagttgca agaccgtttc ctgcatactc ctgagctctg    147000
     agtttgttat atatggccat ggcctaatgg gaagatgtaa gtgactctca ctattgtacc    147060
     agggggagcg cgaaaatttg cagggggcct gtggctgact gaatttagta gcataaatct    147120
     actgaggttg gagtgagaac agatcctagc ttgatttctc ggtctgatta cacgtactaa    147180
     aacctacttc aattgtacgt gctctttttg tcatttacct ggacgcaaat ggtgtgcttc    147240
     ctccgattga gccgaaccaa cgatagcccc ttccacgcag gtgagtttga tccgcgacgc    147300
     ctgttcttct ccaaatgtag gcatcgacat agaccaatgt ccgtgagata cctgagcctt    147360
     ccttcaaaca tggtctaaat tgatacttgt ctacggtaaa gtagtagtgg ttcagaaacc    147420
     caaaaggctc caggttagta taaaacccca gaaagagaga gcctgaagat attaagaaat    147480
     cacatgaaaa taaaacccga accccccccc ccccaaggcg gcctctccca aaccctcaac    147540
     ccaccgcctc tgctattgag catgtgtgta ccataatatg gctatatatt atcggtcacg    147600
     tcatttcgcc tgtatcatcc cacctgaatt ataggcatct ttttgctccc tggccctaat    147660
     ttgtcggacc atgcttccat gcttcttccc gccatcgttg aacttgagag ccttcatcca    147720
     cgagtcaaga catccgagaa aacaggaaga gctcttctat tggagcgaag actcgccatc    147780
     ttgattcgtt aatgtattca ggcttgacat ggcaatcaaa aggcccgctg ccctctgcat    147840
     cctagcttca tattgcagac tcggaacctg ttaagatact cgctagttgt cttattatat    147900
     tgcctatgtt tgccaggtcg atactgttgg tctacacatg tcaggttcag taactgttgc    147960
     agatttgagc ctcgtacata tcaggaccca agccgcatta tcgaaattat atctgcacta    148020
     cctataggaa ggacgagctc gttaggtacc agctggactt caccttgtaa ccctcaaaat    148080
     gaataaccga ccttcttcga attactacaa tgacggatat ttctagaaca gccaaatggc    148140
     agatatatgg gcaaggcgcg aaaatatact tccaggtact ggattatttc ggcaaagacg    148200
     agaacgttgg aaaatgtgaa aagtgcaatc acgacttgag attgggtagt ctgaccattt    148260
     cgcaatcgct tagtcaggct gttctgggtt cgtactcggt acaattgctc cttgattacc    148320
     gacgtaagat aattaccaaa ttcctgtaca gcccgcacag ccacctcttc gagacaaaca    148380
     agccacagta cctgaaactc ctgcaatacc tgaaacaggt atggtcttgt atgataccgt    148440
     tatcgtacag tgctgttgca gataccatta ggtgttttac gactcgaccg cgactctatc    148500
     aaaattgttg aagcccaaaa ttttcttgcc gatagtacta ctaattttgg aacatatagg    148560
     ttggatctac actatatatg gatcaaagaa gcagagggag agttatatta ggagagatgg    148620
     agcgagctcc caaacaacta acgtattttc catgcgagct gcgcacccta cccaaaacgc    148680
     gtccatgaat tagaactctg ttagcttaac cacccaccgt ggcaccaatt cgctcttgaa    148740
     ttcaatagag aaagagggta ggaccttatt agttattatc ggttctgaga gatgcagtat    148800
     gcgctagtac cggaagaagc caatgaggcc attgctcagt acttgagatg tgtatttctg    148860
     tatagttcta tctgcaaatt taaggggctc gtttaagctg attaagcagt tgatgccttg    148920
     ggaatcaggg agcagtggtt gttgaatgaa atagactaca ctagtaagat tcttctccac    148980
     tttgaccgac agttatccag gcttctaaga gtcaagaaat tagcgctatt cgcgaagcag    149040
     cacgccgttt taaagtgctt agttaaggaa caaactggaa gccagagatg tcaggaaccg    149100
     aaaagtcgca ctaaaatgac tcacaaaagc tcacgatgct taatgatgtt ttccgcacct    149160
     ccatcatgtt aagtaagtta agtaataccc tgagcccaaa tacgtacagt gtctccagtc    149220
     gttacagtac agcgattttc gaaaacagtt tacccctcag acacacggtt tgtttctcgg    149280
     ctcgtacccg aaaactgcgc tagtccatat atggctaatt caaaactaac cccagcttag    149340
     ctgtatcgca gtatttaatg tattgggatt ctgcgtcaaa tgagtcattg ttaattaccg    149400
     tacacgacaa tggaatgttc taggaagaca gtcgcaggca caacggcaat ctggcgacct    149460
     ggcctgatcc atgcccactc gcttcttcct ttttctccat agctgttact gtatcgtcta    149520
     catcaacata catgtcgaag actccgtaga gtactaactt ggtaggctaa gttggttctc    149580
     gtttatgctc cccatagcac acgtttccta tcgcaactct cattcgtcat tgggcttgtt    149640
     gggaaagcca gtaccgctca ctcatgctga caggcctcca ggctttaatc gtgtgtagat    149700
     atggacggca gccctatcat gataattaca tctctcagcc ccaagaatac gaaccatggg    149760
     aacaggattc acaatattct ccccctaccc cgggatactt ccgaagccca tatgctccat    149820
     cttccaactg cagcccttcc ccatccaccc cacccgagaa tgatcgcagc tccgcgaggc    149880
     aacgacctag tacactgcct ctgctacaag aatccgaatg ggagccagaa aaagcctacg    149940
     acgaggatcc accaaactgc atccattatt tcatagaatg gcgagtcacc cttaacaaga    150000
     agaccgttgt taaagacacg gaagaagatc ttgtattggc cccaggcgcc tactggaagt    150060
     tgttcctgga agaaaagcta cagaccgtcc tcctagagaa agtgccccgc gacaaaaggg    150120
     tcagagttga tgacacggca atcatggtct caaacagcga ccgttcccag cgtgatctga    150180
     acaagcgttt caacaaaact gaaatagttt gggccccaat tgagaaacaa ctcaggatgt    150240
     ggtcgagtca tttctgccgt ggaaaaagac tcacgctgag agtctgtttc aattacgtag    150300
     aggactgcag ttacccaccc gctggacgga agggtgaaaa gagagggaaa tcctccgtca    150360
     cgaagcggat gcttggcgat cgcgatgccc agctggatgc tgaagaaagt tcatgcggac    150420
     agcaatctat ttggcgccac gtttatgatc tgatgaaatg tgactcagcc gcatgccact    150480
     tgggccctta ttgctggcta gacccgaagg gaaagaagca ttatcgactt cggacgcaaa    150540
     cgctcagacg tctggtcacc tatgccgaga aaggtggtat cctggagacg cacagggacg    150600
     tcccggatga aatccgagat gagctctaca tggaagaaca gcagagggaa gaaaaagata    150660
     agcgcaaagg cagtaatatt cttggcagtc aaatgtcaca tttgccgatc aacattaatg    150720
     ttcacccccc tggagtggcc acaacggctt cagctgttgt gacagctggg caaaaatccg    150780
     tgagttcgtt gaagatccct ggtctcaagg acgtggccgt caaagaatat ggtgagtggc    150840
     ttgcatctaa tgtatctgat gatactctga aagctgcatt tcgacaagcg tgtggtataa    150900
     ccctgtctga tggctttgag cttgagcaca tctacaaaga tcaaaatccg gaatttttcg    150960
     tcagcaaagg aatcaaaccc ggaattgctc ggagtttcgt agaaaacatt ggggattggg    151020
     tcgagaatgt gaaaaaagtt ctgcctgttc tcgagttggt gtagacaagc tgtgggagtt    151080
     gcctgctgtt atttggtgtt tttctttccc gctcagtttg tatgcaactc tggaatatga    151140
     agcacaagta cgtccttttt ttgttcgaga taattttagt gtgaattttg ttccggggtc    151200
     aaattagcgg taggacaaag tgaagcgtgg taaaggcccc catcggatgc tagcgatgtg    151260
     acgttccgtg ggcccgggaa tcaccctgtt ttctcgccca acgagtctgt tcgtcaaaag    151320
     ctcgctttct tcccctttca tatgcctcag gccccgttct cgaagttctg aaaagaagtc    151380
     aaaagcagcg tcgaacgtat caggatatgc aagctgtgtg ccagatgctt ctcccataat    151440
     gatgcattct gagccaacgg cgttgtttga tgtggcactc cgatcaaata ttcgacgcac    151500
     gggaatttga aggaagtctc gagtctaggt tgagcatgaa ctagccgccc ttgcgattaa    151560
     ctggtttcag gtgaacttac aagcttcatg gtcgcgactc cggacgcagt tgtatagaac    151620
     gctgggccag catttggatt gggtatacga gcaagcactc tttttccatc attcatgatc    151680
     aaacggaaga ccttgttata tcctccttcg gccagcttcg ttatggagat gcagctctct    151740
     gatcgaacgg ctttggccgc gaggctttgc agctcagcaa ggtaaaaggc cttatccctg    151800
     tccctgagct gcttttctcc atctcagaac catcatccac tggtacaaca gaagaagtgc    151860
     tcgtgatcag gatttggttg tcatttggtc ggagagactc gtgatcgtgc gaacgatgcg    151920
     aaacggaaga gtagtggtcg tagcttgaaa ccgagatggt gctgaaaaga agacagactt    151980
     ccgtggttga aaacaacaag gtgaacagtt tctcaaattt ggaagagctg aaagtgcacg    152040
     acgtcccatg acaacgttca ttgctacata gtgtccggtt gagaacagtc ccaaaatcat    152100
     tggcgccaag ggctgggtgt agccgcctgg acttcttggc gcttactaag tcacatcagc    152160
     cacagctact aattttaatt ttgaaacagc atgacgatta caaccgtatg tacagggatg    152220
     gatgcatgtg acggacatga aagggactgc agtggtggtg gaatggcctt agcacatcat    152280
     ttatttgatg ttggtcatta tactgaccgc tttgaacgtt cagcaacaaa ttgcggggcc    152340
     aagatattga gtcaaaaatg ttattcacca ccgacggctg atgatcaaag accgaagact    152400
     tcgaccatag tttcaatgtt gtctttcgca caaaagcttc tacctcctac agtggggtcc    152460
     cacagtcgga aaccagtata atgtactgtt tctacctccc acccatatgg tcggaacaga    152520
     attatactac cttctaaatg catagaccgt ccagcaaagg caaattctaa gtgatgtgtc    152580
     ccaaatctca cctagcgtgt tattagggcc gtaatacacc ctgtcctatg gaatgccact    152640
     gtacctccac gtccctcggt ttgcataaat tgaatgaaac tggtggcaaa gaccgcattc    152700
     tcaaacatca acatagtatc aaacaatatg ttggcgcaag cacgcaagta aatcaacagc    152760
     agtgcatggc gcccagagat acagctccat ggcgatgaca ataatagaaa aacacaccca    152820
     aacatattca cgaataagaa cttcccaacc atttttcaga tagcgatacc agttctgcac    152880
     tttcatggtt ctaaaagcat ccagtatgct aagacagcgt gtcccatttt tggctcggcc    152940
     tccaaaactc cggtcgaagg gtacaacagt ttgttcattc tcgggtagca tcgatgccgc    153000
     aactcttaca tacatagctc ctgttaaaat cgaagccgag tattccgaca caatcgggat    153060
     tgcatgaaag acgatattgg cgcatgttgt tagtggataa ggtattcttt cataagcctg    153120
     gttactcagc gcagcgaaaa caacgccgcg gaagaaagcc aaaagggttg ttgcaagata    153180
     gtgaacgcag ttcggcagga ctatatccag aaatgcaact ggtagtattt cgagccattc    153240
     tcgccagcca ggaattctct gccaaatcgt ctgttttctg ggttttgaaa cgacggtgtg    153300
     aacccaagca gcgtggaggt tcgttagaga aagtcccaat aacagccttg ataagccaag    153360
     gacagggaat gtggctccgt cttctgcaga aattggttta gatagagcca tgatcacaac    153420
     tgtcaaaagc atatatatca tgaactcctc gaggccagtg aaaatgaacc aaaatcctct    153480
     ttcgttgtgc aagtgccgac gagcaaggct tcgttgattg gtgacagcat tggatgtagt    153540
     cgagatagta aaaatattgc ccatgatcat tatactgccg catattaaaa agccagtcac    153600
     tatgttgttt ggatcactat cgatgactcc agcgagcgat aggacgaata atccggcgag    153660
     gccgagaaaa ccaccacaca gggtaggaaa tagttctcgg atggagttat gtctcaggct    153720
     ccagaggaac tccctggcat tctccgattc gtcccttgtt gttctaccac ttcggccggt    153780
     aggtggatcc tcgatttttc caactacaaa caaaccggtc tcttgcgggt tttcgtcctc    153840
     tatggaagtt ggggtttcta ggatagccag ggccgctatg acgcttccat ctgtgtattc    153900
     gaactgaaag accatgcttt attagtgtca cgctttcccc aaaatgaact tagcaggatc    153960
     tgtcaggtct caccataaag agaaaaagta aactaaatag tgatgtcgcg accacaatcg    154020
     tgggcatctc ggtctggaaa tccgcgttgg agaaccgcac gagacagaac agggcagact    154080
     gccaccgtgc cagggatcct agtggcatca ggccgaacga tcacgaatga gataaacact    154140
     tgagggaaca ggtcgtcgtc tacagcctcg ctgggaaggt agggatgctc gagttaaaag    154200
     aggagatgaa gactaccaca gcccggatgt aagtggtaaa tgtggaagaa aaaggtgtgg    154260
     aggggaaaag gagggtgtgg gtcaagccac atcgctagat ctcccacatc ttacgtagac    154320
     actctatgga gatttacagt attttacaaa gactcattga gcgctgagat ctaatacgct    154380
     aaaagacacg atacggtcaa gcagggattg tttatagggt agcctattat ggactagctt    154440
     ggtttcagat acgggccgag gcacaatcca tgtgttggga atctatttcc cactttcact    154500
     gtatccctgc ccactctcca gtccctaata cccccgcggc cctaggtcca aggcattttt    154560
     tttatttttt tattcaacct tctcaccgaa gtaggtgtcc tgcgactcgg aaaaatagaa    154620
     tgatccacct ccactagtct gtcaatagca cccataatcc ctaagcgcag ccctgtcaac    154680
     atcgagagtt catttatcta tctctcattc ctgcttaaaa tggcgcgtat ccctaatcga    154740
     tctgcgacct acgaagaagt tcgaatttac attgcgcaga cccttatatc caagtataat    154800
     gcaggccatg acttcgcaga agatactgcc cgctcgtggc gattagggcg gggttctgag    154860
     ctttatgatg cgaaattgga atattttcaa gaggtatttg ggatggatac gggtctctgt    154920
     ctattccaaa gtgtctgtga ggatagagac aatgcttgga agcagtcagt tattggagtt    154980
     atttgcttct gtaggttacc actgttcagc caatacgaat tatattgatc gctatatgct    155040
     agggatgact attgtgtccg ctgcgttgct cttttggttt catatcctac cattacttcg    155100
     cggccaaaca ggctgtaagt gacttgtaac agctggtatc ctatattatc agtgtgctaa    155160
     taatctcttt gcatagcacc ttcccaatta ctcctttttg gcttaaccag ggcaatctat    155220
     gcttatctaa gccctaggcg cgatgactat atgctagtga gtggtttgtt tagtgcctgt    155280
     attgcgttag ttgctgcaac gcgtggctag tgaatgcact ggggatctcg agggacacca    155340
     caacgcatgt tatctccgaa tttacacaat acggaccgtg caataggcca gtatttttcc    155400
     acctacacta ccgcttaaat tagcgatcaa gcccggacgt ttctagggct agcatccgag    155460
     gaagaatgca cagccatgca tgaaattaag aaggggcaca tgtatcttga tagtaattag    155520
     gacgagcgaa accgaacatc tggaccgtta tagttgttaa agaaaacaaa agagtcgaca    155580
     gattagacag ggagcgggat tgcatcgaag cgccatgtga cctacatccc tggactcact    155640
     tgtgggtgga tgggggttgt acacggtaca agacggattc ttacagtgat ataatcaaga    155700
     gcgttttgct actgttagcc gataccatat catctggact aggattgttg agaatgtaag    155760
     caaagtagat tagaatgttt atacttcagg tcggaaattg gttaaatctg attatggata    155820
     tcgtagtatc acggacgaaa tgcagccttg atggggagag agctatttag tgaggtctaa    155880
     cttggcattc aagagtgata gatgagtgaa gaagcctctt cggggtaaat aagatggaag    155940
     gccactgaca cactcatgtg catggcattc tcgtgtaaaa atcaaaggtt gaggctcttt    156000
     cgcgccgtat aaaatattat gcctattctt gtacattggc ggctataccg tatgaagatt    156060
     ggcatgaatc aagttggggt tcggcaatta acctccaaca gtgtggagtt aaaactgatt    156120
     tcgaatatga ctgtacaaca gtgacttcgg acaacaaaaa tctaactttg ctagatgcct    156180
     atttccatca aaccccttcg tgcattcacc gataggattc cgtgggcgaa aatattcgag    156240
     gaagccgaga atacgaccaa acggcagcgt ctttacccat cccagagtca tgatcagaag    156300
     aagaactaca gattagacaa aggtgcaact ctcagcaaaa cccaacagga gattgttatc    156360
     taagcgaata aaggtgccgc gaacgcagag gtgaaaagaa gctcagaagg acagtcacag    156420
     gattctggcc aaatgggtca ttgatccaaa tgatgtggac gcagaaaagg cgtagaagga    156480
     cttggacgct caaggccaac aactgagaag tcactctgtt caggaagtct gttggctgta    156540
     caagggaatc agaagaaagg tagatgacga cgatgagacg ggtttgaata tacgattgat    156600
     cacttcatgt tactgtattt tgtcatatga aggagaattc taacaatcta aatcctcaac    156660
     gctaaggcct gcatgccgaa aatggcccct agcactgtct ttctttgccc caacttgatt    156720
     aatacacctc tcaaggaaag tgctgaaatc tcggtcggga tcatctgcaa agtagctcca    156780
     attacgtttt atgaatcctt tgagctcaga gaaaaattcc tcaattggat tgagatccgg    156840
     cgagtatgga ggcaaataga ccactttcac gccagcgtcg gcacacatct gtgagattcg    156900
     ttcggagtaa tgaaacgatg cattatccat taccaagaca gacttcggct cgggccatct    156960
     cccacaatgc cgaaggagtt catcaataaa gtcctcgaag acaatggcat ccgttgaccc    157020
     acgaaagacg cgagagagca caagaccgtc ttgagcgtag gcgggcaata tttgatagcg    157080
     ctcgtcacga tgaaactgcg acacttgccg cggtgccaca ccgagtggtg accagcctgt    157140
     ccgtcgaaac gaaattcgct tgtcacatcc agattcgtca acataaacaa ggtggtatga    157200
     ctcaaactcg gagaggttat gaagatatat ctcccgtaac tcggcgttct gctccttcgc    157260
     tttctgacga gcagtctttc tcgaccagcc gttagatacg agggcccttc taatgctaga    157320
     agttgttgct agcatctgta attcatccca taggaagata gccatctcgt cgaggtacag    157380
     gcccggtttt tccagcagat gatcaaaaag cgcttccaac attagcggcg tgatacttcg    157440
     tctccgtccg acgcgatttg ggggggcatg aacgtttcca aagaggcgca agtttctgcg    157500
     tatatttttg attgtctgtt cgctacactc cgccgcgtcg gccattcgat aacgggtaag    157560
     tgactggcct tgtatcatat cactaatgaa ttgccgcttg gacggggaaa gcctcggtgc    157620
     catattacta gaactgctcg aatgttcaat gtgtgctgag ctggatggat gtcaagggta    157680
     tggaggggca ttcaggttgg aatgtattgg gatttcatgt aatatacagt ataataagta    157740
     ataaagttgt ttggaaacaa aggaatattc tattattaga tgattattaa ttactcctta    157800
     gatggaagta gttagcgtgg ttccgggtac gggccgagaa acaaagcgcc tgtgtccgag    157860
     gggtaaactg ttttcgaaaa tcgctgtacg gtgtatatcg tttcgacgag gggtcagcgt    157920
     aaatgaatta cacacacaca cacacacaca cacacacaaa attcattaac gcctggcggc    157980
     taaaccgaaa gggcaactat cactgatcta tcaatacatg tcctagtgta catgtgcctt    158040
     atctccttag aacccatacc tggttccttt cagtatatgt catcgcagct gtcaatatcg    158100
     tagcgggtcc tcgtgagtta gtaattctgt tagtggactg acttgaaggt gcttcttcaa    158160
     gttttcaaca tcctatcctc ggcagttgaa gcgcgtctac cgtctctggc acaaggtggt    158220
     tggtgtgggt tagtttgggg gaggttgtca ttgtgttggt cgacatggtt aagcggcgtc    158280
     aagtcggtcc gtggcgattg cgaatcgtat tgaggctcgc actgcttcca agttcggcgc    158340
     ccagttctgg tcatccgaag gtgattttcc gcccaggaag aaagacatgt tgcctccgtg    158400
     ggtacaggta tattgcagca ttttcgtcca gtgcatagtc cacttccgac atcaaaagag    158460
     gaagtgttcc acggtctctc ttgcttgtcc acatacacag gatgaggaag tgcggcaaac    158520
     ttcaataata tcgactgaca tcggcaatgg gggaatggct gtaaaggaac atgaagcagg    158580
     caatgttttt gcttctgttt cggcttcaga gggattgaac gattttggca aatcttaaca    158640
     accggctttt ggttacagta acttccatgt tttatgtagc tttccgttgc caagaatttc    158700
     accaaggttg gaatatcccc agaaaacatg attatgatga tataaaaaag taatatacgt    158760
     agctaggtgg gcgaattaat gcgaaattgt ctttattacc tatctcagat gtttttgtgg    158820
     atgatcttgg cgtcatagta ataaacagcg gattttctag tcgcgcgtgt caccttgtaa    158880
     ttctcacttt agcactttgt acttattgtt tggaaaggcg cgatcaaata aaaaaccaag    158940
     tgattattgt ttctgctgct ctcaggcgat attcaatacg tgaattggga gcaacgatac    159000
     tcgaatgtgc aggtacgttg ggggcgtttc atcacacagg gcaaatcatg tcacggggat    159060
     gggggttaga gtgcgatctt gattctacca aaaagtggtt aaacaggggg gttaagaagg    159120
     ggggttaagc agagcggtta agaagaaggg tggttaagaa gagtggttaa gaagagtggt    159180
     taagaagagt ggttaagaag agtggttaag aagagtggtt aagaagagtg gttaagaaga    159240
     gtgtgcagat ctagcgcagc caaggataat ataaatggca agataaggcc cctcatctag    159300
     ctctaacata tggtatcatc cgcaacgtgg gggcaagggg ctcgatatgc tgaactccgc    159360
     atattccgaa ctccaggact attccggact ccaggtctgg tccgaaggtg ggaatgcgca    159420
     tcattccccc ttcctccgac ttgcgccgtt ttccctctct ccggtcatag tagatgtcga    159480
     ggaacaattc tgtccatatt gagccctcat gttaaacgac acatggacgc acacagtctc    159540
     ccaaatcctg ggctggactt atttcatcct gtggtcgctg tctttctacc cgcaagtcct    159600
     gcacaatcac cgccgccgct caatggacgg cttctctgtc gactttgcgg tgcttaacat    159660
     cctcggtttg accgcataca caatttccaa tgcctgcttc ctcttttcgc cggttgtgcg    159720
     ggcccagtat gcccaaaggc atccccaggg cgccgaaccg accgtccaat ggaacgattt    159780
     tgtctacgcc ctccacggag ccctggtctg ttgcctgatt ggcagccact tcctctatgc    159840
     gaggttctgg aactttcagt ccaagtcaca acgcgtgagt atcttggctt tcgtggtcat    159900
     ttgggcctgc gtgggggtgg tggccttggc cattctgtac gtttgggttt cagcgtcgtg    159960
     ggaatggatt gacgtggtaa gaaagcatgc ggcgatcaaa tcactactag cccgatatgt    160020
     gctgactctc atattcacat aaggtttatg tggtcggcat gatcaaggtt ttcctaaccg    160080
     ccgtcaagta cactccccag gccgcaatga actacttaag gcagtccacg gcagggcttt    160140
     ccattgtcgc gattctgctt gatctgacgg gtgctgcgct gtcgttgatg cagctggtgc    160200
     tggactcttc gttgcaggcg gactggtcgg gtaccaccgg aaatattgcc aaactcctac    160260
     tgggaaacat taccgtccta ttcgatctca tctttatctt ccagcacttt gtgttgtatc    160320
     aggaacaacc ggcggagagg aagccagggc tatcagagca tgatccgctc ctggatagta    160380
     gtgacgagcc atagatacac acaatcatat ggtctgaatt tctccctatg tctgcgacat    160440
     gtatgaacca gcaatgatgc aacttgtatt cgaggtccgt tcccttatgg agctgaaaag    160500
     gttgggaaga acgaaacata ataatccacc tctaaataag gcagtgcgga atgacctcca    160560
     gcccatgacc agacgctcgt gcatttcgac taatctatac agtgagcagc agcggtagcg    160620
     aacttagtag tgagtaccac acgagtcgat gaaaagctta agtgacacta tagctccatg    160680
     tatcacacgc gaagcgttat tctgtactac cggacagtgt ttgatatata tatatagtca    160740
     agcacaggca ggggaaaata tgttcttccc tcatttatgg tttgttccaa cctcttcaac    160800
     caccgaactt tcaatccaga taccctcaac caccgtatag acaaagcttc ttcaaggatc    160860
     accacatccc accacaggca agccccggta agcccatcat gtaagggtag gcccgatacc    160920
     tatggagcgg tagcgcccat ggcagtggag tccttccgcc atttcacggg aaaaaaggaa    160980
     gacactaaaa ccttcatcag gttaatctct gagcccatcg attagagagc ctggaacagt    161040
     ctcgtttgat aggtatgtat cgaagtcttt gttgatctag tacttgcgaa atgcaacacg    161100
     aaacgcacag gcagtaatga acatcagccc ggcaactact gatcacatca cgaccagcaa    161160
     agagtctctc gcaaggggtg atagtgccat gcctaacaag taaccgagcc ctgctgtccc    161220
     gatataacac gcctgcaaga tcgacttcat gctttttgag gcgtgggaat aggtatactc    161280
     agagcccgtg ggccagcaga acacttccgc tagtgcaatg atgatgaagg tgggggagct    161340
     gccacagcac atgggtgcgg tttgggacct gtccgctgtc tgaggccccg cacgcaaggg    161400
     ggtgcgagta gcagggaccc gtacgataga taaaagcctg caccacggcc gagtacgcca    161460
     tggctacgga catgatgaca aagcctagtg gaatccggtc cactgcgtgg aaggcaattc    161520
     tgcgcttctg caagaatgga tacagctgtt tctggacgat gggtccgaaa atcacatagg    161580
     ctatcgggtt cgcggatttg atcagatcgt tagggattcc gtgggtttcc acttgccccg    161640
     cctgcgagat ggatacctgg gctccttctc ccatacaaac ccagaagatt ggccatccaa    161700
     tgctattggg gttagacgag ctctacattt cgcaacgcgg attccggtgg ttgggtaggg    161760
     gaaagtagtc aacgcaccag attttaaaag ctgacagggc atcccgcagc tctgcaataa    161820
     ctccttgtcc cagcggacca ctcgtccatg cgtctctagt tgatattggg acagagcggc    161880
     gttgagcttg aatccccctc ggacagcata ccacaagcat cgagcagcac gaggcagctt    161940
     agagccttgg acgggcggat ggactggccc aaacatcatt aaacctattg acacagctct    162000
     atgagaaaga tttgcaagac gcaccgaatc tggatttcgc tacctggacg ataaacacgc    162060
     aaaggatgac cgcacagaga tccagcagat aagccgacga gaacccgatg tgtttttcca    162120
     tcagcgtggt ggcgatgctg cccaaggagc cgacattggg catcctagcc ggccaccgtc    162180
     attacctgaa gtctccccgt ctctgcataa tgcacatggt tacctaccag tagtaaagat    162240
     tatagatata ctggattgtg agttcacggt cttccacaac ccgttcgccc cgattggtga    162300
     ctctgattca catctcatgc tccgtgtact gatccgctgt tgtctgatca gcctcaaggt    162360
     acgtcctcca tatagttgcg cataccgatg aatggctgaa cggaagcttg aacccctcca    162420
     agaccgatag caatgagtag gcacccacga caatcttcat cctgagattg caagtatgcc    162480
     aaggcctacg cgcccaggga gtagagattt agtaaagaca acataagtca gctgcgagta    162540
     gaaatgaaag tcagcggcgc gagcctagag atgaagggtt gattctagtg agaccaaaat    162600
     gtcatccggc caaccccagg tacagctcag cgtttccgtc gaccacaaag tctgcagccc    162660
     attatttcgg catctgtcga agcacttcaa ccctcactaa gaaatggtaa ccgtggttaa    162720
     aatggggaca tgtagaatgc aagcgcgttg agcgatttaa ttgcaaattc gatgacatgt    162780
     acgaaccata cttttgcggc gttgctttct tttcaacagt tgatgaaaga ggttcaccac    162840
     actcaacgca caattttgag aggaagtagg ccaggtcgag acttggctct gcaggccaca    162900
     aagtctccaa acaccccttc aacgtcgttg aaatcgcttc aacgcttatt aacgagaccg    162960
     tgactctcgc taccaactgc gcaactggtt ccttggtaga gacgtagccg aaaaaatata    163020
     aaaggagccc gattcccagc ccaaaaaaaa tcaggacttc ggtcctcacc ctccgttgtg    163080
     tcatggtgtc cctctcttgc ctgcgggctt gagagtctcc gtgaccacgg ctgtcgctgc    163140
     cacgagccca gtgatgtaag acttgcgctc cctcgctgcc acgagccccg cgagtgtaaa    163200
     aaggtgcttc gcaggatagg tctgcgtgaa caacaatcct cgcagggggg cgctgcgtta    163260
     ccaagtgaac tccgcagggg gacgctgtga tgacaagttc tccgcagcct aggctctgcg    163320
     tcaacaactg tgtctcgcag gataggctct gcgttatcaa ctgtgtctcg caggacaggc    163380
     tctgcgtcaa caactgtgtc tcgcaggaca ggctctgcgt caacaactgt gtctcgcagg    163440
     ataggctctg cgtcaaaaac tgtgtctcgc aggacaggct ctgcgtcaac aactgtgtct    163500
     cgcaggatag gctctgcgtc aacaactgtg tctcgcagga caggctctgc gtcaacaact    163560
     gtgtctcgca ggacaggctc tgcgtcaaca actgtgtctc gcaggatagg ctctgcgtca    163620
     tcaactgtgt ctcgcaggat aggctctgcg atatcaactg tgtctcgcag gataggtctg    163680
     cgtcaacaac aatcctcgca ggggggcgct gcgtcaacaa ctgtgtctcg caggataggc    163740
     tctgcgtcat caactgtgtc tcgcaggata ggctctgcgt catcaactgt gtctcgcagg    163800
     ataggctctg cgttatcaac tgtgtctcgc aggacaggct ctgcgtcaac aactgtgtct    163860
     cgcaggacag gctctgcgtc aacaactgtg tctcgcagga taggctctgc gtcaaaaact    163920
     gtgtctcgca ggacaggctc tgcgtcaaca actgtgtctc gcaggatagg ctctgcgtca    163980
     acaactgtgt ctcgcaggac aggctctgcg tcaacaactg tgtctcgcag gacaggctct    164040
     gcgtcaacaa ctgtgtctcg caggacaggc tctgcgtcaa caactgtgtc tcgcaggaca    164100
     ggctctgcgt caacaactgt gtctcgcagg ataggctctg cgtcatcaac tgtgtctcgc    164160
     aggataggct ctgcgatatc aactgtgtct cgcaggatag gtctgcgtca acaacaatcc    164220
     tcgcaggggg gcgctgcgtt accaagtgaa ctccgcaggg ggacgctgtg acgacaagtg    164280
     agacccgcag gagaccgctg cgttaacaag ttcctctgca ggagaccgct gcattaccaa    164340
     gttctccgca gcctaggtcc tgcgtcaaca aagcgcctcg cagggacatc tgcgacaaca    164400
     agagtctccg cagggacatc tgcgacaaaa agaccctcta gcccgtgcag gcacctcttc    164460
     gtggtgctag ggaccagtat tcgagtattc aagtactcga agaagcaaag acctgcgcaa    164520
     tatcttcatc gtctgttcat tattccgaag ggtcatcatt ggatactaga gggagcccta    164580
     gttagatctt cgccaattca acagccaaga tcataaacta acaactgaag cgtcttcagt    164640
     atcaaatgac gtatttcaca ttcttttccc ttggtagctt gtgatccaat agcttcctcg    164700
     ctacaatagg aattggcatc tttcattcag atgtaggcaa acagagatga gtgttgatgt    164760
     gagtgttgat gtgagtgttg atgtgtgttg aaatatcccg gttgctgaga taataatgag    164820
     gctgggatca cgtgcataca tatatacctg ttcaccagcc tacttgtatc ttagacaaca    164880
     tgcaacaata acacacaatc aactcccatt cataatatga acactgaggc atcacttatc    164940
     aatcaacaat gtgagtgttg atgtgagtgt tgatgtgagt gttgatgtga gtgttgatgt    165000
     gagtgttgat gtgagtgttg atgtgagtgt tgatgtgagt gttgatggtg agtgttgatg    165060
     gtgagtgttg atgtgagtgt tgatgtgagt gttgatggtg agtgttgatg gtgagtgttg    165120
     atgtgagtgt tgatggtgag tgttgatggt gagtgttgat ggtgagtgtt gatggtgagt    165180
     gttgatgtgt gtgtgttgat gtgtgtgtga ttgagcgtgg tggtgaatgg tcgggcggtg    165240
     aaggaggtgg tcaccgtcta gaccttgcca tcggtccatg ccaccctcag attatgtaag    165300
     attcctgaat agggggttca actccaactt ctggattaat cggttattta cgtctatcac    165360
     tgtcacccac cgccataacc actggtatag taggtaatcg atcctaataa cggtgtatcc    165420
     tgttgtataa tttattatat atgttgcttt tatgataaat ttattagtga gactagtaga    165480
     cagtatgatg tgagtggatt tgtaggttca accttttttg tggtcatata tatatattta    165540
     cacacatggt actcgcatca ctatttctat ttattttagt tcgcactccc aagtttcatt    165600
     cagactagac tcaacagtcc gctgctttga caagcttggt tcaatccaac tcgtccatta    165660
     tatatccttc cacccaacta atccgaacac atagtattgt gggacctgta cgtggctaaa    165720
     atattgtaaa gtaaatacgt gcgtcaaggg cttgttaaca agcgacccat gggccaaccg    165780
     ccaaccaacg ccatgcccgc ccatagacag gtggaagtaa ctcattgcga atccatgggc    165840
     ctcgtgggcc gagtcgaggt cgatcaatat ccccagacgt agcaaggagg ttttcttgcc    165900
     atctcatcca catgatagat gtatcaattt attgattcta tctcgcaagc catctctagt    165960
     gccattctga tcactcggtg aatttgcata cagcccctac ttcgattgag ctggtcgaat    166020
     gcaaacccca gactgccctc cgttggttca actatgtata ggcaatacat acgctcaaga    166080
     tcagacctac caggcataga agcatttatg aggaaccgct cgaaatacca ttttgttggc    166140
     tcaactaaac atcgtgatgc gatagactct gccttcttat tcgaagtcat cgcttcagtc    166200
     ggcgattgca agtcacttaa gcctactcta ctgtaggatg gctatatcct agaaccatcc    166260
     cgagtgtgaa agtggattcg caacaaagaa aaccaaccaa gaatatccga tcggctccta    166320
     cattcgggag tcgccgcaac attgtaagta atccccccgt tggtaactac aattcatatc    166380
     gccagccgta ccccatgtat caatatccag tactgcgtcc gaaccgccgg tcgttgcttt    166440
     ctggggcgta gtacccgggt tcatgcgatc aagcttgctc tgctgccgat agaacgcagc    166500
     aggatggctc tgggtggtgt tgttacagac taaaactcat cttcataaag gatctgcttg    166560
     aacaatgatc tgtcaaatat cgtccagggc gtggtgagtt tgacaaatat atacttaatg    166620
     ctgaaaggat gccgacgctg gtggacagaa tccgacgagg cccctggcag gagctgcttg    166680
     cgcgataggt tagaaaacga catcaataga cagagacgcg cggccagctt ggtgacctgc    166740
     agtttcagtg acatccaaag catatacgac tttctggata gttgctgggc tttgatagag    166800
     aaatgtgtgc ttgggatcca aatacaccaa gcacctgttc caaggagaca tttctgactc    166860
     cgacttgatg tagctccgta tatttccgct tggttcattt ccactcgttc gtatgtgtcg    166920
     aacgcctgag caacacgggg tacgaggtgg gacagtatcg gacggtcttt ttggctcttt    166980
     agttggctcg gctgtgcctc ggtataaacg gccttgtctt ctcggttcgt agctggtacc    167040
     gaaattagcc tgtaggatag aaacgaaggg agttttgcct caccttctcc ttgcacgcgg    167100
     atttggacta acaacatggc caacggcgaa ggtaggaatc ccctgtcatt atgcaagacg    167160
     agacatcggc atttctcggc gcctgccaga taatcaggct tgaaaagatg ccatccgaga    167220
     acgtggggcc acccattgga cgccactaat ccaattcagg agggctattc tttcaccgtg    167280
     ttcgaatgcc gaaagacaca cggtggtata agccattggg atttcgcgta tgtatcgcgt    167340
     agacgcatca gcacatggcc tgaggtacag agtcgactga gagagaaggg cgaaggtaaa    167400
     ggcgatcaga actttacatt ggctcatcat cgatgccacc aatggtcatg tcggggtgat    167460
     agagcgtggg atcacatcgg tatcggggag cccgagcaga caatgcactt gcgcgcttcg    167520
     actcgagtaa cgggaacatg agggtacccc ctatcgtacg atccgagtca gcgaggcttg    167580
     aaccactagg acgagtggtt atgacttacc agttcataaa gatcgcagaa tgtttgcttg    167640
     caacgagacg atcaattaga tggtgatcat attatattac ctaaaagatc aattataatc    167700
     gtcttcatcg atgtggtcac cattcatgcc atgttgacat gatgttgtac ccagaccgtc    167760
     gcagtctccg gctgtcgctt cgaagaagcc acgctgggta caccgggcaa cttctgagag    167820
     ccaaaggcgc atgacgaacc cacctgtgat aataaactgt acagtcgtaa tgggataaga    167880
     cctcgggatg cggacggcca gaggttcata cactccgccg ttcatggtat gaaggcggtg    167940
     aggtcgaagg cggaagacgc gatagagcac gcgtcgtagt gatcttggtc tttatctccg    168000
     acccgggata aaaggactcc tcacaagtat gtttcacggg tggcgatggg ctgctcccat    168060
     ttacaatagc atagaaatca gtaatggtgt tctgttttgg ggcacaaaag ttttcacaaa    168120
     taattggata tagcttgtag atcggcgaga taatccatga ctcacatgtt cttgtagcca    168180
     agtctaggga cgaagagacg gcaaggagct gtgactctta cgctcgtgca ttgtcgtcga    168240
     atgtcctcgg ttctattgaa atcgcatcgt cttcaggatc agtgagacag gtcaggctaa    168300
     gattcacaca cctggggcgt ggatattcga gctctcagga atgcacacag gggctgtaca    168360
     gtagatcagc tgaatctagt gttgtggcgg agacctcgtc gcgtagacac tttgaccagc    168420
     taacccaaaa ctcgtatctt tgatcgcctg gcgtgaatag gagtgcatct ggtggagatc    168480
     atatctctca caggtactgt ctgacttgct ggtccatgat gtattctata aaagtcagta    168540
     cagcggattt tagtactcga tcaaagggga taacctatcg aatgcctcgg acacaagcct    168600
     gctcgacttt gcgtagtcaa gtgaataaat tgtagagcaa attgcagggc gcaggggacg    168660
     tatttatagg gttctcggct ccttctgttg cgcaagtgct tgcttgggag caagcattga    168720
     aggacaccta tcctaattga ggcctgttga aacccatgtc ttctttttac cgcgactatt    168780
     tgcggcgaca tctttgatgc ctttagatgt tcagtgagag agacgagtaa gagtggtgtt    168840
     gagaaaaagg gacggtgagt tggtcaagaa acgttggctg actgttgaat ccttcacggc    168900
     cctcttaaat ttggactttg tgggagatat tcaatccgca atgacaggcc catatttctt    168960
     gttctgatca cctcatctgt gcgactcaac gaaaagcgcc taaaatttca tcactagaaa    169020
     ccatggactt gttcttccta gcctcgcttc agtgttgtgt tggttgtgtt gagttgtggg    169080
     tctctcccgt ctatactgcg gaagcgaggt cacggtcggt cacggtcgga tgtgcgggtg    169140
     ctcgacccgt caacccgttg aagcttggct atacgttgtc aacactcaat tttcgaactt    169200
     gtgaccatga agatatatta agactttttt tttctcgttt tcttttttga acctcttttt    169260
     tttggtgact gtaagttcta caatgttctg ttcatcgagt ttctgacact ttcaacgaaa    169320
     gtgggagagg tgtctgattg aaatatatat ctcaatgagg gttcatatct ggccctcaac    169380
     atcgtgaggc ttgatcagtt tccccgacga ttcgttgaca ctatcccttc tatcaaattg    169440
     actgccaacc gcccgctaga aataaaaaac aaattccatc caaaagctga gtgcgttgat    169500
     tgactatgtg gtgaccgtaa aactcagtct atagccgtct gcgtctgcat attctataag    169560
     agataccaag gctagttgga aacagtacta tccagatcct tgactttctc ctgtggacaa    169620
     aatggactcc ccaaacagct cgccagacca ggaaaagcaa ggagaacagc agcccaatga    169680
     attgccaatc cttaatgata aggaccataa tctggaacct tcagatcatg tccctccatt    169740
     ggtaagtgaa acccttcggc ttcgaattct ttggctgacc atcgtagacc tccccttcgc    169800
     aacacgaaga agaaacaaga cataccttgg cgaccgagcc gtttcaaccc acctggaagg    169860
     tgctagcaga cctcgaacgc gacgatccca agtttgcatt tccagcagct cgacttgttg    169920
     gactgtatcg acgtctatgg gagtcgtgtg tgtccaagca catcgatgtc caaaagattg    169980
     accagagcaa tgagatcttg aaggaggctg gtgcgtacct gaggaaagag agagacggtc    170040
     ttcagcttca ccacgagaag cagctagctc gactgcgctt tttcggacag gcactggaat    170100
     catctcggga acgacttatt agcctactcg atgactggaa ctatccctac agtcccaatt    170160
     tggcagggtt gtcagacgtt gcaagagaag cgtaagaaat tgcctattcc gggctgcccc    170220
     gtcctatagt ggcgatatag aaatactaca agcggcagac gcggtgcaag gggaatcaca    170280
     ccgcatccaa agcaggttat atattcccga ggctttttac aagaagggca tcaaatagtc    170340
     attattcatt atcgtggtct tgactgaaat gagtatacaa acaaccccgc ttgattcaga    170400
     ccaatctcaa tcgtaatgac tcgatatatt atgtacaaaa aagtgtgggt ccagggatag    170460
     cgtcggggga aacctagtca acagagaatg tgtcgagaga ctcgaatatg gtagagattc    170520
     cgtacgaggc caaagggata gtcggaagcc agtgtcggtt gcacggacat catgccaggt    170580
     gattgtgtct agtagctgtc tgcgtatccg atagagattc ccccatggcc gtttcaaccn    170640
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    170700
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnng cattcgatca aggaaggctc    170760
     ttgagtttcg tattctccag ggtcgtcttt gccaaaagaa tcctgccaca gatcattggg    170820
     atcagtagcg agacagggag gcggtgtcgg tatgccagaa gattcatgcc agatagcgtg    170880
     aaggtcgaga tccaaatcgt agtctgtaat gttagcgcaa actcctatca aagaaacggg    170940
     tacagaccat tctcgttcaa tccgttcatt tctggtatat gactggccgt cgaacgctgt    171000
     agggaaatat ggaggtatgt aaagcagcga tttaacgtgg gttgggaggg atggaaagct    171060
     ggagactgag cagtttttat tcctctctta ttacacagaa tcaggacaaa ctagggggat    171120
     ttatagctag atgctaagtt atcgaatgcg ttgaacgtat caacagcgtg cacgttggta    171180
     cccgtcacca acccaaggaa aattcaccag cagtataagc cttaactctc cttagagaaa    171240
     acagaaatag atagcgggaa atcaaatgtc attatttctg cccataaacg ctctaccaca    171300
     tggagacttt accaaccctc aggctcctcg gcggaggagg cttgaagatc gctcgcttcc    171360
     aaggctgaaa cgacaccatt acaaagagcc tgaaccgctc gcttgcgctc ccacaatact    171420
     gaagcttgca cattgcagag ctgtagaaga gtatcgctat cgcttgctag caagtcattt    171480
     gacgcttgaa gccgtcgctg ctcctcctcg agtcgtattt tctcggccga tttgacgacg    171540
     tagcattgcc atagacaaaa gtacaagtca agcaatttga ggactggtgt agcgagggag    171600
     tcattgaggt ttactacttt catgaactcc gccgtaaggg taccgcgtgt tctcgctggg    171660
     atctattcag tattagtggg gttttcattc cctgcggtgg gggatatgac cgaccttggg    171720
     ttcgatggtt gtgccgtttg tgacttgctg tggttggttt tccaacttgg gttcatcttc    171780
     tggagcttgg gatactcggc actgtctctt ggccggccga tcaatggggg aaggcgaagt    171840
     gggatggtcc attttggtca tcaagatgaa ttggatctga aattacgctt gaggcgcatt    171900
     tatagctgac aattcacgcg aggctgctgt tacttctacc agtgcttcct cacctaggat    171960
     cgaccgcact ttggaaaggc cagtgaacag ttagctcaac tgttgatgct cgatctcacc    172020
     ggctgctcac gaatcatcca acgatatacg aaaagggaga aaagagttaa cgttgaaaaa    172080
     tcgttacccg acctactgaa ggtagtttgc aagtgttctt gtgacgcgtt gaatgttaga    172140
     catcaagtag acctcggtga aacttaaccg tgacattaat ttgactgcaa atcatttgga    172200
     acgaaggaaa cagatatacc gcgtttgagc ttaatatcga taccaattga cgttggtaac    172260
     cgcggatctc gcattgtggt acggacctac caaaagtaga tttcactagc tcttctaggc    172320
     taccaatcct tagtgactgc accaaaaggt tcgatgagtg ttatcatatt attttgtttt    172380
     ggataggcct ccgggcatta ttggtatttc ccagatccaa acgatctcct caaactgctg    172440
     tcctcccacg caccacgagc acgttgactg tgagatatga ggaaaacttg ttcttcgaga    172500
     tttcagaggc ttaagcgaaa gcttcatgaa ttcaaatatg cttttctcag tatcagccga    172560
     tcaaaatctc tcccagagat acctgccgcc gcttccgaat tggaacgcac acgacgatca    172620
     gccgccccat ccccagaggc gtccccaaat gacgttaaca gatcatgaaa atgagacaaa    172680
     ggcaccccga tcagttttga tccactaccg cgaacattca caaagcagac tgaaactaaa    172740
     ctcttttagt tccacaacct gtcgggtcgt cgtgcgagaa caaagagcct tcaggtggcc    172800
     attccgtgcg aaactcgttt gtgagggaag ttgagagacc gcactgcgtg ggcgagtaac    172860
     aaactttcgt cattcgtgaa ttgcatagtt tgtaccggat gcatgtaaca actgcacaat    172920
     tgaaaccgct tgtcgtctgg agaatgtccg gatcctcgat attcacggct cgggccaacc    172980
     taaatgcacc cacctaaggg tatgtcgtag tttggcttct tcaccaggcg gcctccggtt    173040
     ttgaaaaaag cccattgggg taaacggctg tggcgacatt gtgggacatg ctggttggcc    173100
     attgatgtac cagtggagcc gaatcatgag gctccgagtg aaccgtgaca tctttggctt    173160
     gatccaacag atgcaaaaat cgggtggccc acacttttgc ccgacagcga tgacgtctgc    173220
     actcaaagaa aagtaactgc tttgcagctg aggaaatctc ctgctgcgct agtggataca    173280
     ctaacagagg gccctgaagc agctgaaagc acaatactcc atttgtccgg gagtcaagcg    173340
     gcacagtgtt ttgacaatga ttcccgtcat ctcccgccca tatgcaccgc tcacggtgca    173400
     agggatcacc caatacttgg cccaataccc attgtagatg agcaggattg aaggccatga    173460
     tgaaaaagta aatttataag cgtctcgttc caattacgag gtttgtatgt aagcagctgg    173520
     tagtccccag cacccctcat cttgttcctg aaaagcggtt attatttcct gggagctcta    173580
     gccacatttg tcgggatacg cgcgaggcat acacaatgag tggagatacg atatgcggga    173640
     ctcacatggc atctgggttc actgggatgt atatgcgact ttccccttac aactgggcct    173700
     caagatccaa gaaaccggca aataattcat atagcagtgt agcaatagag cctaggggac    173760
     ccattttaag ggggaacata ccacatgtcg tatccagagc cttcggtctt gaagctcatg    173820
     acccaacacg ctcttcaaaa tgcccttagg cgactcgcag tttgccagct atgccattcc    173880
     gcgaatgcac ggtctaaatg cacggcccac tgaatccaaa gagtgaacca gaatgagaca    173940
     tccttcttgc aacccactga tcagcggtgt agcggtagat actgcatcgc agtgcattct    174000
     tcgacgtttt gactgtttca agcgagaatt tccacgtcag cagccctgac acgatgtaag    174060
     tatagttccc atgatgaagg catataaagc tggcgaggaa accctgcgga gattgcgcaa    174120
     catcaatacc cattcgaatc tttttctgcc tttgtcatca gcacaatgtc ctctgtccta    174180
     ccttggaacc catttgctgt ctgcgggatc ccttatggtg gtcctgtgtc ctgttgcggg    174240
     gtgacgaaga aaggcgagcc gtgcaaaaac tctgtcaagg ttcaagacac caagatcggc    174300
     catcaaaagt tgaccactct ctccagagag ccatttgacc tgtcaacttt gcagtcaaag    174360
     ctctgcgata ttgctagagt ctttctctgc gcgagatggc accgtcaacg gcaggccgac    174420
     caagttggct agcggtggta tgaagcagcc atccgcaacc aggcgcgagt gccgcatggc    174480
     tctagagttg ccgctccatc cattgcgcat ccgggccagc gtcagatgtt gtcagtctcc    174540
     aggagtcgcc ctgcatcagg caacaccgac aggtcacctc acgggctcag acaagaccca    174600
     ccggtgcggc tgtcaaccaa ccccgagcca gtgcagccat tcaatccatt tgtcacttcc    174660
     gcaatgctgc ggacgaacag tgttccatgg catgtttcgc cggctcaacc agctatcctg    174720
     acatcggtcg ctaacatctg ggctggcatc caaagcttga cgctcaagga tctcaccctg    174780
     agcgacgagg tcgacgacat ccactgtgta ttttgtcttg ccgaggatga agatcttgca    174840
     aatgaatgtg tgatcttgcg ctgtcagtgc aaggcgcttt cccacctggc ctgcgcggaa    174900
     gagtggctgg aaaaacgaag tacagttttt gggacgtcat gctgtgtgtg gtaagtaggg    174960
     ctgattctga ttatccaatg cccgaggtgc tgatcaatac agtcgaaacg aagggccttt    175020
     agacgcttcg attcgcccac tacgagtcca atcgtcggat gctgagacac atcatatgcg    175080
     cacggcaagt gaatcatctc ccgagagaga acctgccact atcacgaatt catcactaaa    175140
     tgacccgagt cagagccagt cgcgtcagcg gtcagtggga ccccaaggga gatcagttga    175200
     gcagagcgtg gaggatggcc cccgtcgctc ggctaggcta ggagctcatc taccacgagg    175260
     cccttctaca tctgcaccac cccgccggtc agcacgacta aattccactc gaaggtgatc    175320
     tttgtcacag cggaggtgtg acacagtcgg cattgggatt agtatcagag agcatagcca    175380
     tgatttagac cttggagtaa gcttagaaat aatacaaatg aagtcctgaa cgttcaaaat    175440
     cgcagagcac caaaaccacg cgaccttttc atctttgcaa gtactagatg ccaatacacc    175500
     cccaaaaccg gttggcagtt tcgcttaatt tcggatattt taagatcgaa accatattca    175560
     tacctaacgg tggtggccaa agaattgtag acatggattt atctcagtgg agcgtgtcgc    175620
     gtcaagacgg agattgttga cagaagaaac acatctcggg ccggcaagag actctggcaa    175680
     actcctatgc tggttaggtt gactctcgga atcaatatgt tgaatctggg aaactcaaaa    175740
     gcatttctag gatgtcaagg atatacatta agcatgcgga acggatggag atatgatccg    175800
     caggggaccc acatggtgta catgggttca cctgaacgcg aggaagctac ctttcttttg    175860
     cttcctcgcg ctgcgtcttg tatctggagt caactatagt tgtttttgat attgattatt    175920
     catcttgaaa cactatccac ctctatgtat acgtgagacc ccgccaaccc cgccaacccc    175980
     gacaacaaag acaacaaaga caccatgacc tccaagtcca acaatgggaa tcctaacgct    176040
     cgaggagcag aggaagtaga acggagagga cggacaaaat caacgcactg agcaatcgcg    176100
     cacacttcgt gccatctttg cccatagctt gcttttcata tgacttggac gaatgatgtg    176160
     gtttgtcttc atatcctggt tcaaaagtgt aaccctgcaa ccgtttttta tgtccctgcc    176220
     cttgcaggct ggaccatacc acctaccaag cgcatgtgga tgcggtctgt agtcaggatc    176280
     ccatttcgcg atatcggatg accgaagttc ctttatcgcc ggatatctgt agtaacagta    176340
     ttccgagtag actccttgtt ttgtgttggt gaaaaccttt tccaaaggta gctttaccga    176400
     ttcatgacat tcaataacat cgtaaatatt caaggtaatg ccagacggga attgcacctc    176460
     atatctattc ttgtcatatt tccagccatc ctgaagagcg gcaaagaact tttcactttc    176520
     gtatctgaga tcgcctgaat aatcacctgc gataagagca aggtagagac gggttgacga    176580
     ttttctgggc cgataggcgc tcaagttatg gccaataaga actggagaac atccatcaaa    176640
     tgtcagagca aactccagcc aactagtatt tttgaagatc tgtttccaga ggatagaact    176700
     ggtgtttatg atgttttcga catctgctgg cgtcagaaag tccttgatac ttaaccaaat    176760
     atcaagtggg gtttcaaaga gcttcattgt gaatgactcg ccctggtgcc ggtgttgatc    176820
     cagatcgtac cagggaaagt atttataacc cacagcgcta tttcagaaat gccttaatct    176880
     tacaaaataa caagcaagag tcctacattt ttgtcaggcc ctccgaaatg cacctatacc    176940
     tgtggttata gagctggtca ataacagaat ctatcctccg gatttctctg aaagttgcgg    177000
     tggcctaatt ccttacccat ccgaacctcc cttatttgca ccctagctca aatagatatt    177060
     ttccataggc gagaaaacat gctgttgatg ttcagtggtt gtcatgttca acgttccgaa    177120
     cgttaacatc gattttctga caccattcac cacccgtaca tcgccaaagg ttgttatctg    177180
     agaatgttca gcgaatgtat cagcatgata ctaccaggct gttgtgcccc agtgctacag    177240
     gaagcacaaa caagactccg ccggtcgctt ttttctttat tagctgaatc acgacgggat    177300
     agcaacccac gagatatcgg aaatgctacg cccttccaca tgtccctatt cactaccaat    177360
     tccaatctag cagccatgtt gctcccggga atacactgta aatcaattgg tggttcgggc    177420
     aacacgtggt catggcaact ggattgagac atcgttgatt ggatcgtctt ggtctacgta    177480
     ccgtgattga ggcaacaaat taacatccgc agtcctcctg ggagccggca ccgatgttgc    177540
     taacccgcga aaacttgaca gcagatatct ttttcatggt ggacatcaag cattcaaatg    177600
     ctcatgattg tcccattgtg gaagctatta cacccttatt ttcctcttgc cagtgcagca    177660
     ccatcaccag caagaaggaa tcatcatgga ccacaagctg tcacaggtat caaagggtcc    177720
     gataccccag acatagaaga aaacaatgga ctcacatggc aaactggtat cgttatctta    177780
     gatccccttc tcgaggaatt catcggctga caatctatct cgtggaggca atgaaccgac    177840
     tgaaagcttc cgtcgggttg ttggccagtt tatcctcgga aatagcggcc acacaagcca    177900
     ggttttacag ccatctgttg accagcccag tggctctgta gctacagagt tagctacttc    177960
     tgttgttagc tcgagggact atatgatcac tccaagcgcc ataaaggctg aaagccacga    178020
     cttgccccct ctgaacgtga aaaagagacc agcggaatcc ccaacctttt cacgaaagcg    178080
     acgtcgacat tcatactcca gctctcaaat actgggccgc tcgcagactt gtgcatcgaa    178140
     agagactccc aagccttaca aaaattagca ggcaaatgat aaatgataca attcaatacc    178200
     tgcaaatgct atctgaccac atcttgatct ccgacaccat tttgtttagg gagtgggcca    178260
     ctatgcatct cgccacccaa ttgctacaaa gctggtacaa agatatcatt gcgaggtagg    178320
     agatggaatt agacgccgta tccaagtgta ctttgtcacc gatacagcca gaagagaagt    178380
     gcacgaagtg tgctgccgcg gatgcggacg agctgtatga ttaagaggtt actcctttac    178440
     tacctcgttg gctatctttt gatagaatag ctggcccttt tggaaatgga cgagaaaata    178500
     tagtgttttg caactaaggg acagtattta agatcttgtt aagctcctag tctatcagtc    178560
     cgcggacaaa gaacattcag gtgcggagac cactcgacaa gcaaaaataa atatatatga    178620
     gccagctgca tcttgatctc caaataatgc aatagcgact aaagatgcct agagtacatg    178680
     tatgtaccag aaaaatcgga attggaagga tgaagcaata gcattcttca aaatgctatt    178740
     gccttgaata tcaattccag ccactctttg gttattcagc ccgcttcact cgtagagatg    178800
     caactttttg tgctttagca tctacaataa ctggaccatt tttgccgttc tgttaatcgg    178860
     ctcatgactg ctggtcctta caattcggct gtttggcggt cattctgtgt ctaaatgtct    178920
     gcatactcat tcatatgaac caatatagaa cagcttggcc ctatcattgg taagacaaga    178980
     aaatcagagc gccggggccc aatcagctgt gccagtattc gtccgagaat tgtgagagag    179040
     cgactcgctg tgctgaaaag ccagcttcca agccaaaggc atacctaacc ataaccaagt    179100
     ccaccgaatt ctctctcttc acctggaaaa catggtcgtt gcagcgttaa ctagatgctg    179160
     gtcgcataga agttgcgagt ggtcattaca tggccatgta agtggagctc tgtgcaacgc    179220
     aataattaca ggcaagtttg ccacttcatg agcctaccaa ttattgtaat aaccacacca    179280
     tgcctgatcc ggtgcgctcg tcgactcatg agcgaaacat gaggccgccg ttacaaagaa    179340
     gctgccgcag actctgactc gtttgatagc ttccgtcttt atttttggcg cgttgtcggt    179400
     cctagggaaa ctagaatttg tccgtggaca gtattcccta gcgccgtgta gggtaacaag    179460
     atcctgaaaa agttgagttt tgagcagtgc ggtcatctgt caattcgcat cgagtttcta    179520
     attagctcga gactcaggtt cattatggct gacagtttat tgtcagttat aaaaggatac    179580
     acgcgccgtt aatggtttgt atgtaagctc tgtggctgat cggccccatc ttacgactgt    179640
     cagtcgatgc tggcatctcc tatcacgacc gagagtcgaa tccctaacat cgcacgtaca    179700
     aaacaaccga attgcacttt ctctcttagt tcttacgttt tgaatccgag agaacaccgc    179760
     cctgtcatca tgtcatccaa cctacccaaa gacaacatga tatgtgacct tggcactatc    179820
     aaagctcaat atcagctccc catttcgatg tcggtcccca ccacccgcga gagttatacg    179880
     gcggccacca cgaatttaac aggacctcac cgccgcggta gattgaaggt tgtcacgggg    179940
     cctcccaaaa gcctttgcct accccacttg tgtggcctgg agaatatcgc atccgtcctg    180000
     attgtaagac aggagtcacc gtgggatacc tatcggaaag tcattacgta tgagaatgct    180060
     ggcaaagtta caattgctac acgccgcact cacccgtctc gcatggtagc catccggaca    180120
     tacgggaaag acaatgctcg aagattgata tacagattcg gacgtctaga acacaggaac    180180
     gttctctcct tacatgaatg ctacatgcac gaagatctcg cgtccttcct agttgatgac    180240
     ttgccgctga cgctggctca tgttgtcgct tttccgtctg tttatcctag cgagacagaa    180300
     ttgggatcca ttatctgcca ggttggtcac tcatgccctt cgatgagctg ttctgacatt    180360
     ttagatcctg gatggtgcct gctacttatc ttcatttggc cttgcgcatc aatcactggc    180420
     ctgtggtgat gtattatttg gcattgacgg gatcatcaag ataggtttgt taaccgccgc    180480
     attcttgcat tatctgacta aaatttcgca gcaagtttgg acctttatat agattgcacg    180540
     ccaaagcaat ctgaaattgc atatattgcg gctcttccgt cgataatgat gcggctcatg    180600
     cagaaaaatg gcaaagatca aggccttgtt ggcgtgaatg atctggagcg atggccaatc    180660
     gattctgccg ctgtggagat tttgtccgct accgagacgg cagaatcaat caggtcgctg    180720
     agaaatgtga gttctcctag caaggtatcg tgtttcgcta atgtccagta gcaacccctg    180780
     ttggcggaga agcaccgccc aaacgatgat ctggtggtcc tcgcaagagc agctctgctc    180840
     tccactagct tgaattgtat ttacgacccc ggctctaaaa agtgctaaag gacaagatct    180900
     ggtacgcaac tcagatatcc gcgaatcctc gtcatggtca taggcttcac caataagcaa    180960
     catttcatgc gtctcctaca gttatcttgc cacttcttag ggtactttgt ttcttccacg    181020
     acataatcca ttgtttttgc acaaatcctt ctcatgttgc gttctagtga acttagtact    181080
     acataattaa cgttacattg ctggtgaaag atcaaggcta acattgaata ccgtagggac    181140
     ttctggtgac atgcgcaacc tttgaagagc cgagtgtaaa gaatttcatg cgggcaatct    181200
     ccattcgata atgaagcctc atgcattctt ttggaggagc tcacaatttt cctactaaaa    181260
     ataaacttag ctcttcgaag cccaattctt gagatcgcaa cggcactgaa ttgttagacg    181320
     tccataaatt ttaaggcagc cagaacgcaa gaagtagggc ggggaaacag ccaaactaat    181380
     gtgaaggttt cagaagtacg tatgtatgtc gcttgcagac ttcaaccaat ggtgaatact    181440
     gggaagctga aacaactggt gagcaacggc attcaggggc tatgtctcca gcttttatta    181500
     cccccagcgg ccggttagtg atcgtcttta acactctaaa gttgagttgg aaagagccag    181560
     caccggttgg ttcatttcac cgctagtgaa ctagaagggt tggttggcgt acgagctatc    181620
     cacgccaacc ctattgtttc tcgcctcctt ccaaatttcc ctcgggacca taacttattt    181680
     ataaagacct cccctcagct tccactggtc ttcatgtttg cacagaacac agcactttga    181740
     ggttgttatt tgcaacaccc accacaaatt ccatgcatta cattactgcc ctttccttga    181800
     tagcctccct cctgggaatg gtagctgcca ctggaaactc agtccgtcga tatgtgcaac    181860
     tccgtgcttg gggtcagccc ggctgtcgtg ctagtaacct tggcgaggaa ggtatctaca    181920
     gcgattacat tggtttatgt gtgccatttg gtaattacga tacaatccgc tccgtgagcg    181980
     ttgagtctgt cgaatcagga tgcactcgta agtcccggca atttttagac tgtatgttac    182040
     cactaacaaa tttttagtgt acatttacag gaatctgcag tgtcattctg aacggattga    182100
     ggttcctctt atgaaatgcg tcagtggcga acacgagtat aaaatgtaca tattggtatg    182160
     cgatgactga gatgtacttc ccaggaagtg gtagccaatc gaatgcataa ctgggagata    182220
     tggaaggctg cattgaactg tattgtactt acctgctctg tctcatttgc accccaactt    182280
     atgcaagagg gggtttttga gacccgcact acaaccgaga aaattacagg aagataaacc    182340
     agtcagaaat tccagcaaat taacttctca agatgtcaaa atggcctcct cgaacttgat    182400
     ttgagcaaat taacctttgg tttcttgata caccaaacgc acttgaccgt cccaggttga    182460
     ccacccatga gtgtcggttg tggaggattg aaagaggcca gctatcatgt gcataagctg    182520
     acaattcgtt gaattatttt cctttgaagg ctcctcagcg ttagtcaatg ttatcggcaa    182580
     tggaagtcgt ttgaaatgtt gccgcatccc tggctttatg ctctaaaatt cctcgtgaag    182640
     cgttcttttc agcagacgca atatttcttt ttattataag ctgcccccct catttactgt    182700
     atctttttgc tatccgagaa tggacacacg aaccagtgcc tcaatgagag gtcgaaaacc    182760
     aatgtcaatg acaactttaa aggcgttgtt cttctgatct atatctctac agtactggtc    182820
     atgaatataa ataattggaa cttttccagc ctccatcaat tgccacagcc attactcgca    182880
     ctgaaatggc cccaagcgct ctacggtccg gcggccaagt gccaaaagcc attctgagct    182940
     gataccacta ctcggtgatg gttctgaacc gccacagaaa aagagcactc gctatgatgc    183000
     acacgcttac gcaaaatcac tacctccagc acctccggga tgaacccgga ctcctcgaac    183060
     gcggatacga aataaatacc acggagcaca ggtgtcattg ctagtaaagc caacagacca    183120
     ccgcggcggg atcaattgtc ataactggat tctacagatg caaaaggccc cggccgctca    183180
     aattagtatt tcgaagatac ctcactttta gatcgggatg ggctcaatgt aggctcaaga    183240
     taggctcagg gtaagctcag ggtgggctcg gggtaagctc aaggtaagct cagggtaagc    183300
     tcagggtaag ctcagggtaa gctcagggtg ggctcggggt gggctcaggg taagctcagg    183360
     gtaagctcag ggtaagctca gggtaagctc agggtaagct cagggcaagt tcagggtaag    183420
     ctcagggtaa gctcagggta agctcagggt aagctcaggg taagctcagg gtaagctcag    183480
     ggtaagctca gggtaagctc agggtaagct cagggtaagc tcagggtggg ctcggggtgg    183540
     gctcaggtgt ggccagattg gtctcaactc cggtgagggg aaattctgta agttccccgc    183600
     actgtattgt cacacttggt tatccattac ccgccactca tcgctgtttg ttttgtatgg    183660
     taactttaca tcataccgga acaatatact gtaatacacc gtaatcgtgc cacgtcgccc    183720
     atcatggacc attttaacag accctcaaat caattgtctt tatcatcaat tggtcttcct    183780
     cgatactgca tcctgcatct tagtagtgtc cagtatccag gcggatatca ttaatttgtc    183840
     tgtaaagtgc ggggtgtata tcaccggttc gaacacactt gaagcccggt gcccgtttta    183900
     cttgtcgttt caatctagtc cttagctgtg gtactatact acagtttcat gattcggact    183960
     cgtagttggc agctgcctgt atgtttaaga gcacgacatg acaaaggagg cacatatgac    184020
     gataccccgt tccttccacc aacatgacgt cttttacccg aaattggcca ggtttatgga    184080
     ggcgaaaatc aaacattctt gttacacggc aaagaccagc tctgccaaaa tttaaacgag    184140
     gctacatgtc ccaaccaaga taaaaagtat cgcacccata accctgaact acgaaattct    184200
     ccgataacat cttcaggaag tgaggaaacg gaaacttctt cctattcatg ccagaccaag    184260
     ggctgtttta gaagagcggg agacagtccc atgcaccctt tccgcatgat tcagtagcgc    184320
     ggactttgac tccaacttct ccccgcaaat agagcactca cagtacatgt catttgaaaa    184380
     cggcttgata tgcctgttga cgaagtgtcg gctcagagat ccagggttct tgtacatccg    184440
     caagcgctct ctttgtggca gactagggct accaaggcaa atgaagcaga tcgttggtct    184500
     ctctgttgga gatttaacgc aaaccgaagc gatagccttc gaaaacatat cgtcgctctt    184560
     atctgaagcg gttggattct gccttttaga caggggggcg gctggtggca tatcgacatc    184620
     atcggcggag cgtttttggg tgacacgacg ccgcgagggt gcaccctctt ctgcatcgca    184680
     taccgcaatc actgcattga tcgcagcaat tcgacgctca tattctttct cgatcnnnnn    184740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    184800
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnntctct cttgggtttt cgggctgtag    184860
     cgtttatgtc gaagctggga aacatcaaga gactcggcct cgtggaggta atattcgggt    184920
     ggaagttgct cctcttcatc ttccgatgct aggtcatctt cggactcaac ttcagactca    184980
     gactcggatt cgctgcttga gtcgaagaca ctgggtgcgg tggaggaatc agtgtcggaa    185040
     gcgtggtccg aaaaattctc agaatggcat gggctaatat cgctctcatc gccggacgga    185100
     atagaaccac gagatgccat ggcaggaggc gatgggtgcg atcgagaagg tacaagaagg    185160
     caagtcagag aacagggaat tggtagtaac cggttctctt ttcacaccgt ggccgtgccg    185220
     ttgaggagac cgacctgaga gtggaagggt tgcttggtag caagaaagaa tattgtgtcg    185280
     gggccatggc cgttgatatt tataaaatct gaaggaagga gggaaccaag gaggggagcc    185340
     atcttcggtt cctctgcttc aggagatgga tgagggtggg gcggcggcga cagttgctat    185400
     agcagaaggg gccttgttcg ggccaggtac caggcacagc caacacaaag catgggtggc    185460
     agtagagaga gtcggccgtg tgcattgagg cacgtgatgc caagcccaga gacggtgagt    185520
     ggagggctta aaacggcctc cgaggcggcc atttctggcc tcccattcac cgtctcatac    185580
     ttatgtgtag tattacgtat tcaggttatt tgagtagaag gatatacaat ggaggttcag    185640
     ctataatcaa gcctagtaaa agcaatggac tatcgagtct aagtgaaatt gaaagtgtga    185700
     tccgaaatgc atagaaattg tgatgcgtct gcattgcgtc taaatatgta tatgaccaca    185760
     aaacatgctg aacctacaaa accactcaca atatgatgcc taccagtcgc attagtaaat    185820
     ttattataac cacgacatat ggttatacgg catactagga ttcaccttta ttatgaccaa    185880
     ttatctgcta tactagtggt tattgggggt aggtgacaag tgatagattt ccaaaagttg    185940
     aaccccctat tcaggaaact tacataatct gagggtggca aggtctagac gttgaccacc    186000
     tttttcaccg cccgaccatt caccaccacg ctcaccacca cgctcatcaa cacacatcaa    186060
     cacacacatc aacacacaca tcannnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    186120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    186180
     nnnctcacat caacactcac atcaacactc acatcaacac tcacatcaac actcacatca    186240
     acactcacat cagcactcac atcaacactc acatcaacac tcacatcaac actcacatca    186300
     acactcacat caacactcac atcaacactc acatcaacac taacggttca acactacaag    186360
     cattccaaga caacactcat ctctgtttgc atacatctgg atgaaagatg ccaatttcta    186420
     ttgtagcgag gaagctattg gatcacaagt taccaaggga aaggaatgtg aaatacgtca    186480
     tttgatactg aagacgcttc agttgttagt ttatgatttt ggctattgaa ttggcaaaga    186540
     tctaactagg gccccttcta tgtatccaat gatgaccctt cggaacaatg aacagacgat    186600
     gaagatgttg cgcaggactt tgcttctccg aatactcttg gaacactcga atactggtcc    186660
     ctagcaccac gaagaggcgc ctgcacgggc tagaggcgct tgttgtcgca gatgcccctg    186720
     cgaggcgctt tgttgacgca gggcctaggc tgcggagaac ttggtaatgc agcggtctcc    186780
     tgcagagaac ttgttaatgc agcggtctcc tgcagagaac ttggtaatgc agcggtctcc    186840
     tgcagagaac ttgttaacgc agcggtctcc tgcgggtctc acttgtcatc acagcgtccc    186900
     cctgcggagt tcacttggta acgcagcgcc cccctgcgag gtagtcttgt tgacgcagca    186960
     cctccctgcg aggattgttg ttgacgcaga cctatcctgc ggggtagtct tgttttcgca    187020
     gcacccccct gcgaggcata ttgttgacgc agacctatcc tgcggggtag tcttgttgac    187080
     gcagcacccc cctgcgaggc atattgatga cgcagaccta tcctgcgagg tagtcttgtt    187140
     gacgcagcac ctccctgcga ggattgttgt tgacgcagac ctatcctgcg gggtagtctt    187200
     gttttcgcag cacccccctg cgaggcatat tgatgacgca gacctatcct gcggggtagt    187260
     cttgttgacg cagcaccccc ctgcgaggca tattgatgac gcagacctat cctgcgaggt    187320
     agtcttgttg acgcagcacc tccctgcgag aattgttgtt cacgcagacc tatcctgcga    187380
     agcacctttt tacacccgcg gggctcgtgg cagcgaggga gcgcaagtct tacatcactg    187440
     ggctcgtggc agcgacagcc gtggtcacgg agactctcaa gcccgcaggc aagagaggga    187500
     caccatgaca catcggtgtg tgaggaccga agtcctgaat ttttttgggc tgggaatccg    187560
     gctcctttta tattttttcg gctacgtctc taccaaggaa ccagttgcgc ggatagtagc    187620
     gagaatcact gtctcgttga tacgcgttga agctatgtaa acgacgttga aatgattttt    187680
     cgagactttg tggcctaaga gtcaagcctc gacctggaat aattcctctc aaaattgtgc    187740
     gttgagtgtg gcgaaccact ttcatcggct gttgagaaga aagtaatgtc gcaaaagtaa    187800
     gattcgtacc tatcatcgaa tttgcaatta aatcgctcaa cgcgcttgca ctctacatct    187860
     ccccgtttta accacggtca ccgtctcttt catgagggtt gatatcgttc aacagatgcc    187920
     gaaataatgg gttgggactt tgtggccgac ggaaacgctg tgctgtacac ctgcggttgg    187980
     ccggaggacc ctttggtctc actggtatcg atcctgtcca cctctaggct cgcgccgctg    188040
     aatgttattt ctttcctttc cactcgcggc taacctatgt tgcctttact aaaatctcta    188100
     ctgggcgcat aggcactggc atacttctaa actcaggatg aagattgtct tcctttggga    188160
     ggacatgata gccaaaaaaa ggcccagacc ctttgaaaag ctcacaaaaa actgggtcta    188220
     gtttccagga caatcacgtg aactgatgca accaaggccc acgagctagg ttctcgtgat    188280
     cgccaccccc tcgcaagatt gcaacgctac tatcacactg atgatacact ggagacgaat    188340
     agcaatcaaa caccacgcgt gaatttagac agacgcaggt acggttgtgc gatgcagatc    188400
     tcagcgacga cccacgggac agtagatcag ggaggttcta tttgtgcccc ggagagaaat    188460
     ggaaagaatt gcaaaggtcc agacacgatc cacaagccca aagttttcgg ccatcagtgt    188520
     ccgatggaac gggggattgt tgcctaggag gtactgctgg ggcaggtgag ttggtaggct    188580
     acaacccgat ccgtggttgt gttctcctgg tcagagtcgc gagaaagtaa gttcccctgt    188640
     caagtggcaa gctgaacttt gcctatctgg tctgtggaac gttctagaag ctacgtatct    188700
     tctcctgcac caagcttttc cctgatgatt atactggtta tgttctcttc gagccagaca    188760
     attcctctcc atgtgcccaa ttctatcgcc agtctgataa ctctagcaga tggcttgtag    188820
     aaataatgcc atggatcaca tgagcttgcg taaatatctc cggtttttga actaaacccg    188880
     gaaaaacgat tggctcccgg gagtcgatgc tgtgggccgg cctacctgcg gcacctaaac    188940
     tgtattccaa gcaccctgcc caactcgata atgacgctga atgtagagta tcttctaata    189000
     aaatattgcc ctttcccaat atcctatata tgagcagact gaggtttgtt gatcctgctc    189060
     cggatctgtt ttcttttggg ctagcaacct acaaagcaag tgtagcagag gctggtagat    189120
     aagctttcca tgaggatcat tcgtgacagc cgcatcctct caccgagcga gcatttccat    189180
     ggcttatcga accttatttt ccggcgatcg gcgatcgatc gacgatcccg gtaatgtgca    189240
     cgacctctgg ggaactaact tttgtcaaac tataaccttg gtactccctc gctattgtcg    189300
     taatttcaag gaatggtgct tgcttatatt ttgataatat gtgaattcgt acgcacaata    189360
     atcaggcagc agcttgattg ctcggctgcc atattctccg ttcgtagcaa catccaacaa    189420
     cactaattca tcgaggtcta attgctattg ctgcttcgag atcgcgatgt agcgcggata    189480
     ccaaaaaact gctggtagca tggatgttcc gcttatcggt atctcagctt cctgcctgca    189540
     cagacacgat gtacatagtc gacgatcgtg tttcttcacg ccgtgaaggg cggagtaatg    189600
     gcatcgcgcg gcctgtgatg catgattagc ttgtagctaa aggtggatgg atattaatta    189660
     gtacctggtc tcgagccttt cctctttgtt gattcaatgc tgtcgatctg gctagtctca    189720
     gtggttagga ttgcttgaaa ccatattact ttgcgcaggc cttctgcttg tgagattcgc    189780
     taatgaagcc ttatggccgg tcgagcgatg cgctcctgct cggcttggat ggcttggatg    189840
     gcctgggtgc tcaagcggtc tggcaccaat gcgacgttgc ttgcgcagaa tatggtactt    189900
     tttccctcgc agagactcaa cgcttcggtc cacctgatat tgttcataga tgcgtgggag    189960
     cgggctttcc acggcagctc ccgatgagcg tccagccagg agaggaggtt ctcttcctcc    190020
     cattctggcc agactacctc gcttcgaggg gacatagcgc tcgcataaac tagcagcaac    190080
     cagaagagac cttttcagac aatatcacga cttgatttcc cgcacgggtg ggaaaagtga    190140
     gcctaaatcc tctccagatc cctgtaaaag ggtaatattg tgccctggtt cgctataaac    190200
     ttatatatgc tcaataacat ggcccatgga ccattttgcg gagtcgcttc ggtgagtctg    190260
     aactttgaac gatcgatgtt gtacttcaga ctcactcaaa ctctcagcgt tgaaacagtc    190320
     cttagctata agagcgacca gcttccaatt tcgtacttca ggaaattgtt cttgaatgta    190380
     actacggtac gtcaaaatga acacagcaac gaatcctcag accaagcccc accggctact    190440
     gaataatgta acctcaaaca gactttacag gcaaaacctg ccttcctaca aagttaattc    190500
     ccctaaagtt taatgaaact cgtggctgat tggctgaaat ttattccaaa tcaggcggaa    190560
     attgtggtaa gtacggatgt aagatagtgg gcttgcaaac cccgatcaca agttccggtt    190620
     tagagaacag aatcttcata ccagcctgtg cgacttctcc tgtaacgttt gactgcaaaa    190680
     gctcggtatc ccgccctgac tcaggttcaa ctatgggtag aattcgaaaa cttccgttca    190740
     ctggtcaacg acaaagcttt cggagccgat tacaacgtgc actgtccctg tcatcttccg    190800
     ggtctgagga tatctggagt ccgccaagat ccgcggcagg tgataccaca gaggaagaat    190860
     cttcttttca ggagaatggc tcgtttggca accactacaa cggcattgca gcggatgatg    190920
     gccaggaaaa tgcatcgcat acctggagta tgggcccaag accagaagaa ggactggaac    190980
     ccggacaaga taatctctcc ggggactgca atatgatcgc cttacaatgt gcggcggagt    191040
     aagtggcaat tcgcccgccc taaatggagc tctgtgatac gtctgcttac aacaattagc    191100
     ctagatatcc gaacgaagtc agttttgcga cgcatcagag aaagaacaaa ggctgacctt    191160
     tcccaggtcc atgcagaagt cattgggtaa tcaaagcagc tggactgcaa ctattcgcag    191220
     tgacctggag ggcatccgca gtcggttggt ggtcgtggag acagcaatgg agatgatggc    191280
     caaagagggg gaaaacaata ctaaagagga taatgcagct aggcggaacc ttcggtcgca    191340
     acagtgatct ggatcgaaat atgatgaggt ttggagaata tattccaggg tctgttgtca    191400
     gcccttgtcc gctggggtat caccagagca gactatcact tgaagctgca aataactgta    191460
     aggctgtggg acagtagaca aatcattact atgattccgg tgtaacgaaa cgaactccct    191520
     ggaatggatc gcttggcctc gccagtgaca gttgtgaact aatacgctaa gccgtgcatt    191580
     aagcttttcg ggagtttaag cgccagggtc tcattttagc gaataccctc tccctagccc    191640
     accagtgggg gatcctcacg tcacattcag tgatgggtca atttgagatg catagattgg    191700
     ccgtcgtact cttggttgag tattccaaat cttatgaccc gcggatagcc cgctcaattg    191760
     gagtttcggt cactgtgggc ggaccagaaa ataccgtagt tcatgccagc gtggtaggct    191820
     gtcgtctggc attgtattat tttggcgagg aaattcatgt gccagagaag cgccaataaa    191880
     acagccaatt tcttgatgaa tgtcgccgag tcacttggct gtttcttcat gaatgtcgcg    191940
     agtcacattg cctatcaaat actgggtggg gacaacggtc atgatcggtc agattcggtt    192000
     gcttccgacg gatcagcgca tcatctcccc gggctgtggg ccctgccgct aaccacattc    192060
     agcgaccatg gaacattctc tctgccttcc aagctgcgct tggcggagcg agtctaatcg    192120
     tcaaaggatt tatgtcaata ttctttccac ggcagaacac cggacaccaa ccatttcttt    192180
     ttctattttt actgttgtga tggaatggct gtggcgttac tgaagatcat ctcatgagct    192240
     atctatctgc gtagtggcta tataaaccga ctagccggtt cctccatagt aaagccagga    192300
     ccgccggaaa cgctgaattt gccatgcttc acacaagtga ttaatattgg ttgattgaaa    192360
     ctggcgcctc ttgagttaca agcggataat cactcgaagc ggaaaacccg ggtagggcat    192420
     tgtgacctag agtgccaagc gggccatcct gctcgggcca acttccgtgg atccctccgg    192480
     agctaggcaa gtaaaatgcc aacctacggt tctgaagggc gtcgatcgtg tcccggaacc    192540
     gagtagtcgc cgataccagc tcgccatgtg tttgatgcaa gacaggctga atatcgtgcc    192600
     atgagaccag gccccgcatg gtggcgtgcg atgactcctg cgcctgctgc aattggcaga    192660
     gctctctttc aatcctctgg ttctcagcca aggctttgtc ttttgctgtg atagcccctg    192720
     tagtttcgac gtctccaggg ccttttcagc atgcagacgc tgcatcgact gggagtcatg    192780
     gactctctct ttgtctatct catcaagggc tagctggtac tcctcttgga tctcgtccat    192840
     catagctaaa cacttttgat gggttgcttc attatttttc tttcgggcgc tttttgctgt    192900
     agaatgtccc taaaagctaa cgtcagcaag atgggtcata aggtattgat gaaataaagc    192960
     acaaggttac aacaaggctc gagcgaggaa agggaaacag agattgacct accaggcctt    193020
     tgtgcagctt ccctaccgcc ttgagagggt tacagtccgc cctgctttga aagacttgcc    193080
     gatagattac taccgtagat tgctgtatca tgccatccac ggtctgagaa tgaagatccc    193140
     cagtgcgatc atatgtttta tttctcgtaa aagctatata cagtgtaaag ggaaggaggg    193200
     aaagggttcg ctgttatata tctgattctt ctaggcagtc ttgcaaaaca attgcggttt    193260
     ttgcggcata agagagctac cgacccctgt gtagtcacag cactaaatgc attaaatcgg    193320
     gtaggccgca gcaatatgat gttatagatc atttaacaac aggaggaatt catgctactc    193380
     actcaaacgg tcacctcaac atcagtcaac aagttcttca gatgtgtaca acgatatcta    193440
     tttaggggaa ttctgcagct cgcaagctgc agatcgtttc attaatttcg gccattattt    193500
     ataaaacccc caaaaagggc caaaattcac agcttgagtc actatggcgc acgaaatttg    193560
     ctatatgaag gtatgtttgt caccaaattt gacaaccgca gtgccagatg cagaccgcca    193620
     attcaggcct atgcaagcct cttcttctga tatataagcc tgcagtgagg aaaatacgat    193680
     atgcatgtga ggacagcttt tttttctgat ctcgttcatt gaatttttct gtttttagat    193740
     gtcatcaggt agcgtacaag tggtggcccg aacgcggaga tcggtgccag atgaattgca    193800
     agacacaata aacgtgtggt atcaggtatc gcaaagaaag aaaaagaaca tgactatctc    193860
     tccgatgatg attgggagta gtgaaacaaa cgctatgcgt ttcctgccgt caaacatgga    193920
     catgcggtaa gagacgcagc gctgagatag atgataaaat aaaccccttt ttttggtgaa    193980
     ctttccgggc atgaaagacc catccggaaa tatcttgaaa agcaagacga aaaaaaaagg    194040
     aaaacccatg tggcatcaac cgttggcgac ccgataaaca gcacgaggga tatcagctgt    194100
     acatattaag gtcataagaa gaaatagctc tcgaaattgg tgtttaataa cctccatgca    194160
     tgacaaaacg cccagtgaat gctgtgataa cattccggcc acggagccga tgagatcgag    194220
     aaaaacagag caaaaagaag aagaattcca gatgtgcgcc atatatgcaa tgcatgatcg    194280
     tgatcgtagg tgtcaagaag aaaagctgtg ctgtgttgta aagcaagtct gtgaaaattc    194340
     aaaaagcgtg taggtgaagt ggatcgcagg cgaattaact accatccctt cacatggtac    194400
     tcccagggac cgtaatcggt ggtgtagttg gtccaggaga cattcttgcc caggtcaaag    194460
     ttagcagcaa tggggtctgc ttcagcacta gcctgattcg gaccaactcc cttgtgtgga    194520
     ccattaggac cagggtactc ctgaaggttc ttcatgtcgt gggcggtgtg gcgacgcttg    194580
     aggaaagcgt tcgctgtcac actcttttgc tggcgctccc agagaagatg ccggcggagg    194640
     gactccgtca attcagtggt aagcatgtta cgacgggtgg tccgcggaga gtgtgccata    194700
     gactgcgaag cgttggtgtt catgacaata ggcttcgatc ggggaacatc ggcgccacgc    194760
     atgaccgagc tttcctcttc cttgctagga ggggactgct gaatagatgg accgctgggt    194820
     gaggtcaacc gcgatcgctg aagtgcggga ctaaaccgga atgcatttcc ttgcatgcgg    194880
     gccggccggt gcatcatcat agtgagcatc gagcggcggg agaccaggtc gggccgggaa    194940
     tcaacccgtt ggaacattcc tccttgttcg tcaacgctgg gctcgccacc ttcagcgatg    195000
     gaatcctccc aatcagaatc ctcagcgtcc ccgatcgcac tctccgagac ttcatcgtcg    195060
     gtctcaatgg cgtcctcatc agatcgactg atgaccctcg agttagggat gatgtgggac    195120
     gagacctgat tgctgaagga agctgtcttt ttcgtagagt ccgggttgtt gtttttcggt    195180
     ttcaaccctc caccggtcgc attctcctgg gccgtctgcg gaaccatgcg ctcttcgaat    195240
     gagctttcat cgtcatcccc agaggacccg cccaatgtaa acacgcctcc cttcttcctc    195300
     aatggcgatg gcttcagttg cgtagtagaa tgggaagggc tagggtcgat agaccgtctt    195360
     ggttgcgatc tgaatgaaga tgagatgtgc gatggcgaga atccacgaac aatgctggta    195420
     gacctgacca gttcaggtcg gctgggaagg atgccggaag ttgagacact ggtatcggac    195480
     gcgttgaccg tgcagtgtcg ctctcgttgc cctccggggc agtcgtcgag caactcagtc    195540
     gactcatgag ggtatggggt cggtcggacg gagaaatgag ggacgtgacg ggcggtagag    195600
     acagaggggg tggatgggcg aggagtaacg tcgacgacgg gggcagcagg ctcgacggga    195660
     tgaggcgcgg gcttcagttg cttcttttcc ttaatgttga ggaccatccg ctccaaacta    195720
     aacgaggtga tgtgcttctc cttgccacag ccgaggctgg ctagtgagtc ctcgcgaacg    195780
     acagcaggtc ggtagtagaa aaacttggga cgcttcatat aagcttcgat tcgctcggct    195840
     tggtcagatg cggccgactc gacgctggcg gagagttcgg gcaaatcccc agcttcggat    195900
     cgtagcaatg ggagggcaga agtgctgtta gacttttcgg gttcgacaca gaaggtttcg    195960
     cgagtccata gccgccaact gagattctca agtcgacggc cctggtccat gtagtcggca    196020
     cattttgaaa agactgtgcg gcaagtcagc aaaacaagat atccctcaac cagcagaatt    196080
     gtctcttacc catccacatt ccatggagac tttgagcgtt cgcggtatcc accttatgga    196140
     tattgtccgc gtccaccgtg agaacggggg tcgttaaagg cattttcgcg aagtcacaac    196200
     tagcaaagaa ggaattggtt ttattgaaaa gttgattgat attccggggt cgccgtctcc    196260
     cccgagagcg gtcgtacggc gcttgagatg cggtggtgaa tgttcgtagg aatcaaccgg    196320
     tttctgggtt tctggaatgg gccttgacat ttgagtctgg gccctacggt gtgctgcaga    196380
     gtcgacaaat cgggtttggc gcctaagatg caatcgaatg ctcacgggaa agatgtggat    196440
     agtgaacgga ttcgggtttt aagcgaagtg aagaattagg tgggatgtcc gtcgattttc    196500
     cgtaagagcg ccacagtgcg gagattgcgg ggcgaggagt cggagaaacg agagggtatt    196560
     gaaagcggtt tgaggtgatc cttcagattg acgggtgaga gagattgtag gttgagagtg    196620
     aggagaacgg ttagaaaatc tggagaagga agaggaggag aaagggagtc ggaacgataa    196680
     taagaatgac ggggcggcac tttggcggag tggggtggag agagcggaca ctaggatcaa    196740
     ggcacggcaa taaagtaagt tacatgaacg gtgtttatta atcaagattg gtgggttcgc    196800
     gccaagccct gcagattgct tgatgcggcc gtagtggatg cgggactgac aagaaacctg    196860
     acgcggactt gaagttgacg tctcaaccct actccgatat tcattccctg ataattcgtg    196920
     gacatatcaa gctcactgct caattcagat caagttaatg atttcttcat tcttgattat    196980
     acatggtttc acgtgttttt tgcaaagctt atttgaaagg gagtatgggg tggatgattt    197040
     ctgaaacaac ttgtgagccg tattatcctt taactgtaac caataccagg agacaaactt    197100
     agatattctg ttgaatatca gttccgttta atcaagccgc tcaccccgtt caagccctaa    197160
     gggaggcagt tggcaccgtt gggatcgacc ccagggctta tcagctttca tcagcaaaat    197220
     cactagtgtg caaggccccg gaaaaagagg ggatgatagc acctacttca ctagtaacga    197280
     gggcatacca ttcccggatc cagctcacag taacactgtc ggaggcatgc ctgtggtttc    197340
     cgacatccat ctactccaga aacagcagca cttcaaccaa tcgaaagaat ctggagagaa    197400
     tggttcatac ttgtaagtct ctttttcgta tgcgtgtaac gcaatgtttg tgtctgactt    197460
     tcccaaggtg gcagtggagc cttcagacat ttcgagacaa ataaagatgt tacggcgtat    197520
     tgtaaggttg gtttacctaa aaggcatact ccacaacctc tcctgaagta aaggccgatt    197580
     tcttgaaaag cgtcggcctt aaagccccgg tgttcactcg attttccact gtcaccctag    197640
     gtcgcgagtt tcccgatcga gcttgaaacc gtcgtacctt tactattcaa ttttgcacgg    197700
     aagagggcaa ctataatatt atcggctcga actttgtaag tctcgctata ttctatccta    197760
     tcttctccta cttattattc caagctgatc agaaatggta cacctcttta tacgtatagg    197820
     gtaatatagc tgtgttagac catatatagc tttgcgcgaa tcgttagata aatgacatca    197880
     tatgcttcca tccagcggag ggctgatatc acatatcgtc atcttgctcc gccccgagaa    197940
     tttctattga aataccaggc gaccgcagca cggaatctga ataacgagtg gatagatcca    198000
     ctagtacaat atgcaatccg ctttgaaatc cgtgatcggt cctaaaaaac acattcacga    198060
     cctcgctggg caagtggtct tggtgactgg aggcgcactt ggtataggat tagtctatcg    198120
     ctcaccgaaa ttagtatcat attctctttg tgcaattggt actaatagaa gagtgtaaag    198180
     gtacgaggtc tcccgtgcgt tcgtactaaa tggggcgcgg gtaatcatgg tcaaccgcaa    198240
     acaagaccaa ggacttgcgg ctatagaaaa gattaaagaa gaggccggta acgatgccat    198300
     gattgaatgg atcccatgcg acatgggtaa tctggaatag ataagacaga ccttcaccaa    198360
     acttagggag caggaagaac gccttgatat tgtatgtttt gtgtcatgtg aacttgtttc    198420
     ccggatcctc ttactgactc cacagctcgt tctttccgcc ggaatcaacg caaaccagta    198480
     cggcgagatg acagataata tcgaccggca ttcctaggta aactggttgg ggcattttta    198540
     tgtctgtaat cagctgttcc cgctgttacg gaaaacgtca aggctgcctg atacacctgc    198600
     tccactaatc gtctttgagg gttcggaaca gcatcgtatg actccatcag atgttcattt    198660
     cgcctctctg gatgagatca acaaccctaa agtcggtaat cttcagttgt attgcaggac    198720
     aaagctcgct atcattctcg gggtcaagta cagactcttg gaacgagtga tccgaccgaa    198780
     caacgacaat atttacgcac tctctgtcca tcccggcacg gtaagtaaag tgcatggtta    198840
     tcttctgctg tgctagtcca aggctgacga ccagtatctg taggtcaata cggccatgca    198900
     acagcaatgg aaggaagcat tcccaggacc cttgggtaaa ctgctgacta cggccatgtt    198960
     gactctcggc agggatgtag agcaaggctg ctttagcgcc ctgtacgctg ctacaagccc    199020
     tgagattgtt gagaaagatt ggaatggcta ctatttcaca gacccgggcc agcctggaaa    199080
     agagtcgagt caggcgtctg atcctggtct aggatctgct ttgtggtatc tcagcgagct    199140
     tatcataaag gataggttgg ggcagtgggt gttggttgat tggagaccta aggtgtgacc    199200
     gttccatata aatgccggaa taatcggtag agctgtctag ggactgtgat gcactagaaa    199260
     cacaagtgtc tatgacgcta gtatcgcgaa taagctttgt cctctccctg atccctggcc    199320
     tagtagagtg gctatgacca tcggatgagc ttcatatgtt gaatgctttt tgaagcaatc    199380
     ggaaattcga gcgggcattg atggggttct cggctaagga aggactgaat tcaatcagtt    199440
     aaccagtgaa tcaatcatcc gaattttttt ttttttgggt gcttcatctg ttaggccgac    199500
     catggctcgc tttctccagt ctagacggac agacccacac agctcaacac aaccagcaca    199560
     acactaaagc gaggccgggc acagaagtcc aagctttcta gggatggaat tataggcact    199620
     tttcggtgat tcaacgttga gtcgctcaca gatgaggtga tcagaacaag aattatgggc    199680
     ctgtcattgc ggattgaatt tctcccacaa agcctcaatt taagagggcc gtgaaggatt    199740
     caacagtcag ccaacgttgc ttgaccggct cagcatccct ttttcccaac atcactctta    199800
     atcgcctctc tggccgagca cccaaagcat caaagtgtca ctacaaagct tcggggtgaa    199860
     aagaagccat gggtctcaac aggcctcaat taagaggtgt gttcctcaac gcttcctacc    199920
     acttcacttg attctgcata gtcgagcagg cttgtgtctg acgcactcga taagttctcc    199980
     ctttgttcga gtactggaat ttataccgta attccattta taggatacat cgtggactag    200040
     caaatcagac agcgtctgtg agaggcgtga tccctagcag acccactgtg ccattcacgc    200100
     cagccgatca acgatacgag attaggatta gctagttaaa gtgtctatgc gaagatgtct    200160
     ccgctatagc agctgactga gctgatcaac tgtcgcgcct ctggatgtac ctcgaatttg    200220
     aagcgcgact gctcatactg taggaatgtg aaagcccaca aatcctgttt gaaactgtac    200280
     tgacttgaaa gacgcgggac aaccagatcc gtggacattc gaccacaatg caccagcgca    200340
     agggccacag ctccttgccg tctcttcaac tcagaaacga agggagttgt gcctcacctt    200400
     ctccttgcac gcagatctgg actagcaaca tggccaacgg cgaaggtagg gctcccctgc    200460
     cattaagcaa gacgaaacat cggcatttct cggtgtctgt cggattatca ggcttgaaaa    200520
     gacgccagat gccatccgag aacaacgtgg ggccacacat tggacgccac taatgcaatt    200580
     cacgagggct attctttcac ggtgttcgaa tgccgaaaaa cacacggtgt agtataagcc    200640
     cattgggatt tggggtatgt atcgggtaga cgcatcagca catgacctga ggtacagagt    200700
     cgactgaaag agaagtgcga aggtagagac gatcagaacc ttacattgac tcatcatcaa    200760
     tgccacccat ggtcatgtga gggtgataga gtgcatggaa tcgcatcggt atcggggagc    200820
     ccgagcagac aatacacttg cgcgcttcga attcgactcg agtgacggga acatgagagt    200880
     accccctatt gtacgatccg agtcagcaag gctcgaacca cttggacgag ttgttatgac    200940
     ttatctgttc ataaagttcg cagaattctc gcttgaaacg agacgcttaa ttagcttcgt    201000
     gatcgtatca tcttaccgac aagatcactt acgatcgtct tcgtcaatgc agtcaccatt    201060
     catgccatgt agacatgatg ttgtatccgg ttcgtcgcat ctccggctgt cgcttcggag    201120
     aagccacgct gggcgcaccg ggcaacttct gagtagacct cttcaagtcc catgggacta    201180
     gacttgacct agtcctaaat cccagggcac cccactccca tgggagtacc taacatttcc    201240
     agtgctttcc atgggagtgg ggtatgctcc cattgggatt ccccaatttc ccgccaagac    201300
     ctagattttg cataaataac cacaaaggta tggataaaat cgctgactac tcattcaaaa    201360
     ttactgttgt ttacacctgt tctagctatc tgagggttcg cactgttcat ctcgatcccc    201420
     tatgaaatta gttgacagta ccttcgactt acatagtttc tccctactag agatatgaaa    201480
     ttcggttttt gatggttcaa acatatccat ggctttttaa agtaaattcg cgaatcgtgc    201540
     catgtgttcc cacatgaata tatatattca ctagagaata gttggtctat gtttttaaca    201600
     accatgaagt gtggaacgtt catttttaga cctctaaatt tacatttgtt ctttagtaga    201660
     tgctataatt gttgggtctt taatttcaca ccttagtttt gtccagggct tgggtctaac    201720
     cctctaggaa actcatggtg gacgaaaact tcatacaaaa tcagctgggg aaggcggctg    201780
     acccccaaat ccacaggatg gggattttct atgagactgg tggggaatga agtgtggtta    201840
     gtggggattg cagtaggggc taatgggctt tgtagtggga gtaatgggaa ttccccatag    201900
     gactaagggg ctgcgtccaa tcagcgacat atcttcggag cctagctttg tgatacatca    201960
     agcattagaa aatagtcatt ttgcttaata ggcctaaggt ggcgtagata ccatcgtacc    202020
     tcgcgagaac tcaaagtaag tcttctctat ctcccccagg gatcggtatc atggatcagt    202080
     gtagccagtc ttctgatgct ggcccttcaa accgctacga agaacatctc gatagacttc    202140
     cttgcccttc atctgaccct atacagtcat tcaatcccga tctcaactac agacaccaaa    202200
     cgaacacatc agctccgctg tttgaagtcg tccagtcgat ttcaggtcct gagtctctcc    202260
     gacgggttgg ccccgatcgg aaaaagattt atgtgcttta cgacgatatg tcgaaggaac    202320
     aattcattgc ttggtggctt cagacacaat atgcgaccgt ggagggcaat gacaagagaa    202380
     tcaactggag gtcgaaacat tcttcggaag tttgggataa tttcgaccag gtggctcatc    202440
     agcttactgg agaagcaaaa gtcatgtgtc gaagttgtgg gaaagtcctt ccccatccgc    202500
     aggagaaggg ggatggaaca aactccatga gacgtcatct cgggtcgaat tcatgtcgta    202560
     gagtcacaag tgatcagttt cagcagcaag gtatccaaca atcgtttgag tttgcagtat    202620
     gagttctatg aggaatcctt ccaagtctcg acgctaaaat attacctgta gtctcagctc    202680
     agtccccagc tggctaagag ggtgttactc aggaacaatg ggcacgtaag caagtgatct    202740
     tgcttgctaa atcttcgctt tcgttccagt ttctggccaa gaaggacttt gcagaactca    202800
     ttgagttggc gcagttagcc ccgtcaacgc cgcaattact caacccagtg actgcgcgtc    202860
     gccgcctcca gtcgatggtt aaagagggcc aggaaagagt cctcctaggc cttccaccaa    202920
     ctgcaaagct ctcgattgcc ctcgactgtt gggcgtcccc gtttcagcaa gcctttatgg    202980
     ccatcactgg ctattttatc gacaaagact ggaagtatcg cgagactctg cttggctttg    203040
     agccgctcca tggtgcacat tctggtgtaa attcaagcac cattctgatg gaattacttc    203100
     aaaagtatga tattgtcaaa cgcgtcctag cgattacaac agataacgca tctaacaaca    203160
     ataccttgat cgaaaatatc caggagccta tccagtcact caggctacct aatcaggcac    203220
     ttattgtccg gataccatgc ttagctcatg tcattcagct tagtcttcgg gatcttcttg    203280
     gtcggatcaa agccaaccca aaaaatgaca acccaggcag ggtctggtcg gattctcaga    203340
     aacagtccct tcgcagcagt cggggtggac acttccaaat tgccgcaagt ttttgcaaat    203400
     atccataatc gcagcctggc tgcattcagc ttctgcggcc acctgagaga ccggctctct    203460
     atcatatccc ggttttgacg ggggaagcct aggagccatt ccgcaagaac gaaacgtaac    203520
     ttccaaggct gaagaagcct tttgctcaag gtaaacagga tggaaggagg gacacaggaa    203580
     taccgtttgt aatggcattt tcgcacataa gacagtaacc tgggtccagc agtataatac    203640
     tgttggccat tgaaagattc agctccccga ttccccgatt ccccgattcc tcaggcacat    203700
     tcagagagat actctacgag ctgcatgttt acaatgtctg gcaagtctgt cctctagccg    203760
     catccgatgt attgggcata tcattaactt ccatagcttc cgaaacgtca cccaccgggc    203820
     gtccagcccc aggctcttta ggcaaacgca ccgttgcaga ggttttggga agtttatatc    203880
     tcgaggcctc tctccctcaa aaagctcgat ctcaagaccg gccagggtcc ggaatttttg    203940
     gataccgaaa cttaaggttg tgagtccgat tggcacccgc cgtccctttc tattgaccgg    204000
     gatatactgg gtatgatgga caagttgatt gcacgtatta cgtattcacg actgtacatc    204060
     caccaggatt ttgcagtgtt gatcgcgatg ctccagcaag gccttgaatc ccttgtcaac    204120
     cacctcgtct agggatacat gcgaggtgat catcgcttca ggtttcagtt ggcctagaaa    204180
     agtgttagaa gaacacccca taaaactaga gaataatttc aaatttagat ataacaggat    204240
     atcgcaaact taccgtcgct caccgccctg atggtgtcca caaatgacgg ttcatcaaat    204300
     aatgcagcac ccatataccg cacctcattg tacatcaact ggttcactgg gagcgaagga    204360
     ctcttttccc acacagcaat attgactatt gtgccctgcg tgcgacaagc tgggatcgca    204420
     cccacgatcg ccttctccac gccggccgcg tcgaagataa catccgcccc gattccatct    204480
     gtcaactcgc gagctttctg tgcaacattc acctcccttg ggtccagtat atgtgttgcg    204540
     ccatagtcca ggcagtattt tttacggttt tccaggagct cggataccat gatattcttg    204600
     gcgccgtgaa gcttcagcac ttgtaccacg ccgagtccga ttggcccacc gcccaaaact    204660
     agcactgagt cgccaggctt gaacggcgat atattgactg cgtgccatgc gacagcgaac    204720
     ggctcgatga atgccgccgc ttctagtgat acgttttccg gaatcgggta aaaatgtcct    204780
     gctggcgcca cgattttttt ggacatgcct ccaccatacc ctgaaaaaac acatcacatc    204840
     agcattgggc ctatataggc tttatacccg aaaggctgta acataccact cagacctatg    204900
     aagccgatgt cctcgcaaca gtggctgtac ccctgattgc aagcggtgca tgtcccgtcg    204960
     acaatagtcg gacgcacgac ggcgcgctgc ccggggacta gatttatcac atcctcaccg    205020
     acttcctcga tgatgcctcc aaattcatgg cccattgtta ctgggtatgt ggatccggtg    205080
     atgtggtgtg gttgcttagg gatcagcacg gggccactaa tgtactcatg caagtctgct    205140
     atgggtcaga atgacagttc atgcacaata agccgtctca atatgattag aaacccacca    205200
     gtgccgcaga tcccaacata ggccggtcgc atctaaaagg gttcatcagt atcaggccct    205260
     gtagtatcgg ggtgggacga accttgactt ggcctttgcc gcaaatcggc tcttccacct    205320
     cgtcaatacg aacatctctt ggtccgtgga agcggacgga cttcatcata cgtccgctca    205380
     agagcgtcgt gcgtaattca acggactggg tggatgtatt cagcatcttg gctgatctcg    205440
     atatgcttgc gtattgacct caattccgtt gtatggcttc atccaggagg cgtcccactt    205500
     tgctgaacct gtcacaaggt tggttctagg ggcttttata tgatcgtaaa tcgtggattc    205560
     attgcacgca ctaggtttgc ccaagatttc aagctacgag acgtgccagg cgtttcagga    205620
     agtgattcaa agcttatagc aaatacaggg agagggtagc caatgaggcc gtcgatttgt    205680
     ctgccacaga atgctttcgt catgatggat caggatgact cgtaaggcaa atgcgacact    205740
     aagagaaaat caaggtactg tccagcagtt tttatagggc gaacagaaca gaaccgggtg    205800
     gtctggaaaa accaataatt gctagtccag gatgccgtag ggctctgtat ctggttgatt    205860
     tgcgtcatga gcgacatgca aaagagacga gttgcaggcc cggcaaagca ctactcgatc    205920
     gtgattcacc attatcgtga aatagatatg gatgaaccgg gtgacctcgg tctcggccag    205980
     ctagattggt tgataacttg attgccgaaa acaaccccta tggttgatgg agctcttctg    206040
     ctgttgtcaa attgctgttg tcaaataaaa aagaaaagtc tagcaagctt ctaatagaaa    206100
     cgtcagagct attgacgtga gatgccagat gataggctta aattttggca cgcataaggt    206160
     gcaccaagtt gctttggcga agggaaggag atgcggttag gttaacatac gtcatgtcat    206220
     gtcactgggg tatcccgaag ttgaaagttc gtcaagatcc caccaatgag cagcatgcat    206280
     tgctgtaagg aatacgcata gtgtcgatga cgtgggactc tcagggaccc acctgattct    206340
     tgctatgttg ctattcaacg aaacatacaa aattcaaatc cagtctctgg atgcggcgac    206400
     caagcagcat cacgtccgac actcatggta gacggcccgg catttctaaa tttgggagtg    206460
     ccggccagta ccgttccccc ttgcaaacag gtcaaacatg ctaaacaggc gggtctcgaa    206520
     agataaaagt taccgttcag aaaggttaac gtgattgata cagggttcac tgccgatcgg    206580
     aaaccacagt attgtggcat cgtggctatc cttataagcg agccaacaat gactacaaag    206640
     cgttgttagc atatatactt ataatccggc ttatgccact gtgtttaggt tgatcaattc    206700
     tgacatatga ctagcacact ggtgtcgttg tgcattatct caaggaaaag aaaggtagca    206760
     tttggcctta ggaggcgcta aaacattgtt tagccagttt cataatgaat cgccatctag    206820
     ggacgtggtc cgcttttaag aagtctatgc cgcagtctac ttgtggatga tatatcgggc    206880
     atcttattcc tgcagccgcc ttacttgctc ctggcctgtt cgtcctttat gaggttacgc    206940
     aagaaattat tccggattcc tttaccacag gagcgttaag tcactaaatt ccattttcac    207000
     tttcaagatg acggccgatc agtccaacaa agccattccc gcctatcttg acaccgcacg    207060
     acttttagaa ctatacagac catattgaca actggcgggg ctttccatga aatggtttcg    207120
     ggtacccagg cacaggtaca atatcatgcg tagaacaccg ggtgcatcaa atgagtaaat    207180
     atgggcagat cctttcttat gtcttaggca atcgccccaa gatacttttc ccgtattgtt    207240
     gtctaatgcc ttaaggcgaa atctcaacat cagtctccaa aatgtgagag gagtttcgat    207300
     gtatagcatg ggcagatctt ctcacgctga ttccgagggg aaacaattca acagggggaa    207360
     cggtgtggtt tttgcgggaa cgccagttct gtggccaata tagggccaat atgtgactgc    207420
     caattcgact agtgcccctg aattttatgc tctagatcaa ccttctcacg gtcgtatatg    207480
     gctaagtaga attaccgaat ttttacagct ctcgaggcct ggtctcacta cgatttctgg    207540
     ataaccccga tcctcaactt ttacagtcga ataagggcga taaataagct aacaccttgt    207600
     tatacttaag gtatttcttc gtgaaggacg caattgctca aggacatgtc gacatccacg    207660
     ataccaagat aagacacatc tcacgcattt acaaaaatgc gggcaaaaga ccaatcccag    207720
     acctttgttg agccccttgg actgacgtaa gccttgcatg aaaatagggc tactatagtg    207780
     tattccagga taattcattt aagttgtttt tgatattcag aaggagatgg gatgaggatc    207840
     tgcgaggggg gatattgggt gcctggttcc caggcataac attggagctc atacgttatc    207900
     taagttactg tccctttctc tcttctcttc agtcgatagg aatcgaccac attattcctc    207960
     catttatccc gatggtagtg tgatgccaag agcttctcaa ttggttggcg gacgcagggt    208020
     ccataatccg ccaacaaggt ggccgcgcta gtcaacaacc acaagcagtc atcagtacgg    208080
     ttagatgaat attaactacc gacagggatg actgggttac tagggccttc gagaagccct    208140
     tgatcggtcc tcaatatctc gccccgtggc ccgtaagcag ccacatcacg cgggtaagtt    208200
     tccggtacag taaagatgga aaataaagga gcagcgccca gcacagaagc gataggacaa    208260
     agatgacgaa catattggtc acgagtcttt cggtaggggt cataacgtat gggccaaatg    208320
     tgacttcata gcgatagtac acgaggagta taaagtgcaa aaattgttct tggatgttgt    208380
     ggcgttgctt atctatattc gtagcggagc tcagcctgtc acagtatgag aagccagccc    208440
     taccaggtta aaagtggcga ggagaagcca tggtatagaa gagcgcgttt gccattcgtg    208500
     caacagcttt catggtagaa ggacatttgg tgactagatt atcgactagt gtgaatttat    208560
     gtggatggca tatagaacgc ttcggtctcc gtcaatatgg cctctttaaa gatgaaggaa    208620
     actgagacat acgagtttga cataagtcag aaatcggttc gaagacccac cctaccaagg    208680
     aattcggcat gcgaacggcc ggtcgtactt ggaacccgga cgtgctattc caaactctac    208740
     acaccaaccc ttcccaaccc ccacttgatg tcacagccca tcacgcttta tcagtgacgt    208800
     gtgattaaag ccggaaccta gctaagtcaa gtcgccagaa cctggcaagg tacttcgtga    208860
     gagtcaatcg taatcatagc acccagcccg ttttcccatc gtatccattc tgtcactgct    208920
     ctccctcttc accagtgatt cttattgttc cctggacagc tagctgctta atttacgcta    208980
     ggggcacgga ttacttccgg gtcaggcttg aaaactggga tccgcagcgg tgcagaattc    209040
     gtagggcaat acttgagacc agcaatacca tgccaaagga cttgggaagg ggcaaagcac    209100
     ccggaaaatc taaatttctt cctgtatttg gttactgcac cagaagacta gttataagta    209160
     cttttctacc tagatcctcc tattggtatg aataattgcc gatgccaagt gccagaattc    209220
     ttcttctgga acgggtacaa gagtttcact tctcgttcat taaccgctga ttatgttgct    209280
     ggaaagccga gcatacttgg tgccactgtc agattctttc gaagacgacc gggactcagc    209340
     cttggtaagg ccaagtccgg tagccggtat tagggacaag gttgacgatc ggagtcttgg    209400
     cggggactgt tacagaagcg tccggtctgg gtttgccatg ggttgtatgg gcagcaacaa    209460
     tacgggcagc aggatggcca gcacgttgtg gttcggagca cattttgaat taggggcaga    209520
     gtgcccgtgt gcccaccggt gggtaataat gctatgaaaa aaaaagtctg gctcaaccgt    209580
     gtgttcttga tggcaggacg aggaatttag cttacagggg tagcaatgga catgtttact    209640
     gtggagctgg gttgagcgac attgtcaagt gtgttttgaa gactgatttc gatgtctgct    209700
     ctacatactt tatccatatt aatgatatct aatagcgata tatccgggac gttgatgggc    209760
     ttcggtcgga gcaacggaac tctggcgtac tggggataac cagcacagcg ttagtgtgtc    209820
     tgcaaggcac gtcgtcctcg ggtctctgct catttggcat taccggggtc cagttttgat    209880
     cttagcacat attcatctct gcgcctattc attctagcaa gcatgcaaaa ggttctagtt    209940
     gttccaatgt tggaaacgtt acatgggact gatgtcccat tcacgtatct tgatagtcaa    210000
     cttggaacat tgtttcttgg tatacaatga agaaaatcca caaagaggaa gacatgcaaa    210060
     ttctgctacc gtatattaat tgaatcggat tcagtgttaa gactgtaata atagggctca    210120
     attattcgca gaactattga gataaatgca gactttttcc taatatcggt gacatccaaa    210180
     aggacatccc cagaacggct tctttttcct gttgcagtca cagtctaatc tattcaatga    210240
     gccgctgtcc ttccctatca tcttgtcgaa ccaaccctcc atttctagat cccatcagta    210300
     accgccggga ctaaatagtg aggtactact aacctttgtc ctccttaagc tctagaaccc    210360
     gaccggccgg acagctagca attggcctta gccgggaaat ccaatctttc aacgaaagat    210420
     tagctttgcg aatgtcaaac tccacttggc cgctttgttt gtttccattg tcgactcttt    210480
     cgaaataata ataattgccg tcacagataa tatcttccag tgagagtgtt tccagagata    210540
     actcgttctg taaaacgtcc aaaaacctag acacacaagt gatctcttct tcgttgcgtt    210600
     tccacgccat cacggtttcc caggtaggac agacggaacc tcgagctgat tcaggtggct    210660
     catatgggta atagtaagta gacaaccacc ttgtgtttgg atattcttct gtcgacgact    210720
     cagaggattc ggaagtcgag gaatgctgtg gtaattgagg tgcactttct gccgatgctg    210780
     tttcagatgc tggtaggact gatggggggg ctggtccata ttctggcggg gatacagtcg    210840
     gtgtgtacgg tgacgatgtt gaaaatgatg gcagtgttgg ttgaaatgat ggcacagtag    210900
     ggtgatatga tggcagattt gggtcaaatg atggcactgt agggatatgt gatggcactg    210960
     taggttgata taatggcgat attggattga ccgccagtgg agtgaggtga gacgctggcg    211020
     atgcatatcg gacagatgtt tcattttcct ggcggccagg ggactcggca tgttgcgatc    211080
     taggattttc tgtggctctc gacttcgcac tgcgcattgt aacccgttga actgtgaggg    211140
     tgaccagact tttcttgaca ccgagtaata gtgatctcaa agagctgaaa tcgatatcaa    211200
     gctcgtgaat atgaagcttg cgaagtcgag tgaagctaat gtcatggaac atgtgtccaa    211260
     cgtaactttt tgccggataa gcaggcatct catcttgaac aagataagaa ggcatatgat    211320
     cttgcgacaa aatcagtact tccagttgag gtgcaagctt cctgagaaat ttcagccaag    211380
     tcgcctcatt gagatcaata cataagtgaa gatcctctag gccttctaaa gtagataata    211440
     gagaatctaa ttgctcttcg gagagggcaa tcctggagcc aatatcacca cagaagttag    211500
     aatcacaggt gtgcagcttt cggggtctgc agcttgagct acataacgca agaaaaagct    211560
     ttgataatgc caaggagttc agttttcgta tctggctggc cttgttggtc cgcgtagact    211620
     ctcctaggct gtaaacatcg aatcgaaaat cgatccggct cattatctgt cgtcttccga    211680
     ggaatggaac tgtcttctgc cggggatcaa gcaaaaattc cgttctgtaa tgtgcgagtc    211740
     ctattgattg gatgttcttg aatcgatcca gacattcccc aagtcgaaca gtgaacgctt    211800
     ctgattccag caggttgcca ttatccgcaa gcatggcttt ttggacagca tgccgactct    211860
     cctgctcgtc gcctttgacc tgccggcagc tttttgatga tatagatatc atgccgggga    211920
     gattttcaat gccatcgaac acaacgggga tcatccatag ctcttgaacg tgctcgcgga    211980
     gaccctttga cttggatagt tcttccagtt cgtggagact ttcgcttatc acaacgaaac    212040
     ggatttttcg gtaaaaggcc ttcgcaaaat tctccagtgt gtttttgtac aatgcgcggc    212100
     atgataacct cagagcgacc aattgctgga aatccaagtg gttacatatc tttgagatca    212160
     attccacggg caagactgca atggacattt tggctgtgcg tacgacgttt cgaggtagag    212220
     aacaatgata acagaaggct tggtttgtta tccgcaaata tgagtaggaa tcgtagaata    212280
     gttgcttttc aatttcaagt tccgaaattc gcgaaaaaaa tggagttcag tgaccaggaa    212340
     tggcggacaa tggtgcgtgc cagaatttgc gcgaggtaga aagcattcca aagtggagaa    212400
     agcagtaggt ttaggccact ttggtagtgg gcagcttaca gagatgcttg gagatcactg    212460
     atcagtttgc tagtctcatt gtgcgtagga gagaagggaa aagaggaaca ggagcagagg    212520
     cgagggttgt gattccagac gaggactagc ccttaggctg gactgcttag taagggagaa    212580
     ctgcatacat cgtaggcagt ccgtccggta cccgggacgg gtactgatac ataccggaat    212640
     tacaagatcg gcttcaagga ctacatcaca tgaccccatc tattatcgag tctgagggga    212700
     atttggattc aattacacga attgaaccgg aattctttcg aacaacaatg ctatagcctc    212760
     ctaacatccc gagtttccgg gcaatgcgtg atagtagctt cggcattctg gtaaattgtt    212820
     tctcagttgt gtataagaca gaggcattat gtagagctag ggtcaccgcg tcaatttgag    212880
     accctcacgg ccgtcggatc aactgagagc tataagccgg ataataatct ctcgcacccg    212940
     ttatggacct gactacattt agtggtcgag tgtaatttgt agaggaaggg cccatattaa    213000
     tatatgatac atcgatttga aacttgtcaa cggtaaatca ccactagagc ctgttttgga    213060
     ctggctccta agccaacccc aaggcctcac tgagcccttc aatcggtagt agcgacgggc    213120
     ggtgtgtaca aagggcagga tccacagaca aggagcttac taagatacgt acgaaccgat    213180
     cgtcgaaaaa aaccgtaccc aagccgaact aatgacccaa tctgataaaa agctcccaca    213240
     gtaacaactt atcagaaaag tcaatccgct gttcaattac caataatacc gagacaatgc    213300
     ccagcgattg atcaatctcg gaagtgataa cgagatcaat agcaggccga tatttttgac    213360
     aggaacttca cgtcatatat acaaatctta aagtacggtg caatggttcc attgggttat    213420
     tctagtacta gtgcatactg caggcacata ccaaaattcg gcacagcagc cgattttgaa    213480
     gttgcaactt acaggttgag agccaggaca ccagccagaa ggccagcagc ggcaccgggg    213540
     tcaacgagac ccatagcagc accggtggaa ggagtggggg aggcagaggc agagcccgag    213600
     gcagagcgga agcggagcca gtgccggaag aagcgctggt agtcataccg gtgttggtgg    213660
     aggtctgggt gccagtggta gttccggtag aggtagaacc ggtagctgta agaatgggga    213720
     tattagtact gcttttgcta atttgaagac cagttgttaa ggaagccaga ggtaaagtct    213780
     ccagtgggag agggtttggt agacacgtct ggggtggaag taccagtaga ggaagcctcg    213840
     gtttcagtgg aggagacacc agcggaagta gaagcagtgg aagtggtacc agtagagaca    213900
     gcagaggtag aggcagcaga agcagtagaa gaggcagaag agacagtgga agatgtaccg    213960
     gtagtagtag cgctggagga gctcttgtcg gactcggtga catcgaactg ctcggactgg    214020
     gcgaggatgc cggtgttctt ggcctcagtg gagatcaggt tgatctggaa gccggagctg    214080
     tagtgcggtt gagtgttagt tggttgcgtg gaggcacaat cgaagcatcg cacgagtaat    214140
     cttacccatc ggtgacgtcc ttcaggccag gggcagtgta ggagcccttg gaggtgtcga    214200
     cgccggaggc aatcttctcc tcaacagggg ggtagacggc attgttgaca aggacgatgt    214260
     caacagtgga ggcatcggtg ctgtaatgtg ttagccttgg ctatcatagg tagggtgtga    214320
     gggatagtag tcaacatacc taacggatga ccacttcacg gtgaaagagc cagacacatc    214380
     aacctcgtca ttcttagcgg gctcagtgac cttgatagct agaccaattg ttagagagac    214440
     tcttgtgcac ggggcgattt tacatacctc caacggaaag ggccaaaggc aggagagaca    214500
     gaacggtagc gaaacgcatc ttgttctctc ggatccgaca aactatcagt aggctggctg    214560
     tcttgcctgg gcgtttcggt tagagcggga tcgcttatgg gtgattgccc gacgacctga    214620
     aggcttctat gatcttcgta ggctagtatt caactcggta atgggatgaa tgggaaggag    214680
     atagcctagc ttctaccatc ggtgtaaaag ccagaataat ctatgttagc ctcgcttaga    214740
     tctattatat tttcacccga ggggaaagta tagagcacta gtgtcatcat actccgggtg    214800
     tcaaaagtat aatccaagtg gcctaaatca agagattgaa gccattaagt gcaaggagga    214860
     gcagaatatg agagagagat cacacttggt tcaagaaagt ctttccagag cctaagaaat    214920
     ctagtgccgg tgccgtagtc cctgtaataa ccatagcttt ccttaggaac tacgagagga    214980
     ttaggaaccg acactaaggg aaaggtcggt gattatatga tatcggtacc acgccagtta    215040
     tcatagttaa agacacggtc gtcataatgg ctctcgttaa caaagccgat aggattataa    215100
     ttagagctac gtaatatgcc aggggaatcg tatcgtaaac catacactgt gtagaaccat    215160
     agggttctat tacctaggtt attaaagtca aaaatatcta taaagagtat actctcgtac    215220
     cttggctttc tggtgttata tttgtttgag aatataccat gactcttaga gaagactcga    215280
     ttgaataaag accatactta tatgactctc acagtcattt gcgccttgct cgtacgagat    215340
     aacatggcag acaccctcta gtaagtggcg acccaaatcg gcaaggacta ggaccgcttg    215400
     ctaatcgctt taaccacgat aacgtaggtc caaaatcata tggcctttct attctagtta    215460
     aggatagccc tgttctctac acacgtacta agcaccagcc gttctatgat ataagataga    215520
     aggcaaaacg accaggttct atactgcatc tctagggctc tgattcgttg ctgttagagg    215580
     tggtgaaaga gccatagcct caattccagc gtggaacttg ctctcctaac cggtaagggc    215640
     atacgctgtc tgccttaggg tagcgcatga cagcgctata tcctagtctc atggtatcat    215700
     ggtttgatgc ctaatcgtgc aatgccgctg ggaatattac gaacgtatct tatctaatga    215760
     ttccccgggg ctgaatccgc caaccttggc tcatatgtat ataaatggcc tccttccccc    215820
     ggctggtaat gttttcttag cttacccttt cctcttataa gccctccaga tacgattgtt    215880
     attgtcgacg atgagcaaac caggtggttc acgccctcga aggggtcaac gccgtggtta    215940
     cagatacctg gactctgaga gcgtgatcgt tgaaccaaat gctgttgagg cggatacgac    216000
     accctaacgc aatgcaaaag aaccgaaaca aaggagctct caatgttacc cgctaatcac    216060
     agcatcttct tcttcctaga ctaactatag ctaggataac gcttttgaag ggctccgaga    216120
     tgcagttgac catgaaattc aactgtgaca agagaaggaa tggatgcttc gagataaacg    216180
     tcacctcgag agggagacgc acaaacagac acgagatatg ctttccctgg aaaaggtaag    216240
     gcttatcttg aactgcaagg ccctgctaca tgcagccaga ttactaggtg actatccata    216300
     gtgggcacat gatttgcgag tcatgcgcag gaaatcttgg gacgccgaag aggtgcccta    216360
     tttatggagt accattcaca gggatgtcag ttgctaccct tctgcaggat aaaaatgtat    216420
     gcgaggtcag acagaagttg ccgacactac gtatgtgctt agttctttcc aagctgatat    216480
     tctcttctct agttcttagg cgttgtctcg agtattatga agcatcacat tttctatcgt    216540
     gaaaagacta tattacttcc aagcggtaca gcatgtcgat ctcgagataa tatatccaaa    216600
     tatttcgaag tcttatcttc taaggccgtg agactacacg agagcttgta agcgatttag    216660
     gtagaagtcg gccaagtcct tactcggtct ttatcttgtt aactccatgc gtctctgcta    216720
     gctccctgat ggcgtctctt gctgctttag gtgaaatttg gttttctgtg atcgggttgt    216780
     aaaagccaac agaagaattg tcaactaaag tgagatacag tgtacataga tatcgagtcg    216840
     ctttatggtg tgcctctagg tgatattgag ataattttgg gttatcaagt ctctgtgggt    216900
     gagctattat gtagttaaag ccagcattag cgcttatgtc aggtgtgtcc tcggctgtct    216960
     aacctagaag ggtttgcatc tatattgtag tgacgtctta ccttcgtaaa ctttaactgc    217020
     tttagccttt tgatcggtgt tccgaacctg atcttgatcg agaccggcta gcatttggcc    217080
     gaagtttata gggaggcttt agggcattcc gcgtgtactg agacgacctg tttttgactg    217140
     aacgacagtc aactttaaat aagtgttatg cgaggaacat aaaaaccgtg gtcaagcacg    217200
     gttttcagac cacggtttcg caagccccgc ctttgtccct cgtgatctct caatcacaac    217260
     ctcgcacagg agccactaaa tcttttttga actttacgag gttgtaaagc cctgcaaagt    217320
     tgtcgcgcct tctgttactg actcgcaagt cctccagaca gacttcctaa aagacaccga    217380
     tggcgggcga acatctatgg gacagtacga aagagatcgt ggtgaagatg agggatacca    217440
     tccagagcaa cactgaggat cgcgtgaaag agtcgttttg ggtggcaata tcgacttctg    217500
     tctgagagca aggatatgaa aggggatatg gaagctcaag cttatcaagt acgtttcgtc    217560
     cccttgttac catcatcagc acaatttcta aaaggttatc atttaggtct atgactgcac    217620
     cgttttcaac tctgttgtgc ctgcaagaat cgaaaacccc acaaagcgac tattgcttgt    217680
     tccaatacaa gggacttcga gtttgacccc agcagaaact ctatcaccag gatcatactg    217740
     ggatattaag atgacgccga tcgagttctc acgccggacc aaacgggtgg tgcagatatc    217800
     acgatcatta cgcttcaaga agacaaataa tatgtgtcaa aatgagtgaa atcttggttg    217860
     cgacactgaa gctgagggtc atacgtacaa aagtcagtgc tagaaacgga tgaaaatcac    217920
     atactagctt ttatattgaa caaatctgaa agcttggaat gtacaataaa tagtcgacat    217980
     ggcttactcc cccacagatg ctactgtaac gtcgagcatt aggggaacat agattatcta    218040
     gtgtatcaga gacattagga aattgagatt gaattaggtg cccaaaatga ggttggggaa    218100
     gtccagggca ttgaagccat cggaaaattg agagtccgag ggaagttggg caagactagg    218160
     gcaatattcc ggtgagttaa ctacaccggg gtcgttcgtc cgccgatgga acgctcttgc    218220
     ggagttacct tcaggacaag gcacgaactg gcgattagcc atatcattcg actggatttg    218280
     cgaggcgtct gtcagtcgta tatttgtgac taagtttgtg ttacttgttg ggaattgtga    218340
     agtgttgagg ggaacagagg ccacaaaatc gccattttga agtcggtgtc tctttcgact    218400
     tggctcgtcg tttgtccctt gcgtctgatt cgcactgacc ggtgacgacg tagacgagct    218460
     tttcctgtca tcggttgcgg ctgcggtttc gtctgcatca actgaagagt cagtggatgg    218520
     gaatctggat aaaatactct gagcacttac taggcggctg tttccgctta gttactcgct    218580
     tcgtctttac tttcagaggg ttgaatccca aggatagtct ttgggagata tattttccga    218640
     ggttggaaag ttcgaggctt ctcacgacgt catcaacgcc taactcacgc aatttacgtg    218700
     cagcggccgg tatgcatttt gagtatctat ttcctgtgta cctggggtca attagcattg    218760
     cccaatcaga cagaagaata aacttactct gtctctgtta catttaatgg caacgcaatt    218820
     aggtgacagg ggtccccgaa gtattcaatc catcttccat aaccacggcc aatccaaacg    218880
     taatgtatca aagagatttt gagcgggata tgaggcctct tctaacaatt gagcggtatt    218940
     taagtggtag ccaagtcggt cttggaactc ttctactttg attggaccta ctgttcgaaa    219000
     ataacaacaa tgaacggttg atgttttgat tacaagatca taaagatcat agtccttatg    219060
     tatggaaaaa gtgaatctac caaggatctt tccattcacg gacgagccaa atatcgctga    219120
     ctttaattct aagattggga ccccaaaaca ttggaaaagg ctgctctata gaccggatga    219180
     gtaagcaaag gcgcataagg tgatgccacg ggggagcgca cgcccgtacg gatgcgtacc    219240
     cagccagccc atggccaaat attgatagcc ggaaagggcc agcctaggct gacagggtga    219300
     aactgaacac cattggcgaa gtaaatattt ctattgaacg aacaaaagga aaacggaggg    219360
     acaaggttcg aatatcctct aggatagtac attagggttg aaagcgaaat gacacgcgga    219420
     gcttggatcg gcgttgaatg accaaccgtg attgtccagc gcttgttatg tttcccactg    219480
     tagaattctg cgagaggatg tcacttatct gacaacgtat ccttcgtaag ttttccagca    219540
     ttgacttaac tcgtggaaga aagaacggat acccttcgac agcctctccg gtttccgtac    219600
     tgagcttact gagccggagt tctatccagt ccacccgctc aaaaaggaaa aatgccgata    219660
     cataaaggaa gatatcatcg gcgcagttgt cttcggataa cggatacggc cccgtccagc    219720
     tgaaggagcg gacgttctcg tagctggggt agaagacaca ttcaatggca ggagacctct    219780
     tatgcccatg ctgagtatac tctaaccatc ccttgaggga ttggtttgag tacagagttg    219840
     ttgtggtaga gaccccacat gtgggtctag gtcctcaccc tctggtagct agatagttgt    219900
     aagggaagct cgcttccctc ccttccaaat acaactctct cctttctgct tcctgagcct    219960
     acaacctgta gtctcaccaa gagtgctacg gctttctgcg aggcaaggcg gcggtgacgg    220020
     tatattggga aattctctcc aaattgattc aagatccaga tccgaatcgt agtctgaagg    220080
     gacatcagcg ccagtgttaa gtatcgaaaa tcaatccaac taaccagttt gataaagttg    220140
     tcccattatt cccgtgcaaa aagtaccacg ttcacgataa aagacagtct gtggacgcaa    220200
     ggatttagga agatttggtg gtctcatagg gtctatatgt agaggtcagt atgactagct    220260
     tctagggtat agaaagctca acgaaaaaaa aaggtccagg aggggtcttg gccatgaccg    220320
     tgagaaggct atgttaccca gtgatgatgg ctcctgatct acgtagtagc aaacggtgaa    220380
     tgatcttgtt tcctgctgca aatgtacttt ggtgaagggt ggggaatgcc cgccccacac    220440
     atactccccc cgttgaacta tcttgaccga caagaccggc cagaccatgt tctttgcgat    220500
     tatacgatac ccaaggattt ggccagacga agatagcttg tttactttgc tcttgcacgg    220560
     tgtcattgta gctcatttat gtttggtctg cagccatttc cagaaactga ttatcgacat    220620
     atcaatagcg cctctttgga gtatatacta ggtttattcc atatatgatt ggggtctaaa    220680
     cttgacactg ttagatattc ggtcttcgtg tcattttgat tacagtcaat atcgcgattg    220740
     gtgctgaagt tagaacgagt tttattggga ctacttcatc gaggggcgac tttttttgaa    220800
     acttagtaat cgtacattat ccagttttct cctttaatcc cgatgccagc cataatcaat    220860
     tacataatta tacattgcaa gccagaaaat acatcggttt cctggtagat tgtatgtttc    220920
     ttgatcgtgc ttcagcaagt ctagctgttg cagttcctat aagcattaag ttgagggcag    220980
     gcagcaacta tcggtgagtc tccgagagcc aatccattcc gaacaagata catgtagttg    221040
     aacctgttca gtcaaacaga atctgcggaa atctgctcca tagatgtagc gccgacgata    221100
     cccacaaagc tcctgcttaa tcgttccact ccttgcatgc ggaactgctc tctatctcta    221160
     gaatcacctt tggaaatcct ggttattcta aagatcgaac acggggtcac gtagatacct    221220
     cgagagaggt tacctacatc atcccaaaag aggatcttac gaggacacgg ccttgttacg    221280
     agcttgatct ggattggtgg tcgcaaacac tacagccaca agaacaatcc acaaacgagg    221340
     tcgctggtag gacggcttcc tgttcctaga gaattttcta cattcatatt tattcatatg    221400
     gacgatttgt cttggcgggc tcataaaata cgcaaacctg tatttgtgga aaacacacta    221460
     acctacttcg ctcatctaga ctaccaagat agcagacaag aagagcaata gagcatagaa    221520
     gcttcctaag atgctgctcg gcagccgacc gtgttagagt ggtgaccgac gctatgacta    221580
     atggcgtata tcaaaatcaa gctgtaaacc tcctaaccct atcagctgcc ggtttctggc    221640
     agagccccta taccatatcc cgacagcttg atatcagttt ttcttccatg ttgaaacagt    221700
     cttttgaatt gaacaacttc tggtgccgct acaggtcgcg atcgatccac aaacacgtcc    221760
     tacattagat tgttactggg actcgagctt ctcgaacccc cgatctccgt gcgctcatcg    221820
     cccaccattg gggtatgtac atctcagtat ggttcccgcc ccttcccttg tcggtcagta    221880
     tatacatgcg aaatctcagt cggagctcca gcatctgttc aaggacaata gcaaagagag    221940
     cagaacagaa attgcgacac attttggagg aatcgagtat gacaccgaga tttgcagttg    222000
     gcggttgggg tagtcgcgga ggtggtcaga gaaatcggtt atcggttggc tgattagcgc    222060
     gcgccggctg ctaaatcgct ccgttcgcac gcgtcagaat tgcgtcccga ccgttcaagc    222120
     agttgtcgac gtttgtgtct atgtttcgcg atttttgaac ataattatct tcctcctgtt    222180
     ttcatcccgc tgagaccacc caatgaatgc ttagagacat ggatatctcc gccgccggtg    222240
     atgcaaatga aatcatgacg acggtgaagt gtctccgact ctgacaaata gaatggcctc    222300
     ggtcttgcgg taatacgaag gacaatgtct ggaatatttc cgctatcgaa attgtcggat    222360
     atagacaacc cttcaccctc gccggaagaa tgagggagat ttacgaggac gcaacacggt    222420
     gcactttcgg ggctgagagc ggctccatca cactctcaga cgcagagtag atggttcctc    222480
     aagacacaaa tcgagcgatt cctcacttga caacgcggcg catgactaaa tgctgtcaaa    222540
     acaaagaaga ggacctaaga ctcacggact tcgatactcg gctgctcaac ggatcgccgc    222600
     agcaatgagc tacgtaatac caatgccaac gcaaagaata cagccagtat atgcggtttc    222660
     caaagtcaat acacgggatg aaacctcaag cactcgggac tcgtcgcctg aggagttagt    222720
     gctgaccatc cagccaagtc ggaagaaatc gcccgtggcc aagcgtgtcc agccaattga    222780
     ggcgccacta ttaccaccac aggaggactc ggaagatgac tatccagtat attctgtccg    222840
     tcatctttcg gctctccgcc ggcctatgat tctataaaaa tacacggaga tggtgcggca    222900
     gacttacaga aagcagtggt gattgagcta ggtgccttgc gcagactatg tattacctca    222960
     gtgcgtatcc ctgaagaagc gttgggagga tcaccgcgtg ctacgcaaag aacatttcga    223020
     aagcgcaagc catccaaatg cacccgtact atttagagca gctcaggctt acccagcaac    223080
     tgtaagcggg gcgtcaagcc tttgggtcaa ccggcacagc aaagatagcg ggttactgat    223140
     ggaagtcagg ggcaccattc atatgatcga tgtgcctcca tcaagtcctc tccttgagga    223200
     gtgtcttccg cctctaaaac atgaacggca tcgtggccca caacctgctg cgcaggcaca    223260
     caacgactca gctttttcag ccatcacaaa ctcgtctggc aatatgccag gaaacttctc    223320
     attttggagc ccccaacgat ccaaagtcat ctaaagttac acaaaccaac cagaccttga    223380
     tacattagag acaacaatac agctactgaa aaccaaaacg ttctttccat gtatgggcta    223440
     acatctagct ctccacccgc aggtcgtcta tgttcgaccc cacgaacacc tcatgcgtca    223500
     gaaggaggat tccagtttcc gcgtgggtgg ttgccgccag gagaattagc gacatccccg    223560
     gcactggcta aaggagatgc ccgccaggcc caatcacctg gtgcctgtac ggatataatt    223620
     agagattaca gtctatattg tccaacagcc agattggtca agaagaaacc aacccagata    223680
     ctggagaagt gaaatttgac aattccaacg gatgattcga agggaggctg ttttaaaagg    223740
     gcgatcgctc aaggcaacca gcaacgcaac aatcacgagg cttgtttgat cttgggaaac    223800
     ccgacacaga tgatgaggac aatcacagtg atgccacagg gaatacccct ttacccaata    223860
     gctccagcca aaggatgact ggcacccttg ccctcataga tcccttccca ctggaaggag    223920
     atgatgtctc tgaggataac cacgttcgct acatgtttgc acctgttctg cacaacctaa    223980
     cagatttttg gcacaaagtg acagttcgaa actgtcaaaa tcgagacgat gtctactcag    224040
     tggggagaga cagccaaacc acggcaaacc cgaatggcta tgcctcgtat ggagcattaa    224100
     tgaccaagaa atctgcatct gtccagcgac caagaatagg aatttcggat gcgcaactac    224160
     gaagcctcgc aaaagaataa tcgtgactgc ccagggtagc gacaagacga ccaatctcac    224220
     ataaagacgg aggcagacag agtcatactt agaagttcat gaaactgacc tcaagggagg    224280
     acacggtgga tgcatgagtc tttgcgagat tcgaacaagg gagccactgg acatgccaag    224340
     gttagcccac cacattccag agcattccga tatcggcatt ggacagcttt tccgatctga    224400
     gtgcacaggc taagtcgact actttaaaag gccgggtacc gaaccgattc cttgatgcag    224460
     aggcaataac tgcgcctcga aagccaacac aggggcaccg gaacatacac aggcaccacc    224520
     ttgttacaat cgtggatttg cgcaccgaaa tagatcagcc tctgtgatta atcagatcgt    224580
     aactggcgtc gatcagacca ttattgcaat tgattatatc tgatcatatc aggattggcc    224640
     tcaatattca ctagccttcc ggtggaaact gcaatgttta tgggcaggat tcctgccaag    224700
     aagtaccctg attcacctcc atgcaaggtt gaatttgctt gctgggtgct ttcgctggaa    224760
     catctctctg ttactcgctt cttgtcgaca aaagccttcc attgtgggtt tactcccatt    224820
     tctttctccc aggctttttc cgtactgggt gcactggtgc attacagtta aaagatctgg    224880
     atatacggcc cagcctccta cgatagcgct tttccttatt aacttgctga gatattttaa    224940
     tatataatat tatgttatct ataaacgaaa tctaaatcta cagatataaa ctataatatt    225000
     atgactggat ctatatttat atagaaaatc gtgattttat tagatataac tctagggaat    225060
     ataattaatt ctgaattata ctatctgctc agctattatt ccttatagca cgggactaat    225120
     gttagtcact cactgaaacc acctactata atatagacta tattacagcc atagcgttct    225180
     tttaagaaag aacggaaatg tatcaatata tactattaag gtatctcaag aatagtcttc    225240
     cgcacaaccc agtaaaaccc agacccaacc cagtctgggt tgggttttgg gtcaagacct    225300
     tcgacccagt actgggtctg gggccccaaa ttgggttaca aaataaacaa atatgctaag    225360
     catcttatat gtataactta tgcatttttt ggtcgtaatt ttgggtattt ggtttactca    225420
     atcatatcaa aattagatta atgaaaaggg taagagaaat gttttaattt aggattgctt    225480
     atcaagctaa tggtattcaa atgtgtcatc gtcccttctt ttacgtttcc tcactgatac    225540
     tcgtgtctgt gtataggctg gtggtaatga ttgcgagcaa ggacaactat actcagttgg    225600
     actatcctcc agttgatttt ccgggttatc atccagttca tcaccttcct ctgtatcact    225660
     aaatggatca acctctacct caccaagctt atcttccctc tcttcttttg tagcctcgag    225720
     ctcatcatgt gagaagaatt tgtcgagaac cgttgcttcc tgctcatcta tatatcgcga    225780
     cacattcatc caccatggaa gtgcaatgtt tatcgcgggt gggttcgtaa cgcgtttact    225840
     gtctcaacaa attttcttgt gcaccccagc gcggcttttt ttgaagcgag tgcagatcgc    225900
     aatgagcttg aactcgacgt ggcatggctg gtgactgcat tgcagagagt tgtaagtgat    225960
     ctagttgtga agccgatatg accattgtgc aaactgattg tcacgtctca agcgcacttt    226020
     gggattccca tgaacaggtg cgctacggca gctcgtccaa gatcaatcct tgctgactcg    226080
     ggttgtacaa caggagaaca ccctcgtttc tgtcactcga gtcgaatgcc acgcgaacaa    226140
     atctcttgtt cgctcgagct cccctttaca aatacgattg catgctctct gtcccttcca    226200
     catgaatact atcgacgatg agtcacagaa ggttcgtatc gcgcacctcg gcctctttct    226260
     ccctattgat tctgcatatc gggtcattct tcgatttgtc tacatgatac aactcctgaa    226320
     ctccgatcag gctataccac cacccgaatc atacctgtgg ctaagcatgc aacctttcaa    226380
     atatcttcaa gtggcgtagg ctgctggtat cgaatgcgtg atcctcgttg tcttcggatg    226440
     acatttggtg gcttcccagg cctggaaatc caaaagacac agggaaatga tgatgttctg    226500
     tccttcttca tggcgggtga gctgtacctc cgcagacagt cagaccgtta gcacaagtcc    226560
     acctgcaagg agaaggagac gcaaagtctt ctctttctta gcctgcaatc tgacattgct    226620
     catctcaggc acaaaccgag agggtaagac cggggcacag gcaagccaat gagagctcac    226680
     tgcccaagaa tcacctcgag catacaggaa gctgcatcat gagggctgtc aaaagtgttg    226740
     tggtgtaccc ggttggttct tccctgttgg ttcttatgca cgcatttcct atccaagccg    226800
     aagcactatt tgcaaagacc atttaccctg ggtgtcactg cagctgcagg ttagtcaagt    226860
     cgaccgcgcg taatccttta tccgttcata tcgtctccta acatatcacg cacttgtcag    226920
     gaaatccgga ttccctacat ccctatttcg acggtttttt gagaataaat catatatttt    226980
     tcgagcccac cgcgctgcgg aggacacgtg ggcatgtcac tgttcgaaca ggcagccact    227040
     ttgaaaattt tggtgtccga aacaacatcg aatcagaatg gttttgggac ctctcagact    227100
     atcccctaga tcctcgagca aattttccac cgtcaatcaa cgctcatgtg atggttgctt    227160
     ttggaaggat ggccggattg tctactacga ctacgagcga actagcactc ctgcggggat    227220
     atcacccaac gggaattcgt ttcagacggc actgctagaa cccaataggg tttcaatcgg    227280
     gtttcaaccg tgttccctta tcagcagaac atggttgatt gcattaactt gggacaccac    227340
     ttcccaaaag gcaattgccg tcacttcgat cctcgattgg ttgaaatatg atccgtcatt    227400
     gccgaggcat agtaggagcc aaccgggtat tcttgattgc ttgcttgtcc aaatctctca    227460
     gcaacatggt tgtctggtaa tatcactttg attcttgcgc tctctgggat ataagagctg    227520
     aaatagggta aggtcgagtg actcacaatc gccacctgaa gtgatgactt cgacttagga    227580
     aggcacaaag cctaccgcat agttggtttt cctcaagcca atcgttcacc ttatcacatg    227640
     cttctacacg tgggccttgg catattgctt ggtcatagtt gaaccagagg atctactatc    227700
     cctatcggat tgacgctgta tgccaacttc accgagtgat cagaatggga ctagaatttt    227760
     cgcttacgag atagaatcta tagttgacac atttatccat gtgggtgaga tggcatgaaa    227820
     atctccgtgc tacgtccgtg agacattgat agacctcgcc gcgggccatg aggcccatgg    227880
     attcgcactg agttacttcc ccctgcctat gggcgggcgg gcggttgacc gtagccccgt    227940
     gtcatttaat gggcccatgt gtcgcttact aataagcact tcagtcacat gaaattttat    228000
     aattttataa tgtttagcca cgcacgtata tgtcctatag tactacgtat tcaggttatt    228060
     tgagtagaaa ggtatacaat ggatgtgttc agctataacc aaacctagta aaagcaatgg    228120
     actatcgagt ctaagtgaaa ttgaaagtgt gatccgaaat gcataaaaag tgtgatgcgt    228180
     ctgcattgcg cgtaaatata tatatgacta caaaacatgc tgaacctaca aaaccactca    228240
     caatataatg cctaccagcg cttcagtaaa tttattataa acacgacata ctatttatac    228300
     tgcatactag gattcgcctt tattatggtc aattatctgc tatactagtg gttattgggg    228360
     gtaggtgaca agtgatagat ttctaaaagt tgaaccccct attcaggaaa cttacataat    228420
     ccgagggtgg catggaccga tggcaaggtc tagacgttga ccaccttttt caccgcccga    228480
     ccattcacca ccacgctcac caccacgttc atcaacacac atcaacactc ccatcaacac    228540
     tcacatcaac actcncatca acactcacat caacactcac atcaacactc acatcaacac    228600
     tcacatcaac actcacatca acactcacat caacactcac atcaacactc acatcaacac    228660
     tcacatcaac actcacatca acactcacat caacactcac atcaacactc acatcaacac    228720
     tcacatcaac actcacatca acactcacat caacactcac atcaacacta acggttcaac    228780
     gcaacaag                                                             228788
//

If you have problems or comments...

PBIL Back to PBIL home page