(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_19

ID   PENCW_19; SV 1; linear; genomic DNA; GRV; FUN; 709213 BP.
XX
AC   AM920439_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 16)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c24, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920439.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..709213
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        join(complement(3368..4019),complement(2671..3314),
FT                   complement(2382..2401),complement(2250..2327),
FT                   complement(1887..1950),complement(1749..1824),
FT                   complement(1179..1611),complement(882..1113))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823090"
FT                   /orf_name="Pc24g00010"
FT                   /product="Pc08g00040 protein"
FT                   /protein_id="CAP86909.1"
FT                   /db_xref="UniParc:UPI0001830970"
FT                   /db_xref="UniProtKB/TrEMBL:B6GWJ6"
FT                   /transl_table=1
FT                   /translation="MEAASFLSATKGEKLKDSPQWLTWFAKVQLYAVQKNVWDLCNPDL
FT                   TSSTTDPANKRPEPLQEPVEPQYPEEGDEKERRIWRDRMDVYKVKYTRWEKQTKGLSDV
FT                   NEYILTYLDPIHRLSLVAYRTPYDRLVYLKSRFARSTAYEEEIRMKWKVFAMQKPTGDI
FT                   EEWLQQWNSLREQAVSLGINDGDANRDFLHTVKEALPIWWQGKYQEIVMDKKVYCVQTV
FT                   TSTNAPKGAFSTWQGHQEAKPEVKQEKLPFEKRRCPCGSSHPKHKVATCYIMNEAIRPE
FT                   GYTLNERTLEKAKKKLAKDLAWKQWVEKVVAEAQPKAEYANQVSFATTYQKHEAVQISE
FT                   HVLSVAKSDEPSLHDRWILDTGSSTHICNDRSLFVDFTPDDIEVSTGDSTTKILGRGTA
FT                   RLVGRHPAKGRKEITLSDTLYSILTWIPYKSSISKRETTRVYDPTGTHSEIRTLATCFI
FT                   LLEICTSNRRTQLIPSASAFADDDRLNQTMQGLSQGKNEASPIVEARPSLTKYGSEKSP
FT                   LPGINPVLVPPCSAADVTPGLCRAYQEHHANETTYAKILREEAQMDMRFSITVGAANWA
FT                   LLAGYLVIPGTFTSLQTSNQVEKTLQTSRTGREVLHMIQNPPLLAIACLLFVSGIAALM
FT                   WQMHFPKLRGNYPLLINKVFVPLCLHAAAGLLTTVINVCTSQGGDWSVMAIITTVITGV
FT                   TLLICSALLALYNFFKLERVRKEDEDIRRYRASIAPDT"
FT   CDS_pept        join(4803..4914,4973..5182,5474..5646,5706..5984)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217327" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942565"
FT                   /orf_name="Pc24g00020"
FT                   /product="Pc24g00020 protein"
FT                   /protein_id="CAP86910.1"
FT                   /db_xref="InterPro:IPR021476"
FT                   /db_xref="UniParc:UPI00018331A5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWG6"
FT                   /transl_table=1
FT                   /translation="MLLTKFSSLLLLATQAAAHGLITRIMGANGVEMPGLTVVDGTPRD
FT                   CPSAVCGGQKDTAVIRDQEMGSIKASALGRTLISGPVDPKRVIMNFMTPNTDTRVHTRH
FT                   FHQGAQSAVDDVAGTLPRTESGAVTPSGTVEKGVEGYAGKGSVNGLPSVSDAGVITMTY
FT                   HQVNQDGAGPLSADIDATSGGTDIKAFKPAKVIQNIPGVAGFSTSSTMDYEVKVQLPSG
FT                   MKCSGVVGNTKNVCIMRVRNNAISGPFGGSAAFTN"
FT   sig_peptide     4803..4856
FT                   /db_xref="UniProtKB/TrEMBL:B6HWG6 "
FT   mat_peptide     join(4857..4914,4973..5182,5474..5646,5706..5981)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWG6 "
FT   CDS_pept        complement(7109..8843)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(11401..11475),complement(11194..11338),
FT                   complement(10892..11112))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127393"
FT                   /orf_name="Pc24g00040"
FT                   /product="Pc08g00080 protein"
FT                   /function="scytalone dehydratase activity"
FT                   /biological_process="melanin metabolic process "
FT                   /protein_id="CAP86912.1"
FT                   /db_xref="GO:0006582"
FT                   /db_xref="GO:0030411"
FT                   /db_xref="InterPro:IPR004235"
FT                   /db_xref="UniParc:UPI0001830973"
FT                   /db_xref="UniProtKB/TrEMBL:B6GWJ1"
FT                   /transl_table=1
FT                   /translation="MDYTIADERKFRELAYKWAMAWDKKDKDAFISIATSRIIADYTDY
FT                   PAVGVVKHCPPDDFVNFAFREDRLGDPRSFTRVNDTEAIGNWQVRARHVRKFPDGKTAE
FT                   WDSSAYLELCYVLTGGEWKIGGLRPHTVLATTGSHQEVIGQF"
FT   CDS_pept        join(complement(12638..13063),complement(12341..12451))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127394"
FT                   /orf_name="Pc24g00050"
FT                   /product="Putative uncharacterized protein Pc08g00090 "
FT                   /protein_id="CAP86913.1"
FT                   /db_xref="UniParc:UPI0001830974"
FT                   /db_xref="UniProtKB/TrEMBL:B6GWJ2"
FT                   /transl_table=1
FT                   /translation="MCLGTSIQSSRDDDDLSQRSRPRSQWLPLYTTPRKTSHPCFALPE
FT                   EASLRQADRDLQEALNYTPSGGVCRLLSTNQAWSPMSKQDRRFARGKALTRPVGGLQPI
FT                   TTLFQIARVSPRRMPVSRCACVSKNSCTQGCPWLSLNEGDTTSTGNARPASGLECESDK
FT                   NKSDGFYYPYPLILE"
FT   CDS_pept        join(complement(15196..15315),complement(14742..15149))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942566"
FT                   /orf_name="Pc24g00060"
FT                   /product="Putative uncharacterized protein Pc24g00060 "
FT                   /protein_id="CAP86914.1"
FT                   /db_xref="UniParc:UPI00018331A6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWG9"
FT                   /transl_table=1
FT                   /translation="MDSPNSSSDQEKQGEQQPNELPILNDKGNNVDPSDHVPPLPSHSQ
FT                   HEVVTRHTLATEPFQPILKVLADLERDDPKFAFPAARLVGLYRRLWESCVSKHIDVQKI
FT                   EQSNEILKEAGTHLRKERDGLQLHHKKQVARLRFFEQALESSRERLISLLDDWNYPYSP
FT                   NLAGLTDVAREE"
FT   CDS_pept        join(16701..16752,16799..17055)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942567"
FT                   /orf_name="Pc24g00070"
FT                   /product="Putative uncharacterized protein Pc24g00070 "
FT                   /protein_id="CAP86915.1"
FT                   /db_xref="UniParc:UPI00018331A7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWH0"
FT                   /transl_table=1
FT                   /translation="MHQSKGHSSSLVLTIRKLNLWELNQSGPDNPAPPSVQSHGLHTIP
FT                   SPIASNNAACPRWKIANQDSDSTTGCGDSSANLVASKLEASVLPDSELSRLLLRRSD"
FT   CDS_pept        join(17389..17454,17733..17898,18019..18129,18209..18336,
FT                   18655..19005)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942568"
FT                   /orf_name="Pc24g00080"
FT                   /product="Putative uncharacterized protein Pc24g00080 "
FT                   /protein_id="CAP86916.1"
FT                   /db_xref="UniParc:UPI00018331A8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWH1"
FT                   /transl_table=1
FT                   /translation="MSADCDELECDVAWLVTALQRVKVRIAYLGLCLPIDSVYQVIVRV
FT                   RFVYMRQLLNSDQPIPLPESYMWPSMQPFKSSNERTSADNQAVSTSPPARRRRRKGFPF
FT                   LTYNLTLVISGSCIMRAVKSAVVCPVGSYAPISYPSRSTICKDHLPWVSLQLQAGRTDY
FT                   YDYERTSTPAGISPNGNSFQTALLEPNRVSIGFQPCSLISRTWLIALTWDTTSQKAIAV
FT                   TSIRDWLKYDPSLPRHSRSQPGILDCLLVQISQQHGCLCGKITLILALSGI"
FT   CDS_pept        join(complement(23999..24395),complement(23656..23720))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076477" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942569"
FT                   /orf_name="Pc24g00090"
FT                   /product="Putative uncharacterized protein Pc24g00090 "
FT                   /protein_id="CAP86917.1"
FT                   /db_xref="UniParc:UPI00018331A9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWH2"
FT                   /transl_table=1
FT                   /translation="MSPRSACGWPEWEEKNLLSWLDSHRGLPWKALSDAYYEEYQVYRS
FT                   VESLRGKKYHILRKQRRTGAKVPGHSGRQKRPGDVRRSLVDSGSRSTLPENTSAQRNID
FT                   KRFQTILAADPSQSGDSDKPAQTSRSKIRCAYSTMNTSMRDMNHSMDFV"
FT   CDS_pept        join(24933..25261,25317..25334,25388..25568)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076481" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942570"
FT                   /orf_name="Pc24g00100"
FT                   /product="Putative uncharacterized protein Pc24g00100 "
FT                   /protein_id="CAP86918.1"
FT                   /db_xref="UniParc:UPI00018331AA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWH3"
FT                   /transl_table=1
FT                   /translation="MGGIRKASRPLRRPDFRSRLQRALSLSSLESEDTGSVSSTATGDT
FT                   TSDESPSQEEYDSGDQENSDAADESEQEATRQQRTVFGHETDLGIRGQTQLSGDSNTVA
FT                   LERLTELDNRMGSIERSSHDQATWNETIRNDLVDILGRLAIVETEVQKLNRQGTNKSTE
FT                   GQKTGRSLRRQQ"
FT   CDS_pept        join(complement(27170..27241),complement(26734..27117))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076510" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976305"
FT                   /orf_name="Pc24g00110"
FT                   /product="Putative uncharacterized protein Pc24g00110 "
FT                   /protein_id="CAP86919.1"
FT                   /db_xref="UniParc:UPI00018331AB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWH4"
FT                   /transl_table=1
FT                   /translation="MSIVEGRDPKSTGGERRGETQTLPLAIAARDAALADSQRVGHEIC
FT                   ELQQQLESTNAALQDQVPWNDIQLVLDQAHGDMVSMTTRFWNTIDALQNRRLASYLPGS
FT                   GVTHADPAEQSGPATQGHDAHLSISESNVPLPSQQEPSARNQFGSLV"
FT   CDS_pept        join(27313..27564,27679..27744,27847..27891)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942571"
FT                   /orf_name="Pc24g00120"
FT                   /product="Putative uncharacterized protein Pc24g00120 "
FT                   /protein_id="CAP86920.1"
FT                   /db_xref="UniParc:UPI00018331AC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWH5"
FT                   /transl_table=1
FT                   /translation="MPTIVSWEYVKVVTRAMGAMLAKENPENIVEGRDWYRMLVQPSRR
FT                   FERVPIVFRSRPSRPKGITGRRSTQLYFATVVCLFPESLEYAEAQAQDLNPNEAALAPA
FT                   QEVRTNMYVGAYNPVS"
FT   CDS_pept        join(complement(28941..29294),complement(28528..28896))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942572"
FT                   /orf_name="Pc24g00130"
FT                   /product="Pc24g00130 protein"
FT                   /protein_id="CAP86921.1"
FT                   /db_xref="UniParc:UPI00018331AD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWH6"
FT                   /transl_table=1
FT                   /translation="MPKRSNEKRLKLNQQCREALAANICTRGPLPTITQLILLDDRLGI
FT                   VVAPEKVRLQPRPEDGYAWSVTSANASVLKSSLSSGKIHLYRKICNEIGHSIEAVSPHA
FT                   LGHSQSNTSCIPRESLEAESFGDGMDGSFTAEISKLKAANNSIEIELERTHARLNDCLD
FT                   ESHTVRAEANELRHDMQILRSHNKKLHDELTEAKAGIAGARRILNSLQTEGIGIELGTR
FT                   DFQSSVNGIHKVVSEVLD"
FT   CDS_pept        join(complement(33091..33361),complement(32883..33000),
FT                   complement(32695..32776))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942573"
FT                   /orf_name="Pc24g00140"
FT                   /product="Putative uncharacterized protein Pc24g00140 "
FT                   /protein_id="CAP86922.1"
FT                   /db_xref="UniParc:UPI00018331AE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWH7"
FT                   /transl_table=1
FT                   /translation="MVAVGSLSDGYLKDMDMGAFSARLSLQFATVVLLALVPSIHAFAE
FT                   PLHTPSPLATAFGRLVLLNLCGCALYALRPLERIGMVQFWQPSLHVCGNMGNSGLQSLA
FT                   RMKRHVLLSIIRFISVYCLDEPLTFNWESLRVFFRGARRNVINLKSPTFRAD"
FT   mat_peptide     join(complement(33091..33235),complement(32883..33000),
FT                   complement(32698..32776))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWH7 "
FT   sig_peptide     complement(33236..33361)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWH7 "
FT   CDS_pept        join(34119..34458,34577..34857)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942574"
FT                   /orf_name="Pc24g00150"
FT                   /product="Putative uncharacterized protein Pc24g00150 "
FT                   /protein_id="CAP86923.1"
FT                   /db_xref="UniParc:UPI00018331AF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWH8"
FT                   /transl_table=1
FT                   /translation="MEDIVPIVRQIGQQQAHNAYYRDCYSPFKLLQELTEHTFTELQRL
FT                   YKSGTERSTNSVHQLLRNFQNTICNLVERACEAQAECEKFCSVNESHSARVVFEPIRRM
FT                   YTNPQASLQEPRENHNVLCVPQYFSPKAHTPCRSPPTQSSHESDTAIKKFRLPQNVHHK
FT                   GEQCLAPPSATVLTYHFPHSQPNDHLRAWQLDATAEKMDQPYG"
FT   CDS_pept        join(complement(35639..35782),complement(35032..35586))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076484" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976306"
FT                   /orf_name="Pc24g00160"
FT                   /product="Pc24g00160 protein"
FT                   /protein_id="CAP86924.1"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI00018331B0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWH9"
FT                   /transl_table=1
FT                   /translation="MKLSTKSRLDSLVSTTALSFTVAILVCLSLVFVGCSSSSSPKGLH
FT                   FLKVDLKEFPKLRDLQIRDPFNVDTARIENGGRNAVEGVASSIHTSANEAIHEATSAAS
FT                   SMVEAQVHEFKSHLPQYYLVGLWSYCKAKDGSEMVCSDPSTSFTFDLSAVLDSTSINLS
FT                   NILPDIDLSLVSGYRRFSQSVVCLYIAGFVVTTLSGVLACRKVFFSKGSRSLAIFYTVC
FT                   DTWTNIEETC"
FT   CDS_pept        join(36285..36671,36717..37100,37161..38615)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076485" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942575"
FT                   /orf_name="Pc24g00170"
FT                   /product="Pc24g00170 protein"
FT                   /protein_id="CAP86925.1"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI00018331B1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWI0"
FT                   /transl_table=1
FT                   /translation="MSFSRQSEVEHWERKLYDYREXHFELSARVHISHLVFESGFRRRM
FT                   DGRQNIRRLTQMMKMQGCQRLMRDNHVPVIVPRAHWQDRVRPRSGGGIIPSLDMELDYR
FT                   LCAYDHENLITAARNFLDHDNQWWIFQLSEIVVDKFIVSPDDXRNEAESIRHKFIQSLK
FT                   ERYPNDNRPPDGLIYERINRYEGYLDTPRDPLAANNWWAVLEALAGSKKGKYLKQFFKH
FT                   ETLHQKLNSLLIIPGLWGGMRIGLLHKLTAMHCDEPVACYWELIFSTFSRLVGGREELL
FT                   LLIDGVTVELLQSRVPKISRKDLQSLQVELEEGRLFPNFSEEARQDIWARLKEIDYPIP
FT                   TLKTFFKDRLYLEVAQSVMKRLFVQPRGDKITIDQGVYGKYDTPVPVSMALRQEWLGSD
FT                   LLEFWRFSFQYGFEMTDHQRLKWPTDADPEDMLDRRSSGSSFLPKQEIWRHFFTLVRAR
FT                   GFQAPVTDDTSFATGELPSPRVCEFPEDLAEEIEVAKRCGKPYSNTVEADRFALSAETL
FT                   RQSQASVRVTAGFLRQSVFKAFFGYLWNSNSQMAGGDPPDDNIEVHHRGERPTTANVGR
FT                   AMMATDGMDVDPGSLRPNPLVTSAARTHNAAATASPADILPPFGVMTITVGRTTRILDL
FT                   PIHDSFMKDFSTGLFNNNFNVQTDEREKRSISPYTCYSHYLHNPSSVLHAEFRQNEHTT
FT                   YAIAPSQIGAGSKRRMLDEDEQMARAEIWLQEQIALLSDRRNGDEDL"
FT   CDS_pept        join(complement(39704..>39827),complement(39270..39654),
FT                   complement(39161..39215),complement(38924..38986))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076486" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942576"
FT                   /orf_name="Pc24g00180"
FT                   /product="Putative uncharacterized protein Pc24g00180 "
FT                   /protein_id="CAP86926.1"
FT                   /db_xref="UniParc:UPI00018331B2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWI1"
FT                   /transl_table=1
FT                   /translation="VSTWHQAMGGSLNATLSTSGHTQSVSLSPDCEAEMESALSRCVDG
FT                   PSIDCRGIAVSLDGQLPLMASVRQHAERAAGDEVPSQQQGNCSCQSPPLNKETTRREST
FT                   QQQTSTSTESTGSATHTASSSCELPNTSSFASISASPSAPSETHGPTTIPSPKGSGELD
FT                   LNTCLIKEADHREGGLCHCASGSAKLKPLRFLGLWNLHLIVSCKI"
FT   gap             39829..39928
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(41818..42033),complement(40942..41778))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076507" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942577"
FT                   /orf_name="Pc24g00190"
FT                   /product="Putative uncharacterized protein Pc24g00190 "
FT                   /protein_id="CAP86927.1"
FT                   /db_xref="UniParc:UPI00018331B3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWI2"
FT                   /transl_table=1
FT                   /translation="MYATPSNSESTWYGHGHSHNEASPSAASNSASCQHNPYPVDAESD
FT                   TNGLASKIDNGDRGRIMVYWKTRSAVPSRAVSPGQLPYVMLDFSFNTPTAQVGGAYSIR
FT                   TGQVMTSGHQLISQNPGKAIETKVSPDGRDQISDECCISCMILLVLLFSNTSPTHRITA
FT                   VENEVERPVGTLMATIPNIHRPSLDPTAMLSHLLAQLQSKQALQRKRDNYKTIFPAKQS
FT                   RVPLVNLLGTGQILAKIETLKRRGWPKLKRLSRAVYRNSKRISRLRAHLSFLQAELEEL
FT                   TSRNSSSKAVVCKQEMTKNELSPRRICLIGSLLVQHYLEKCSEGPVDGDRVNIPGLTAL
FT                   VTDRFPSLRA"
FT   CDS_pept        join(complement(43425..43484),complement(42327..43340))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942578"
FT                   /orf_name="Pc24g00200"
FT                   /product="Putative uncharacterized protein Pc24g00200 "
FT                   /protein_id="CAP86928.1"
FT                   /db_xref="UniParc:UPI00018331B4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWI3"
FT                   /transl_table=1
FT                   /translation="MHNQSVKQLAMESHSYRSAVLTMIDLQPTLASLKPTYTQTIGLRT
FT                   SQALHDEGSRLHVTPVSKQFPLSALNRPSYCDLLLHSSSPVSVPGDEPTTEPKHNGAIT
FT                   EKDSISGAIRGSYTSTGSDDHSLFPIKNSKNKTTDLLQNVTTRATFSPFAFNRTSQVWA
FT                   SLETPHSEDSSGPFVESLYHSTSQIHTEASEIRETGQSRMSKSDGASGTEWSDAASRIT
FT                   GTTGHHLSLTPNDGSQTLSRTLTGTAATSQTNSSISGPTSATKTSDHEWHDTALYGSNL
FT                   SARLSKQGTVLILSSVFGGSVALIGVFIIHCFILRYLHRHAVGSTTLPSQRVVDSPEKR
FT                   AKLVPRTAEFSHFSNDT"
FT   CDS_pept        join(43875..44063,44117..44287)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942579"
FT                   /orf_name="Pc24g00210"
FT                   /product="Pc24g00210 protein"
FT                   /protein_id="CAP86929.1"
FT                   /db_xref="UniParc:UPI00018331B5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWI4"
FT                   /transl_table=1
FT                   /translation="MAPPLSRVKREQLRKRRNNLLRRHNEFWLLYGMKSWLIMELPDGQ
FT                   IFTYHSHPDTPPPSREDMKTRPKPTIVRTPRDYISATSAQSVGRDIPVFCAPVRQTQKW
FT                   EALANHLNNNRRMVS"
FT   CDS_pept        45898..46387
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(46750..47061)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234786" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942580"
FT                   /orf_name="Pc24g00230"
FT                   /product="Pc24g00230 protein"
FT                   /protein_id="CAP86931.1"
FT                   /db_xref="UniParc:UPI000183322A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWI5"
FT                   /transl_table=1
FT                   /translation="MAELKTERIQQHRQQGLENDFYCKCFESFHQLVSTTMDATQSLAL
FT                   QYHFNRANSPSGDPRLIRAIVSLRVALDKSRAEETSAEQEWKQQWKVSPVRQSSLRWL"
FT   CDS_pept        join(complement(50025..51016),complement(49436..49963),
FT                   complement(48969..49374),complement(47911..48823))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942581"
FT                   /orf_name="Pc24g00240"
FT                   /product="Pc24g00240 protein"
FT                   /protein_id="CAP86932.1"
FT                   /db_xref="InterPro:IPR013180"
FT                   /db_xref="UniParc:UPI000183322B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWI6"
FT                   /transl_table=1
FT                   /translation="RFMASEADLDTEIKGLSILSEHSDLYEEFAKMGCVASLTSSYAIH
FT                   MI"
FT   CDS_pept        join(51465..51943,52009..52240)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942582"
FT                   /orf_name="Pc24g00250"
FT                   /product="Pc24g00250 protein"
FT                   /protein_id="CAP86933.1"
FT                   /db_xref="UniParc:UPI000183322C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWI7"
FT                   /transl_table=1
FT                   /translation="MAFGVDDHTSTPAKTGLEKTPLREIDPVLVLSCSAADVAPALCRV
FT                   NQMHHADETSYVRMLREEAEMDMRFSITVGAANWALLAGYLVIPGTFTSLQTSNQVEKT
FT                   LQANEAGRTVLHMIQNPPLLAIACLLFASGIAALMWLMHFPNLRGNYPWLINKVFLPLC
FT                   LHAAAGLLTTVINVCTSQGGDWSVMAIITTAVTGATLLSCSALLALYKFYKLERIRKED
FT                   EDIRRSRASTTLNR"
FT   gap             53868..53967
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(<53969..54657)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942583"
FT                   /orf_name="Pc24g00260"
FT                   /product="Pc24g00260 protein"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP86934.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000183322D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWI8"
FT                   /transl_table=1
FT                   /translation="MGEPSLGTVKFGTILPIALCADVIAASPQPLARRQQPDGIAKVDL
FT                   PSTTGEAKFLGANIIYGFPDNGVGWGNGGYAEYIGRFNSTLSNYRTTREYGGDFILFLV
FT                   HDLWGADGVTSDDGLYPGDNGDFSEFEKFLKQVKRDLEANDILDSLAIDVXNEPELQTF
FT                   WARPWSQYLDYYVYAAKLVREYFPDTLTRGPSAAKSRAWAVQSGMNSWLHVVPGNQTIP
FT                   DIYAWHPMLHTYGV"
FT   gap             56683..56782
FT                   /estimated_length="unknown"
FT   CDS_pept        join(56792..56830,56951..57050,57102..57283,57327..57434)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942584"
FT                   /orf_name="Pc24g00270"
FT                   /product="Putative uncharacterized protein Pc24g00270 "
FT                   /protein_id="CAP86935.1"
FT                   /db_xref="UniParc:UPI000183322E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWI9"
FT                   /transl_table=1
FT                   /translation="MMLLHIDLGTNGSVLEGIQYLRGLGRALATLGPETILLTQSGDVK
FT                   IMGVENSCEIKESEMNPATMKLCALADVVTKLMLKNRTYEWEAEIQNLPCQLESISVEE
FT                   ILQNEMFTRDSCEEELKLLVSVANKTAYHGIKSYYARC"
FT   CDS_pept        join(complement(58273..58651),complement(58065..58241),
FT                   complement(57995..58026))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823353"
FT                   /orf_name="Pc24g00280"
FT                   /product="Pc24g00280 protein"
FT                   /protein_id="CAP86936.1"
FT                   /db_xref="UniParc:UPI000183322F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWJ0"
FT                   /transl_table=1
FT                   /translation="MILVTWCLLLQAVAFSPTYAHLRMTSPEPYGSSRKTLDNSPLAAD
FT                   GSDFPCKISPGDFVVPTEEATYRTGSNNSIKLLGSATHGGGSCQVSLTSDREPTKNSEW
FT                   KVIKSYEGGCPAKGPGNLDGRQHIHFPWPGSIVEYNGDSKYRPQEGEPVCTGNPTFGPI
FT                   PITDTADTGEANSTTENANSMPYPDEQWVLHR"
FT   mat_peptide     join(complement(58273..58591),complement(58065..58241),
FT                   complement(57998..58026))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWJ0 "
FT   sig_peptide     complement(58592..58651)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWJ0 "
FT   gap             58932..59031
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(59836..59863),complement(59361..59757),
FT                   complement(59282..59299),complement(59052..59232))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076481" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943610"
FT                   /orf_name="Pc24g00290"
FT                   /product="Putative uncharacterized protein Pc24g00290 "
FT                   /protein_id="CAP86937.1"
FT                   /db_xref="UniParc:UPI0001833230"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWJ1"
FT                   /transl_table=1
FT                   /translation="MYSKPSEICSCATSPVTSGWENSLSYLDTDPTMGRIRKIPFTDQR
FT                   QSFRSRLQRALSLSSSGSENIWSPPGSAEGDTTEEESSLQENGFFGNHHNDIVVEDGQE
FT                   SPPHTWSMGPRPEEELEQPGQANLAEDCNMIALQCAADLDIRTKLMQKALDNSNSWIAT
FT                   IRSDLEDIRSRLAVVETAMEMMAKEGKNSTTEDNATRRTLRSQQ"
FT   CDS_pept        join(60096..60181,60253..60616)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670590"
FT                   /orf_name="Pc24g00300"
FT                   /product="Putative uncharacterized protein Pc24g00300 "
FT                   /protein_id="CAP86938.1"
FT                   /db_xref="UniParc:UPI0001833231"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWJ2"
FT                   /transl_table=1
FT                   /translation="MAWGSLKYEVNNSEFRLTEPIPQNDPWVMIYAHFSPLSGAQVVLL
FT                   SERVVLVTVSSCDMSPRSEVAWAEWEEKNLLPWLDAHRALPWKARSHAYSEQYQMDRSA
FT                   ESLRGKKYHILRKQRRIGADRLSIQAIQAIQAEQELIARPAIRLH"
FT   CDS_pept        join(complement(63149..63369),complement(62957..63062),
FT                   complement(62682..62878),complement(62510..62573),
FT                   complement(62267..62416),complement(61928..62098))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076707" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670591"
FT                   /orf_name="Pc24g00310"
FT                   /product="Putative uncharacterized protein Pc24g00310 "
FT                   /protein_id="CAP86939.1"
FT                   /db_xref="UniParc:UPI0001833232"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWJ3"
FT                   /transl_table=1
FT                   /translation="MTLRNNEQTMKMLRRSLLLRVLLNTLILVPSTTKRCLHGLEGLFV
FT                   ADVPAETLGFADAPARPFVDAGPRLRRTCEGAQVLHHWARGSDSRGHGDSQARRQERDT
FT                   MTHRSEPVAQLVARVTVSLISAEAISTTLKGCLETLWPTEPSLDLVFLSKLCVGSDGPL
FT                   SSTVEEKVMPRNASTDAEIMGWRWPRKRCAVPALTCVAFTKMSTPWAHRHWHTFKLRMK
FT                   IVFLWHDSQKGSRPLKSSDKKLGLVGFCDADLSDDPRDSRFREVLFVARRETGTNCRGP
FT                   DTIHKPKAFGRQCPMVRGIIA"
FT   mat_peptide     join(complement(63149..63270),complement(62957..63062),
FT                   complement(62682..62878),complement(62510..62573),
FT                   complement(62267..62416),complement(61931..62098))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWJ3 "
FT   sig_peptide     complement(63271..63369)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWJ3 "
FT   CDS_pept        join(64173..64292,64339..64578)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127645"
FT                   /orf_name="Pc24g00320"
FT                   /product="Putative uncharacterized protein Pc24g00320 "
FT                   /protein_id="CAP86940.1"
FT                   /db_xref="UniParc:UPI0001833233"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWJ4"
FT                   /transl_table=1
FT                   /translation="MDSPNSSPDQEKQGKQQPNELPIHNDKDHKLESSDHVPPLPSPSQ
FT                   HEEATRHTLATEPFQPTLKVLADLERNDPKFAFPAARLVGLYRRLWESCVSKHIDVQKI
FT                   DQSNGILKEGRKAGD"
FT   CDS_pept        join(complement(65223..65360),complement(64814..65167))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943611"
FT                   /orf_name="Pc24g00330"
FT                   /product="Putative uncharacterized protein Pc24g00330 "
FT                   /protein_id="CAP86941.1"
FT                   /db_xref="UniParc:UPI0001833234"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWJ5"
FT                   /transl_table=1
FT                   /translation="MDHPTSPSPIDRPAKRQCRVSHAPEDEPKLENQPQQASNGTTIEP
FT                   KVPVRTRGTLTAEFIKVVSLNDSLATPALKLLDLYFCLWECYVVKSAQKIRLEEEQRQL
FT                   QASNDLLASDSDILLQLCNVQASVLSERKRAVQALCNDVVSAFEASDLQAYPVDEPEPW
FT                   "
FT   CDS_pept        join(complement(67457..67459),complement(65803..67407))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670592"
FT                   /orf_name="Pc24g00340"
FT                   /product="Pc24g00340 protein"
FT                   /protein_id="CAP86942.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001833235"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWJ6"
FT                   /transl_table=1
FT                   /translation="MQNLTELPNELLLWIVSHLDGSALFTLEKSCKDFDFKLQPSIWRY
FT                   NIKFQNSNLLHLAVKYDNVGLGEALLRHNANINAFYRGKTPLMRALKYTSAAVRELLLS
FT                   HRDLDINIQNQARDSPLSYAIHYGGFSIVKSVLEHRAASVDIKHKYGRTALHLAVFAGR
FT                   IGFVQLLLLSGSDPNLEDDSGQSAWSWACRFNRPVMEMIFSNDPMTKVFLGTKSSQEAE
FT                   LPVHQAVAYGSVEAVKRLLRQKGLNSNIQNRNGYTPPHLAVQTKRLEMDNLILGHPLAN
FT                   VNCKDKDGNTPLWLSTYSSCDEITERLLAEKDIDINFVGGRGRLESPSTSLHHAAMRLD
FT                   TILLRRLLAVPGIALNLCVAGHSPISVAAYHGHVKTVACLLSMEGVEINGRGLIDPPIC
FT                   RAVSHGHLDVVRLLVQQGARLNVNESTVATHDTALCIAARGGDLEVVREILRHGRIDVN
FT                   LRNQWFEDPLMLAVRGGHFSIVDALVANPRLTHFSLRRSLDLAKDYRIQRAIRSRIYDD
FT                   NTTKKLLKRSPRRIFDRL"
FT   CDS_pept        join(68161..68188,68250..68805,68871..68953,69016..69317)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823354"
FT                   /orf_name="Pc24g00350"
FT                   /product="Putative uncharacterized protein Pc24g00350 "
FT                   /protein_id="CAP86943.1"
FT                   /db_xref="UniParc:UPI0001833236"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWJ7"
FT                   /transl_table=1
FT                   /translation="MLPWNSLLVWAPTKNSVKREDTKIGHKKLNTVARELFDLSNLQSK
FT                   LCAFVKESLCARWHRQRQADGVGQQWYEAAVRNQARVSHDSRVASPSIVHPSQRQTSPA
FT                   SRRRPASDNTDRSPPHGLTQDPPGPVSTSSELVQSINPAVTAEMLRTNGVPWHVSPARP
FT                   AILTSVTNIWAGVQDLTLQSLSLSEELEKDPLAERMPIHPAWKSGWKSDVQALARHAVC
FT                   GTLDALIRPLRVLLADTETNSVHSASESSTDSEPVSVRSPARNDPSQSQSRRGSVESLG
FT                   VSIEQSGPRRSARLAGARLPRDSSTSASLCRSARLNSNQRR"
FT   CDS_pept        join(complement(70589..70918),complement(70486..70517),
FT                   complement(70148..70427))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127646"
FT                   /orf_name="Pc24g00360"
FT                   /product="Putative uncharacterized protein Pc24g00360 "
FT                   /protein_id="CAP86944.1"
FT                   /db_xref="UniParc:UPI0001833237"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWJ8"
FT                   /transl_table=1
FT                   /translation="MAEPSGTGTSTAQAAKAAQRSVLALLEDMKATGRTNEALKELCRQ
FT                   LFFVENALGNFASTFDLGGLCKLDLEVQHPIRMTIWVAKMPVQDFRLASKSGPVTPPTT
FT                   PCTNWMIIGMALGVSALVTAFSTPRNISDEQCTLVLAKQNGLLSEMIEANQRQAAHLDR
FT                   RRAPRRVVSEKEGHSLGMQHPRKVFNGLPSEICQVRSGKDPIPGTETDFL"
FT   CDS_pept        72135..73280
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943612"
FT                   /orf_name="Pc24g00370"
FT                   /product="Pc24g00370 protein"
FT                   /protein_id="CAP86945.1"
FT                   /db_xref="InterPro:IPR022085"
FT                   /db_xref="UniParc:UPI0001833238"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWJ9"
FT                   /transl_table=1
FT                   /translation="MHRLRDSLLSPSPKGFPVIGEADTVSHSQQDVRQSLARGEFREVR
FT                   GAAFFSRTWIVTDRYCNVKDGVDSLEGYVREIWYMYYHLSLHTSHETPEHDSLVLDILR
FT                   IQGKGPLTRPVKGNYGIDIARLTEGTLWNDLPFLVTDMTDLWINNCGPMSGTQRLNFAS
FT                   FLAKLASTRVCKDRMCQVALVLFRCAFEERQELRTSEDQDNEDPGRSMGSLELMHLLPS
FT                   VQAWFVEARYNFLQLSEVSWNDCPSTIGQGGPCFIESDFGKRCSPTGFTPWRWMYWLKR
FT                   LHEIQDAAKDAGEKRLKQCAVEAISRMLMDVKERNSDILRVFKDAGDLIYEDKHLVSLK
FT                   RIVEGEGPFFPENEDGEESEKTEGKEKLEESKMPEGNKKDN"
FT   CDS_pept        join(complement(74407..74532),complement(74241..74330),
FT                   complement(74110..74172))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214039" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127647"
FT                   /orf_name="Pc24g00380"
FT                   /product="Pc24g00380 protein"
FT                   /protein_id="CAP86946.1"
FT                   /db_xref="InterPro:IPR022706"
FT                   /db_xref="InterPro:IPR023112"
FT                   /db_xref="UniParc:UPI000002DB14"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWK0"
FT                   /transl_table=1
FT                   /translation="MQITTVALFLFAAMGGVATPIESVSNDLDARAEAGVLAKYTGKCT
FT                   KSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD"
FT   mat_peptide     join(complement(74407..74478),complement(74241..74330),
FT                   complement(74113..74172))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWK0 "
FT   sig_peptide     complement(74479..74532)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWK0 "
FT   CDS_pept        join(complement(76574..76628),complement(76222..76449),
FT                   complement(76045..76124))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127648"
FT                   /orf_name="Pc24g00390"
FT                   /product="Putative uncharacterized protein Pc24g00390 "
FT                   /protein_id="CAP86947.1"
FT                   /db_xref="UniParc:UPI0001833239"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWK1"
FT                   /transl_table=1
FT                   /translation="MTHDEESASIINMLRRNSKNGKRRRKLNITRYQWFWAVNYRDLSA
FT                   LTPDLRHSVKRRVIVKRVIPTQDFPISRLQSAREVFSSQQACEENTRLKSIYETNKPAL
FT                   LCCDMKLYIGDHVESI"
FT   CDS_pept        join(complement(77577..78006),complement(77182..77282),
FT                   complement(76794..77084))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943613"
FT                   /orf_name="Pc24g00400"
FT                   /product="Pc24g00400 protein"
FT                   /protein_id="CAP86948.1"
FT                   /db_xref="InterPro:IPR022085"
FT                   /db_xref="UniParc:UPI000183323A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWK2"
FT                   /transl_table=1
FT                   /translation="MEEHKAEWKPFFYPDPEDGDPDPPTWDEIQILQEFVERYGTANAV
FT                   PVDDAAHRFMSLRNEDDLIQERQSQAVDKGERVSWLLWDAAIEMPNYQPAVLRLVEAIR
FT                   ALPDLDRTEEQVRTSRFQDRLEDWRNLAVFKDIWEETHDPLRIPVFALEQEPWKHGPVP
FT                   LPPPSPSLLQRHNLTDVHAMVPFFEIAGSIIFKFVGKKDLTLAEANKKPDLNLWKGDSS
FT                   FSKERWDFWKERLQWISEQNELMERTRDDAQKLVEIMHSIEQQTREKNSAL"
FT   CDS_pept        join(complement(79218..79794),complement(79003..79112))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217789" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943614"
FT                   /orf_name="Pc24g00410"
FT                   /product="Pc24g00410 protein"
FT                   /protein_id="CAP86949.1"
FT                   /db_xref="UniParc:UPI000183323B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWK3"
FT                   /transl_table=1
FT                   /translation="MHTHKLFARNKETWKVWKISVLSEALNTPFLMHGILTFFALHLAH
FT                   LRRHERHSNYAPLFDVDDP"
FT   CDS_pept        join(complement(81086..81165),complement(80489..81002))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943615"
FT                   /orf_name="Pc24g00420"
FT                   /product="Pc24g00420 protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP86950.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000183323C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWK4"
FT                   /transl_table=1
FT                   /translation="MRLVQIRKQAAPSELAPKCLYRQPSSFTILSSYSWSSSSSIRCRR
FT                   TEAIDAVAAYCQFEEGITCRLPQNKRVESHVAESGYVDDQKPESETTEVQTKSASPLEN
FT                   AIRSVTKDNRPLFCFICVGQQNLALKKRVQLFSSHGDVSKHIKRKHLQNLGSSTVIACN
FT                   VCDKKFAEVMHFQRHANDSHSTVTGPLWRAGSKQ"
FT   CDS_pept        join(81499..81555,81608..82450)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127649"
FT                   /orf_name="Pc24g00430"
FT                   /product="Pc24g00430 protein"
FT                   /protein_id="CAP86951.1"
FT                   /db_xref="UniParc:UPI000183323D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWK5"
FT                   /transl_table=1
FT                   /translation="MDKAYLPQWGQLPVEQYLIKHWDHSSSEPTGDQRLRLIRQFLDLD
FT                   EIPKEVHPNCHASDTYEALSHFPTAYGIDTILRPWRSDDLRKIAWRIWGCDNDQLILLR
FT                   TYYNADDNEQITELVGSDELHEENVAWWALLDNPELFNFGDQWWRVFDILPELAGPLNG
FT                   YSRLPNPESISRERQDFKERLPTLKQSDEWTANRDNYIEREFAYLRRIASEGYLAIADQ
FT                   EAFKTDMLRLIYYDGKRNIVQETRTEFDEQTFADVAVEWDQLSLPLELWRDGKTGEKYR
FT                   VNGELGRELYQLDEADLE"
FT   CDS_pept        join(complement(84808..84898),complement(84607..84640),
FT                   complement(84296..84426),complement(84104..84249),
FT                   complement(83617..83952),complement(83205..83471))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076631" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943616"
FT                   /orf_name="Pc24g00440"
FT                   /product="Putative uncharacterized protein Pc24g00440 "
FT                   /protein_id="CAP86952.1"
FT                   /db_xref="UniParc:UPI000183323E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWK6"
FT                   /transl_table=1
FT                   /translation="MSLQIVVVKEDAGFNRPQLGNVSFNTSNQVVYTVDQQTRQFLYMG
FT                   PQILETALTRKTRDSQIRRRSNTMHQSKGHSSSLVLTIRKLNLWELPRAPRKAMAYTLF
FT                   LAPSLRTMQHVLGGRSQTKIASQQQGAAIHGHPIIDGEIYCASGLFRQIEDKTKVAADE
FT                   RASSRLPPSSHHLHTAMESLDLWHRDTFIHHGSAMFIASGFVTRVYCLNKLSCAPQRGF
FT                   FEASADCDELEYDVAWLVTALQKVDTLISITQVECHANKCLVCSSSPIQILSHALCPFH
FT                   MITIDDESPEDSYRVPISPTQAAAMATAAASGQFYPLHQDSMTGQMPRPLSPY"
FT   CDS_pept        join(85752..85871,85918..86321,86371..86467)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943617"
FT                   /orf_name="Pc24g00450"
FT                   /product="Putative uncharacterized protein Pc24g00450 "
FT                   /protein_id="CAP86953.1"
FT                   /db_xref="UniParc:UPI000183323F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWK7"
FT                   /transl_table=1
FT                   /translation="MDSSNSSPDQEKQGEQQPNELPILSEKDHNQEPSDHVPPLTSPSQ
FT                   HEEVTRHALATEPFQPILKVLADLERDDPKFSFPAARLVGFYRRLWESCVSKHIDLQKI
FT                   EQSNEILKEAGTHLRKERDGLQLHHDKQLARLRFFEHAMESSRERLINLLDDWNYPYSP
FT                   NLAGLTDVAREENTTSGDAVQGKLHRMQSRLYIPEAFNKKGTK"
FT   CDS_pept        join(complement(88376..88429),complement(88177..88317),
FT                   complement(87951..88116),complement(87795..87889))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823355"
FT                   /orf_name="Pc24g00460"
FT                   /product="Pc24g00460 protein"
FT                   /protein_id="CAP86954.1"
FT                   /db_xref="UniParc:UPI0001833240"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWK8"
FT                   /transl_table=1
FT                   /translation="MSSRTLNWSRTAKSSLVKQHLVRPSDPIAARPALNVRTQQIAEFS
FT                   GSSENRDRLGHRAKKNLLDREFFLSLLNSASTKREAKSYLARLKASPAKYHTTLTDGKT
FT                   GRPRCSPSTPGLDRSQVRTRGTLTAEFIKVVNLNDSLATPALKLLDL"
FT   CDS_pept        join(88580..88653,88718..89010,89160..89403)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943618"
FT                   /orf_name="Pc24g00470"
FT                   /product="Pc24g00470 protein"
FT                   /protein_id="CAP86955.1"
FT                   /db_xref="UniParc:UPI0001833241"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWK9"
FT                   /transl_table=1
FT                   /translation="MELKTPWVRHMVALYTASILILVRSVTRVVEYHARRTYPYVYLVA
FT                   DHAERLNL"
FT   CDS_pept        join(complement(91659..91838),complement(91291..91606),
FT                   complement(90390..91237),complement(89885..90331))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976564"
FT                   /orf_name="Pc24g00480"
FT                   /product="Pc24g00480 protein"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP86956.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI0001833242"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWL0"
FT                   /transl_table=1
FT                   /translation="MRQSLITALLVWSNWASASAHTFPVRDVPAVIGMDLYGSKIPKPL
FT                   QKRDTATLATNVLNETAYFINVSIGTPPQPIGMLVDLLAPEFYVITEDTNYENSKCREN
FT                   SLCTSFGSYNISESSSNSTKEIPSKHKWSSSPDTIRTDIITIGGTQVKDVGLSLIKVTY
FT                   ESWNSIGLSPENTSFPYHLINQDLIRSPSFSIWGNISESGGAGILFGGINKAKYHGPLQ
FT                   AFGFNITTGLVLLPLSRFQVQTDSNVPTNYTISSPKPYKLSTQYITTTLPKDIVLQMYK
FT                   DYNISFVGWEGEDPQFGLLPCSRKTENHTVSLIFGDATISAPWSDLFRPWDSQYGERCV
FT                   FLIQPEDEEDDTFAGTIGTSFSDHMYMAINYNNAFVGVAALNGNPGPDDIVEIGDGPEI
FT                   PDAVGDFPTSIVPYTKPTPTASTSTSTGLASMPTYMSGGMFVGVAGAALWYGVEDMNLL
FT                   YFASEVICTWIEYIRLYSPRTPESQIHPRKQEWVTSIDETADPDPVSGVQPTTRRLVDK
FT                   SDTSKVDLAAIESSPAEYEQWEEMQPGFMDADYVEIVLHEGGCLYIPIGWWHNVRGLRT
FT                   GISVNFQWGERTCENRMCQN"
FT   mat_peptide     join(complement(91659..91778),complement(91291..91606),
FT                   complement(90390..91237),complement(89888..90331))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWL0 "
FT   sig_peptide     complement(91779..91838)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWL0 "
FT   CDS_pept        join(92552..92582,92710..92814,92954..93360)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943619"
FT                   /orf_name="Pc24g00490"
FT                   /product="Putative uncharacterized protein Pc24g00490 "
FT                   /protein_id="CAP86957.1"
FT                   /db_xref="UniParc:UPI0001833243"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWL1"
FT                   /transl_table=1
FT                   /translation="MPMHLLRQISIPKAFRRLKWVNLVTSHPESKELHRQGDYWLTAKL
FT                   TIIPVLICIVIVTSKLKAPRRVRCESSRSDLINRSPSTPASYRRSRRKTLSRTDLDEIP
FT                   IYRTGDFPGSRKRGGTPDVERGITCQQTSSSPDLADQNLTLSRLDSSVSGSKIKNEGAN
FT                   SGYTPLPAKPLLHHNTG"
FT   CDS_pept        join(94657..94775,94814..95238,95267..95553)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076751" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943620"
FT                   /orf_name="Pc24g00500"
FT                   /product="Pc24g00500 protein"
FT                   /protein_id="CAP86958.1"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI00018332CB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWL2"
FT                   /transl_table=1
FT                   /translation="MTFAGIFRGFSSNGIYSRSYMCFIWKLPTFFGYSRHRDSICFQIH
FT                   LPSPPGGNMPQLLSIHVMSICRGSKNDITGCSFLRVPVHFLPIPVSANMQGVPSVKHEI
FT                   AWPEYVMDRLATLAQTSRLMSIFYLIATGASGLSSSYWISSFRRGNLSWHVHTAPAQTL
FT                   ASHPDMPPSLVEFLSLVVTTLTFVSLQMSTFCMCFASTIASIISEEFVYLINTDGNPYG
FT                   VWASHGNSFLKLSWAATTLQFLVVVESFILILKRRIGCFLCDKTSSSLVDKCGN"
FT   CDS_pept        join(95685..95803,95871..96018,96105..96326)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976565"
FT                   /orf_name="Pc24g00510"
FT                   /product="Putative uncharacterized protein Pc24g00510 "
FT                   /protein_id="CAP86959.1"
FT                   /db_xref="UniParc:UPI00018332CC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWL3"
FT                   /transl_table=1
FT                   /translation="MAYNFHGLISSTKLNPWPPFRFCRGVWDVNHQPCVADHERLGILK
FT                   GCLGVNKWPKEASIPMLFSAVIFESSMSNLNGPKQLSRSDIRHHLNRDFDWSPYVLNCS
FT                   LPGDYADWIIEDYGFLFDAFPSYTLVQNVLRGICEEQQVIMEWPPGQVCFVFHFHNFA"
FT   CDS_pept        join(complement(97636..97703),complement(97412..97553),
FT                   complement(97255..97330),complement(97094..97160),
FT                   complement(97014..97046),complement(96832..96900),
FT                   complement(96603..96732),complement(96471..96518))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943621"
FT                   /orf_name="Pc24g00520"
FT                   /product="Putative uncharacterized protein Pc24g00520 "
FT                   /protein_id="CAP86960.1"
FT                   /db_xref="UniParc:UPI00018332CD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWL4"
FT                   /transl_table=1
FT                   /translation="MSHRSFLRILLSTRILAPSTTDRASLAVRERRSYVTGLVAATVVV
FT                   TEALKSLVAQLLPARIFVHADLSCEEKLHDQWKGQIGRDIPDRSPTPCPLGVGARKSPS
FT                   SGEQHTAACYVYLKFGYPGKDYPFRRGEYEARTEEPMSDVSNQRPPATTSEQDDFPRFT
FT                   RCGCYIEATRHTTYDRAMALIASIARNETYIEEAAREGGPEKAFRWM"
FT   gap             98029..98128
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(99283..99553)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        100144..101304
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670593"
FT                   /orf_name="Pc24g00540"
FT                   /product="Pc24g00540 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP86962.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00018332CE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWL5"
FT                   /transl_table=1
FT                   /translation="MMSPLRIPNISRNGRDQCRRRVKCDEQDLPCSNCMSPELDCTYLK
FT                   GMACNAASSRPQSHAVPISCSKSGSSPWQGGVNSPESKHSRSRQVNDMELIHKYSTETY
FT                   RSLSANDSENSIWQITVPSLALQHKYLMNGILALASMHIATSSETCEASVYLNTGLKYY
FT                   DQSLALFRDELNDITPQNCNAIFANSIVTVAVTVASSLLMDTNGEHSSKTDNAVILVGL
FT                   LQGVKMVLQTGRPWINLELFPHDECWDNAVAELDVDTSTALAHLATLNDEIMIGIFAEQ
FT                   HRTNKKLISHLRHCYAEFARSAGLGPVLAWLAAVEEDFVKSLRCREPFSLLILMYWGVL
FT                   LGELDEQRWWARDSGRALVSELLEALSSDDPSLEHAFAWIRRKMSL"
FT   CDS_pept        join(102767..102801,102978..103506)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(104468..104553,104630..105511)
FT                   /pseudo
FT                   /gene_family="HOG000234693" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(106454..106581,106633..106991)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943622"
FT                   /orf_name="Pc24g00570"
FT                   /product="Pc24g00570 protein"
FT                   /protein_id="CAP86965.1"
FT                   /db_xref="UniParc:UPI00018332CF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWL6"
FT                   /transl_table=1
FT                   /translation="YLAHFFLFHLXKKALLETVRFMPXFRPGXLIFHWRVNRYSPIPLD
FT                   NIKSEGXYNTSLSCRSSTLANIYMTTQLKRLYGVQGLHS"
FT   CDS_pept        join(complement(109035..109557),complement(108580..108973),
FT                   complement(108184..108520))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076702" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127650"
FT                   /orf_name="Pc24g00580"
FT                   /product="Pc24g00580 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP86966.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00018332D0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWL7"
FT                   /transl_table=1
FT                   /translation="MTTPFNEVPGDRTCQTIDKIVNNFVSQYHNKSLRPLRLADTSISE
FT                   FSTELSNHLSVLNEGGSIAFGRGEVLTSNSLSKSLESLFSITIPSVREGPPLTWTSVVL
FT                   FAGPQFEGPAQLRVGTSSVELSENDLRLLRSGRPWRFLFPWPDKDDCQKELQSNDTVLQ
FT                   ELVDARRVISEVQEQISLVEQHLRNHQDLVSQLSGNKDHVNNRGALPLDGAQSALPNQG
FT                   GFGPVSSTEQESSGYQDSSSPYLTVQNASNDRSVQPVNEELNDSAPPEVAIARDDLQRA
FT                   DSCPESDARPEPRLHASDFIQDLSEILDDPKNEAVMRWSEDGQSVFVAPESRFPTHILQ
FT                   KLSTKSHQSLVRRLYYYGFRKSGGDFHHESFSRGQPSSIGPKQEMSYSPSRLSPRDNAF
FT                   QHGPRYKVIKRKRPRESV"
FT   CDS_pept        111455..111843
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943623"
FT                   /orf_name="Pc24g00590"
FT                   /product="Pc24g00590 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP86967.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00018332D1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWL8"
FT                   /transl_table=1
FT                   /translation="MLTIDLTRALVTPRACPGGENVQFSHPAFAPGPRGPVAVPRMRQA
FT                   FDFPQATPEFAPFTVFFISLSSKAMVEEATPPPRKVRSACLRCRKKRVKYGGGIPACGN
FT                   CARAEVSYIDIHGGNNHLSIPRDFTVKCGARITCLEQQVLSIXPDFDMSQGPQVNMDFI
FT                   ETFLCAREFPEGYSREENPVNQRSHPTMEELDIGSPLSVKAARSVAIDPGMLSLESDFR
FT                   QKHYLGSLSGDFLYSVGHIRWYLIPLKSXYGIPSPEEASILLGVYFEKIHIDQAFLHPA
FT                   SLLHAYEALYTCAREGYDETTDRNGWIDAASPFPYNGKIETLGDRKMTPMSISMAIYHI
FT                   FVVFRPVATVLSRKKSYDHSPSKFYRMAMSTSSDYFSRISIQFVQALVLLAVXSLIEPA
FT                   GVGVWTLSHVVMAHCIDLAFHREAGAPSVSFLRSQSSTKIDIRLPGESEILDMTTISKS
FT                   ELPIHLPPCQNLVLSIWRSKLDQHLPDPXTDTRTFVWPTSIPEIQKQIKPDLDGWLTDV
FT                   SNISSTPDMDEEDKVKLHLYDTLSNQEPLLCTWRNIHGIFFSGATIVYCIWASRHLQST
FT                   VPFEKILRNLRTCSNHLSIGSQWWPSVRAGKESFEKMIDLMINFPRHMSKSLPLHQACL
FT                   RT"
FT   CDS_pept        complement(112296..113213)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076695" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823356"
FT                   /orf_name="Pc24g00600"
FT                   /product="Pc24g00600 protein"
FT                   /protein_id="CAP86968.1"
FT                   /db_xref="UniParc:UPI00018332D2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWL9"
FT                   /transl_table=1
FT                   /translation="DISKVVPKLKGQSNFAQWQHRLYMALKENNKIYIEIIQGIAQQPI
FT                   FPDLYDESIEVVRELAQHRAASSSYSDPNAPVSDAVVRELVKEQKHKKMEILERHQVLL
FT                   DKWDLVNTRCCNLIFSTLDTIPASRIQNFENAREAIELLRAEYGLSSWQGIFKRFEVLD
FT                   NIQHKSNNPQEFVRRFKEALLELQQRDTVLPANMVLNFFVKAVQGNPRCQ"
FT   mat_peptide     complement(113192..114619)
FT   CDS_pept        complement(114431..114679)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234746" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670594"
FT                   /orf_name="Pc24g00610"
FT                   /product="Pc24g00610 protein"
FT                   /function="DNA binding"
FT                   /protein_id="CAP86969.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniParc:UPI00018332D3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWM0"
FT                   /transl_table=1
FT                   /translation="MPPIRSQSSRNSIEKEGRILLAIQAFKNQKISSIRELARHYKIPR
FT                   STLQDRLNGHXSRAISRANSHKLTEIKEESLKKWILSIDRHRAAPRPSIVREMANLLLK
FT                   KRGTTPVISVSENWVTNYMKRRPLLSSRFSKRYNYERAKCEDPKVIREWFDLVQKTILQ
FT                   FRIDPDDIYNFDKTGFTIGLTATAKVITRSEYYGRRALLXPRNREWVTIIECTNATSXA
FT                   LPPCVIFKGKVFIKSXFDSLPEDWRFEVSPNGWTSDEIRLRXLKKLFIPTTSSRTKGAY
FT                   RLLILDGHGSHLTPRFDKICEENKIIPIYIPPHSSYLLXPLDIGCFTVLKRSYSRIVKI
FT                   KMRNGVNYIDKLDFLEVYPLARIKAFKLETIKNSFRSTDLIPFIPEIVISKLNIRLRTP
FT                   TPPSSRGSDXGSKNALELYLVIKAASSIKALLRIRSRSPPSPLNSAINQVLKAYQITMQ
FT                   SAALLEKEVSDLRAKNEKKKQKRTRSIRTIVHKGDLSV"
FT   mat_peptide     complement(114434..114619)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWM0 "
FT   sig_peptide     complement(114620..114679)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWM0 "
FT   CDS_pept        complement(116075..116255)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(117109..117627),complement(116936..117027),
FT                   complement(116258..116876))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943624"
FT                   /orf_name="Pc24g00630"
FT                   /product="Putative uncharacterized protein Pc24g00630 "
FT                   /protein_id="CAP86971.1"
FT                   /db_xref="UniParc:UPI00018332D4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWM1"
FT                   /transl_table=1
FT                   /translation="MPTEPIDFFGHRVSSPLPRIETVRHGLQPILKLMRLYIGILDRNG
FT                   SVAKQLHKPLFSNKIEDRINGLFSSSRPRVVELASDDSLRGGHPSWVDLIRESNLNNQI
FT                   ELRDEDQYRLCIRGLSLDLSKSDRDILSSNLLQKLLLMPPEPEDVQAEREARTELIKDL
FT                   RLACERTFQKTILQISQEQTHSADRDFTRSESSESPVEIHTTKPRPLSGWGDGQYSCGA
FT                   KHIRRGESHTALKDDFSVEPFGKETIARFLEYQGALELVADSARIRGDIPQGTKSFIYF
FT                   WSGSLPWSLCWTQAKKKPAQPAQPAKRDPLVLKVRFPSDKPSLTEQTKSAERVQQPTEN
FT                   SLGEEDPGIISEHTPQLPDMASSPMNVHVASPSVGPNVPSMMQFITTKDHANVRQSNHV
FT                   SPGSFGLILN"
FT   CDS_pept        121863..122351
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943625"
FT                   /orf_name="Pc24g00640"
FT                   /product="Putative uncharacterized protein Pc24g00640 "
FT                   /protein_id="CAP86972.1"
FT                   /db_xref="UniParc:UPI00018332D5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWM2"
FT                   /transl_table=1
FT                   /translation="MVCYIQVYGRQHGITTETAYQHIQLLEQAINHKFEESAHWHGKCY
FT                   HQDRVRPHPSWLRRDLVYACAGEKGNNRLNEVWYNTWIFRINLKIDGDLDERTARTLLG
FT                   LHMKVERIQFTERSPNETTKRMRELRDEIPWLADGSVEMRNTGDCRFFGRQFEIGRDI"
FT   CDS_pept        join(complement(123439..123448),complement(122746..123320))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217531" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127651"
FT                   /orf_name="Pc24g00650"
FT                   /product="Pc24g00650 protein"
FT                   /protein_id="CAP86973.1"
FT                   /db_xref="UniParc:UPI00018332D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWM3"
FT                   /transl_table=1
FT                   /translation="MYSSLFLLLPNTALPPGSVLLLLLHFLLLSNSRYRILQFLRSKTH
FT                   PPRPKVLTVAVYTLQMSSTAGIHVAIYNDGGVYKHWSLFVNGPTDAEQTVLHIMGSSTN
FT                   YRFEMRASDARKSATLSELIYLCDVPIAKVTSIKEAARQAPIHNEYPGYNCQDYVLDLL
FT                   DDLEGKRIINGNDANYKKKKEVVKSRQEGLA"
FT   mat_peptide     complement(122749..123234)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWM3 "
FT   sig_peptide     join(complement(123439..123448),complement(123235..123320))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWM3 "
FT   CDS_pept        complement(123961..125274)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943626"
FT                   /orf_name="Pc24g00660"
FT                   /product="Pc24g00660 protein"
FT                   /protein_id="CAP86974.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI00018332D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWM4"
FT                   /transl_table=1
FT                   /translation="MGDTPHPEALSLSNADAAQWNRDLILAFQAELERNPEADLMSMFS
FT                   DSYRLEHRNSQYRQLSYPAEINLRTLHELRDTLRDEPEVNVLSKFPTNYNRKITMATGP
FT                   KVLPLVEKDAPEVQAPEFRTRLDLAETATVIFPLSKEVVALLAQFSEYALEVGSSDNGK
FT                   ALVVPLKQLLWNSPKLWENPVRGVVVKCNDDIVAKVILGNRDYTEYTSMEFLAERAPDI
FT                   PAPRPYGLIAFGPFRVIFMSYIPGTTLAQAWPVLSHEGKLSIQQQLEDIFCRLRSLQQD
FT                   EGKALGGVRGEGAKELRVDECALFKGITTAMEFSNLQFSARHHGSNTYVTLLRSLLHHD
FT                   SPDMAHRLVFTHGDVRVDNIMVTKDRNINGHYIVTGIIDWEDSGFYPAYYECTTLTRTL
FT                   SLVDEDDWFLYLPESISPSKYSIRWLVDRLWGIHVRST"
FT   gap             126270..126369
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(127427..127543),complement(126973..127380))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943627"
FT                   /orf_name="Pc24g00670"
FT                   /product="Putative uncharacterized protein Pc24g00670 "
FT                   /protein_id="CAP86975.1"
FT                   /db_xref="UniParc:UPI00018332D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWM5"
FT                   /transl_table=1
FT                   /translation="MDASNSSPDQEKGEQRPCELPNLSNKDSNLEPSDHVLPLTSTSQH
FT                   EEVTRHSLATEPFQPILKVLADLERDDPKFAFPAARLVGFYRRLWESCVSKHIDVQKIE
FT                   QSNEILKEAGTYMRKERDGLQLRHDKQLARLRFFEQALESSRERLTSLLDDWNYPYSPN
FT                   LAGLTDVAREE"
FT   CDS_pept        join(128381..128471,128639..128672,128851..128981,
FT                   129028..129170)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823357"
FT                   /orf_name="Pc24g00680"
FT                   /product="Putative uncharacterized protein Pc24g00680 "
FT                   /protein_id="CAP86976.1"
FT                   /db_xref="UniParc:UPI00018332D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWM6"
FT                   /transl_table=1
FT                   /translation="MSLQKVAVKEDVGFNRPRLRNVSFNTSNQVVYIVDQQTRQFLYMG
FT                   PQILETALTRKTRDSQVRRGSNTMHQSKGHSSYLVLTIRKLNLWELTRVALITLHYRQC
FT                   STQSHGLHTIPSPVASNNASCPRWKIAN"
FT   CDS_pept        join(131865..132036,132086..132351)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943628"
FT                   /orf_name="Pc24g00690"
FT                   /product="Putative uncharacterized protein Pc24g00690 "
FT                   /protein_id="CAP86977.1"
FT                   /db_xref="UniParc:UPI00018332DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWM7"
FT                   /transl_table=1
FT                   /translation="MKRGGRRYKHLFKWLGGNTIKSQSTAKVEFKDAPETRTIQPKPRA
FT                   KRTREPKPQYSADSTPSTRCRFINGTRYRPWDLTISSTVKDVFSEADKFYGKEPRGLLY
FT                   RVEGETDDLLPCMLKNTEDFEIFKLCILRDCPGLVDFLPYD"
FT   CDS_pept        complement(134049..134513)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823358"
FT                   /orf_name="Pc24g00700"
FT                   /product="Putative uncharacterized protein Pc24g00700 "
FT                   /protein_id="CAP86978.1"
FT                   /db_xref="UniParc:UPI00018332DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWM8"
FT                   /transl_table=1
FT                   /translation="MSCNPAHLQWVLGQILGDPLHRERCIWAGDDGNHCQNTVPLDSRI
FT                   NGVLCFQLLQGPLLVYPLAQEFSSAAKQLLCFECRRRRCRSKVWATRFLNMLDQAKDVT
FT                   VHSEPHDSALLVHQWPTSMSHNVATAVCPNESFSKPEEAAWRRSQLATYP"
FT   CDS_pept        join(135204..135250,135285..136145,136198..136513)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127652"
FT                   /orf_name="Pc24g00710"
FT                   /product="Putative uncharacterized protein Pc24g00710 "
FT                   /protein_id="CAP86979.1"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00018332DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWM9"
FT                   /transl_table=1
FT                   /translation="MTVSGENFHVSSHDTIWRGNAAEIAQYQYPFESFSAFAISPMSSV
FT                   LPWNPFAVCGIPYGDPVSCCGVTKKGEPCKNSVKVQDTKIGHQKLTTLAREPFDLSTLQ
FT                   SKLYDIARVFLCARWHRQRQADQVGQRWYEAAIRNQAREPHGSRVAAPSIAHPGQRQMS
FT                   SVSSSRPAPGNTDRSPHGLRQDPPVRLSTNPEPVQPFNPFVTSAMLRTNSVPWHVSPAQ
FT                   PAILTSVANIWAGVQDLTLKDLTLSDQVDDIHCVFCLAEDEDLANESVILRCQCKALSH
FT                   LACAEEWLEKRSAGFGTSCCVCRNEGPLDALVRPIRVQSSDAETRHFHSASESSPEGEL
FT                   ATIMESSPNDPSRSQLRQRSVGPQGRSVERSVENGPRRSARLGAHLPRGPSTSAPPRRS
FT                   ARLNSTRR"
FT   CDS_pept        join(complement(138077..138565),complement(137915..137941))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943629"
FT                   /orf_name="Pc24g00720"
FT                   /product="Putative uncharacterized protein Pc24g00720 "
FT                   /protein_id="CAP86980.1"
FT                   /db_xref="UniParc:UPI00018332DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWN0"
FT                   /transl_table=1
FT                   /translation="MIRMRHVIISLTITWLALAGLSSVTVHFAVLLRDRAESDLVTPSD
FT                   SILDITFENLMDYIVDGMVIAALVSALFSIFGFDLVIYPKWLQENCAARFYYGCIQIVV
FT                   SMIVLSLGGWIASRVHGFQTSFEFFARSHIPYYKIMYYGSFGQAAFGSLVIIMSLVHFP
FT                   NYMMIFEE"
FT   mat_peptide     join(complement(138077..138496),complement(137918..137941))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWN0 "
FT   sig_peptide     complement(138497..138565)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWN0 "
FT   CDS_pept        join(140013..140094,140156..140763)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076627" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976566"
FT                   /orf_name="Pc24g00730"
FT                   /product="Putative uncharacterized protein Pc24g00730 "
FT                   /protein_id="CAP86981.1"
FT                   /db_xref="UniParc:UPI00018332DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWN1"
FT                   /transl_table=1
FT                   /translation="MDHKVLQVPKRSNIPDTEEHNGLTWQTGNESAKNFRRAVGQFSHR
FT                   DRGHTSQVLQLSVDQSTSSVSTEVATSVASSRDYMMPKSAIKAECQDLPPLNVRKRVAD
FT                   SSTFPRKQRRHSSSASQVQGGSQGAYQEIYRKRPRTLTTISRKLAIDTIQYLQTLSDRI
FT                   LISDTIFPREWATMHLATQLLQSRYEDIVAREEIESDTASECTFSPKQPVKKCPKCAAA
FT                   DEEELYD"
FT   CDS_pept        complement(141430..141759)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670595"
FT                   /orf_name="Pc24g00740"
FT                   /product="Pc24g00740 protein"
FT                   /function="catalytic activity"
FT                   /biological_process="trehalose biosynthetic process "
FT                   /protein_id="CAP86982.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005992"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniParc:UPI00018332DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWN2"
FT                   /transl_table=1
FT                   /translation="MPSPWMLMVRLYSNRLPVTIKRSXDGEYDFSMSXGGPVSGLSGLC
FT                   KSTTFPAYVWPGPEVPGPEIPVVKQRWKDEYGAVPVLIHDHIKDRHYNGFSNSIPWPLF
FT                   PYHPSGMTFDEFAXEAYEKANRVFVKAISDEVRDDDLIXVHDYNLKLLPEMLRNLARSK
FT                   QSVKIDFLHTSFPSSEIYRILPVRNEILLGVSHCGIIGYHTYDYARHFLSSCSRVLGLD
FT                   TTPYXNRDAGKYRSIVTCSAFRIGINPDXFKRVFRKENVQKRIVGLXIKFEGIKLIVGV
FT                   GHLHHIKGTPQKPHASEIFLSANVPTHSGLALQSGLARPLVAVPSRXDVEEYQNLXAVV
FT                   NESVSRIKRKLSTVEYMPIHFLYKXVNSHELVALHSASNACVVSSTXDGMNLMAYEYIS
FT                   SQQKYHGVLSLSEFAGAAQILNGSVIFNPWRPVELASAYREAVTMDDEQRAVLKVR"
FT   CDS_pept        join(complement(142710..143102),complement(142204..142656))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076600" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823359"
FT                   /orf_name="Pc24g00750"
FT                   /product="Pc24g00750 protein"
FT                   /protein_id="CAP86983.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001833352"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWN3"
FT                   /transl_table=1
FT                   /translation="MNPYATDPDDIPPSDLYADLPLYGRYHPKPDDFRIDRQHINSESR
FT                   DSLEYWASVVDLCNQTVRIYPADEGGRDVFALGSIIVKSSHLHAPGGARYTEIDYSYAD
FT                   ANEIQAIAIAKNVLKDVRVPEIYFAGKINGRHILVQERLPGVALAVAWPYLSQSQMESF
FT                   KQQAREILVQLHSVKPTDRCQIRSYVVPDPNIRNNGRIQPLECDILFSDSNNDPDMSFM
FT                   HNDFTDSNCIVDDDKIVGLIDWEMAGFFGWNTAGEVHRRLRSHDTPFWNDLYDYEYLHT
FT                   "
FT   CDS_pept        join(complement(144368..144626),complement(143909..144258))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943630"
FT                   /orf_name="Pc24g00760"
FT                   /product="Putative uncharacterized protein Pc24g00760 "
FT                   /protein_id="CAP86984.1"
FT                   /db_xref="UniParc:UPI0001833353"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWN4"
FT                   /transl_table=1
FT                   /translation="MQTLTKISIRGDYLCKAYFRQRMKKHPLPPGPSHAYRGQSLGSQK
FT                   YLSGYGRLGHYGLGKIGQTAGVSSSGRALAFILFLIGPRRASRRSLRQAHQEHLYKGRA
FT                   YMSSLTLCYLCYHLHPREADNTPAPAVQNFLPLQTNMAKRCSVCDGWIKTGGGAHICPG
FT                   APAPKPPSNPPQPKAQDELSTLSNIDDDKAPLLRSFHLI"
FT   CDS_pept        join(145119..145280,145348..145611,145705..145776)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943631"
FT                   /orf_name="Pc24g00770"
FT                   /product="Putative uncharacterized protein Pc24g00770 "
FT                   /protein_id="CAP86985.1"
FT                   /db_xref="UniParc:UPI0001833354"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWN5"
FT                   /transl_table=1
FT                   /translation="MTLLETAQNRVITQAETSSEGFSDIDQDVDAVLSEHPLEALPPLS
FT                   SQGTAKDFHDHRRVYVYPASPDLLQCQDLFGAQSLCYKSSSNSPTPINYAGGNGKLRSS
FT                   GFWLRESFNIQISHQPTQPTGHNLISSSRIMTEDTIAVRWLAFLTNHPFWVAGAGWCLG
FT                   RP"
FT   CDS_pept        join(complement(148488..149015),complement(146222..148420))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127653"
FT                   /orf_name="Pc24g00780"
FT                   /product="Pc24g00780 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP86986.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001833355"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWN6"
FT                   /transl_table=1
FT                   /translation="MSRALVSCNNTTKRPYLAASNTSTHLDSPFAMDRISSPEGHHAPM
FT                   SPLQRPRYPFMRNREVPSESMYGRLNEHGLPIPAPTDSAQVPVPYQNFQQSTKGAPYEG
FT                   SPGFRAHMGYPLLNRVNNAEHLSVSRSLPPVSDSTIRVTQMAKDTPHVGYSQGSYQREV
FT                   LKAPQRKAHRATQACDQCRARKAKCDEGRPCCSHCKVNNLGCVYKEVPLHKEEKTTQLV
FT                   LDRLSQIETRMEERANRIDEHFAKWQDQMQEQVGFNLAEEVRHTHPTVQEHPALPPSPV
FT                   IRQDSPLKAAMPQTQDVSGSKFGQQLGAVDPRYRQKEAEGELSIPVEHTTAAHKLLMWP
FT                   SIKRLIHPERYDEDYVMRLEEEHGLISIYGQGEISYTADNSQLPMDCESKGAQPGVNGA
FT                   GQHVNIDIDEFGNLDLDATTARRYYDSYFKHMFKLHPFLMEGELGIKVDNFIESYCRVN
FT                   NSPPSSVSSYARPARDGPPPAKKRQSNEDLSVRGEFMETVSNPLRPRVGKNIDTALILL
FT                   CLAIGAICEAPAPLPGPIMDKKIDYLNQHIPAPLTPLHSPPPLITAYVTDANGVLPPAN
FT                   SDSAAVQMSLSNPLYSVPAQSARQAFPNSSSNNGMEGLSRRDITNTRDKQGNTRNYQAI
FT                   PGLTLYGYATAILGHLQGGNELEHVQCSLLAGLYAGQLAHPFQSHSWISQASRACQILV
FT                   RTKRYEQLNEGATKDLYDFAYWTCLQLESDLLAELDIPASGISRSEGRIPIPKGKWTMF
FT                   LPNNLTAPETMTMLFYSAQIHLRKILNREHTDLYKVEKQDQTRWSFTVQEALSLNLDRW
FT                   RESLPDSMQWDESDPPANEINAARMRAKYYGARYIIHRPLLYHVLHYGHTGARVGPISQ
FT                   NSMESPAFQQLPPSMLNMSARAPSMARMSSDMGFTPV"
FT   CDS_pept        join(complement(150653..150794),complement(150557..150597),
FT                   complement(150332..150493),complement(150125..150274))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076806" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670596"
FT                   /orf_name="Pc24g00790"
FT                   /product="Putative uncharacterized protein Pc24g00790 "
FT                   /protein_id="CAP86987.1"
FT                   /db_xref="UniParc:UPI0001833356"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWN7"
FT                   /transl_table=1
FT                   /translation="MAITYLKKELPRRTNQHSDREAPKPGEGTAQSLPNQDHRVWPCQI
FT                   YHFSEVDQSMRTKPIQATPPYVRSHCTFDDGSSLNDRNASTVFKPRERAKQMDSTPVLG
FT                   GPESPDEGVGTDRNTQDGAEEKAPVRAGYGNISPGAKFVNGDMSRDEFLEYFCGRKSEY
FT                   V"
FT   CDS_pept        join(152116..152538,152741..152869)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943632"
FT                   /orf_name="Pc24g00800"
FT                   /product="Putative uncharacterized protein Pc24g00800 "
FT                   /protein_id="CAP86988.1"
FT                   /db_xref="UniParc:UPI0001833357"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWN8"
FT                   /transl_table=1
FT                   /translation="MTSHDSATQPQSSRSCDYPPYNQESPPQASVEALQKALKAQVLHS
FT                   LRVLRKIAMDHQALNLVPEIIDGWVADIEGVDAKNIPIASSMAAQMSVPFERFTILTKC
FT                   ITATGPMQQLTIRHQTTELLKYILSYAEEYYLVQGSQCRYPRIRPVKASVLSLRWVSRE
FT                   YSNVLPIAHLGTSIVLCDTE"
FT   CDS_pept        join(complement(153833..153967),complement(153664..153722),
FT                   complement(153459..153552),complement(153189..153239),
FT                   complement(152991..153104))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127654"
FT                   /orf_name="Pc24g00810"
FT                   /product="Putative uncharacterized protein Pc24g00810 "
FT                   /protein_id="CAP86989.1"
FT                   /db_xref="UniParc:UPI0001833358"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWN9"
FT                   /transl_table=1
FT                   /translation="MAKTFPTQVRRALVGGKLDDSVSLSIAEEKLCRSDIATGDGLYLM
FT                   SAVHLFTPQAHASHPGLNNRQVSNATSQILLCYCIFTVQQENEILTNGSPWEAAVSKSH
FT                   GCNNRIFIEDLSVKESVQSRVPHDEEVPMMHLWSNYTPVPKAQRRP"
FT   CDS_pept        join(complement(156370..156975),complement(155816..156238),
FT                   complement(155418..155756))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194425" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943633"
FT                   /orf_name="Pc24g00820"
FT                   /product="Pc24g00820 protein"
FT                   /protein_id="CAP86990.1"
FT                   /db_xref="UniParc:UPI0001833359"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWP0"
FT                   /transl_table=1
FT                   /translation="MQNPTSSAPPVDMGPFPFVFRPSVAIPQFCVAYRWWEDEAINMLW
FT                   AYDFNDISQAIRFGLFHDESSPRSSLLSRNMQFINECLFAASKPYDHCRLSELPHLQKV
FT                   EEILLRSSIPQRPLLTWNWIPTISGGSSDPRSIALEIEAESYFHFQQIAFEDIVRSALG
FT                   YKAVSVEWFLQQHTSLYALLVDHLRMYPEELLLYLKIEKPEGKHDMPSHDTPGFAFIAA
FT                   PIQQLFKNHSSSLSTIFKVLSVLAVRFQKAYRHSDQMNWFEPFETSLPLLEDCLSSSAT
FT                   DFAGALTQTDKCLFDGLSRGTHIEEDAMLSEALIYWQRLSNSVLECCSGLPHLVPYLQA
FT                   CTLELYEARNYYSLMAILDGLRKYIAIGSNIFRDFAASRTVTPAHLIPPKILPLIDPSH
FT                   NFVSYRQRYNQHPGIPFLQPHIREFKQRGESVEQSLFRLFQTTTSSQREDHGQVST"
FT   CDS_pept        join(158455..158506,158895..159375,159439..159952)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670597"
FT                   /orf_name="Pc24g00830"
FT                   /product="Putative uncharacterized protein Pc24g00830 "
FT                   /protein_id="CAP86991.1"
FT                   /db_xref="UniParc:UPI000183335A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWP1"
FT                   /transl_table=1
FT                   /translation="MALSGLHLARNWMQAGVDSNQTYDCDSMYHDGNSSSGSSTYPLVG
FT                   VPIDYPYGLTPAPLMDSAPAVDQASDVCWSFEQAQNWTITRASPTVTLSPLPISRYREI
FT                   RPRPLHESASTLPPVQPGKEEQHSQYRKLGRRKHSKSHRQSDQGYLKKTARSAIRTASE
FT                   VTDTTKKQVRVGRMRAKPPKAPGGDSATQGPRRRSPDCSSNHPEDSPQASVGALQRALK
FT                   AQVLQSLEVLREIAKEFRAFNLGLETIDDWVAEIKEVDETLIPVPSSTAVLQVHVPFEK
FT                   LSFILTKCITASGRMRDFIVRDQALELLKYIQTYAEEYHLFKNLRVHLDIGRYIERLSQ
FT                   GKDNEMGK"
FT   CDS_pept        join(165614..166263,166306..166693)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076809" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943634"
FT                   /orf_name="Pc24g00840"
FT                   /product="Pc24g00840 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP86992.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000183335B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWP2"
FT                   /transl_table=1
FT                   /translation="MFQERDKHLLLLSPAQPLPQLDQHDGPSLPKVNPLTPPATPVPNW
FT                   DSRVLPSWPDAGHGIWMPNKRDTTSLERECRVDHGVIQAYHCFPGSHYHAPMPLRDHGM
FT                   PSLCLSQKTDGSLESTSIPYLPTLVPCHLRQIDSSPMSNVVERAPGAGSSTMQTVNPAL
FT                   VFPASATASETLDITSSLPAAPEVGPIPSGTGIVSTWILDQPQEKSQVLHGTTIRQHNH
FT                   NLNLENQQSDMHERRFKCKIVGCRMGFKREDHLERHTRSHLKEKPYVCWVPGCHRTFSR
FT                   RDNLKVHCTKTHTRRGGRNRYVATLDEASPDYDPEFRGQLSFDGRPLRFLAPISSVPEA
FT                   KPLQP"
FT   CDS_pept        join(complement(167682..167798),complement(167230..167625))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823360"
FT                   /orf_name="Pc24g00850"
FT                   /product="Putative uncharacterized protein Pc24g00850 "
FT                   /protein_id="CAP86993.1"
FT                   /db_xref="UniParc:UPI000183335C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWP3"
FT                   /transl_table=1
FT                   /translation="MDSSEQLPDQDRADRQPSEMPRESDEAYPQAVSDSEPPLQQEEIL
FT                   KKPLTIEHFQPILETLADLDRDDPKLAFQAARPVGLFRRLWASCEPKHSESEIPDENDR
FT                   PPKEAATKLNKQRDGFQLRPDEQLSRLVSLEEALEQTQERLISVLKVWNQSSRGDLAML
FT                   MDIERCS"
FT   CDS_pept        join(complement(170942..171466),complement(170634..170861),
FT                   complement(170052..170369))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943635"
FT                   /orf_name="Pc24g00860"
FT                   /product="Pc24g00860 protein"
FT                   /protein_id="CAP86994.1"
FT                   /db_xref="UniParc:UPI000183335D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWP4"
FT                   /transl_table=1
FT                   /translation="MSRPVSKFAEWLARASIQDTFGLCGLLALVCWICCSLGRRFRHLP
FT                   LRLQQVSWRSFFQAPTPGVLQWLDIPTYLQGGVLTALVIANTIVISLHAQTWVDVQRRA
FT                   GCLAVTHLVPLCSGFSFSLPAHVYYVERDTFYWAHRWLGRICVLHCLLHGSVLGANARN
FT                   KSHGARLAIPLLAGCSLVSILPWTLAAILRRWPQLGLKVHYMLASIATGALFYHLIDRV
FT                   SSYRWVLLGGICAGCAWSAGTCLHTMWYHIAQAADHATYSTIHFPVCVLGPYGHPPNLG
FT                   QYGTIVFVLEDIGLFRALPFIRHLVQESRSRRNTVRRLEVLWQVRLKHFSESPIMLGCF
FT                   AVSCAYRNRPPPLGGG"
FT   mat_peptide     join(complement(170942..171352),complement(170634..170861),
FT                   complement(170055..170369))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWP4 "
FT   sig_peptide     complement(171353..171466)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWP4 "
FT   CDS_pept        join(171571..171655,171695..171744,171973..172074,
FT                   172320..172416,172462..172547)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076811" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943636"
FT                   /orf_name="Pc24g00870"
FT                   /product="Putative uncharacterized protein Pc24g00870 "
FT                   /protein_id="CAP86995.1"
FT                   /db_xref="UniParc:UPI000183335E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWP5"
FT                   /transl_table=1
FT                   /translation="MAWESDAAKMTLVSNDQKPHFMTWDGVAVVIRLMSIARRASQKNH
FT                   VVLALRFLRLPTSTICLSTVLFPIRAFYRVGPFEILLINHLPFYHLHGNVVGCPKVAAD
FT                   GTVISGTVLLTGRDHGFSFPEHLELPDYRMLHVIF"
FT   CDS_pept        complement(173315..>173899)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076815" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943637"
FT                   /orf_name="Pc24g00880"
FT                   /product="Putative uncharacterized protein Pc24g00880 "
FT                   /protein_id="CAP86996.1"
FT                   /db_xref="UniParc:UPI000183335F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWP6"
FT                   /transl_table=1
FT                   /translation="SGNLKIILANTKKRKQAKGLRASLFHFQDCVLEKVPPYFSSWSTE
FT                   FWVSDSVVIDSKSIEEAELILKALRPERLDEMGYVCVGLPVTIFGPLFNTLISKWNASA
FT                   ASFEHSNGFIWIYSVVDPANFKITTGESDSSTNHSVYYLLERMSGKSWLVRAKLTFRLE
FT                   TSSREKAAILAELLEVSHVQVTSSHKPITHS"
FT   gap             173902..174001
FT                   /estimated_length="unknown"
FT   CDS_pept        join(175046..175102,175158..176318,176376..177129,
FT                   177178..177704)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823361"
FT                   /orf_name="Pc24g00890"
FT                   /product="Pc24g00890 protein"
FT                   /function="DNA binding"
FT                   /function="protein dimerization activity"
FT                   /protein_id="CAP86997.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR003656"
FT                   /db_xref="InterPro:IPR008906"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001833360"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWP7"
FT                   /transl_table=1
FT                   /translation="MCSIETASSSSSVPMSLSSLFNRPSGIVTLEDRPRSPPAKLTRFA
FT                   PGRRDWVLYDSDQEKEFLSWWLETEYGQQLTKNGKYKFRWSAESRSSKVWKHFDQVAEL
FT                   SSGRPKVVCRSCLTPLNHPHHPRHKSHGTSTMGKHLKSNSCRRSKEEVSVSAVTPGPIQ
FT                   ESRASFSPMRSRFTKAQFEGHLLRTITSANLSFEVTEEPTFRELLDLVYSGPQALEVPS
FT                   SKKLRHYMHDIVTTYQESQLQDLPGDSKVSIALCCWKGPFGQDFMAITAYYFDKEWSYR
FT                   EVLLGFELICRSETGNDPCDQILGLIQEKGLLHRIFSVTVDYRVDENLMLSLREKLTSS
FT                   GGISSWQCFVGVPGIVQTIQLCLRRYIENITSSPEGERVENVREISHANGWTDPSDGDE
FT                   ISHVLGKIRSFAKFVNETPRKRDEFLCLQPASTRVLPLDDARSRWNSVFLMLKRAGRLR
FT                   RYIDQYCQESGNLQYKLTNTDWRKVDYLVQLIMPFIQFTTALLASREATVHRVCFVFKI
FT                   LMEHLDESTRILRRKSAPWKRKLSEASLIMKMELGEVYEKTFQNFGVMYGPGTFVAPQY
FT                   KVSAFDEATSSQGLGQPERYIEYLRIFHLQYRPQMPTSLSCVNGLSCSPQLLGLDRLLH
FT                   PLAGLAGSSRCAQDEVDQYLREGVLNISPCAYWKDHQREWPVLTRLARDLLSIPATGAG
FT                   TERLLTVAQNICRTRGGSLDESTMRDLVMYAYSEGSESGKQSISRVQRDMASDDEWEEF
FT                   EVEAERPEPISDDEWDSAEMSVDERSGDDENSQAEAVILEIPPTGDLEQDVTDKGEGGS
FT                   FLPPPVTQLINSLRRRFSGR"
FT   gap             178654..178753
FT                   /estimated_length="unknown"
FT   CDS_pept        join(182989..183079,183246..183381,183460..183590,
FT                   183637..183855,184283..184288,184402..184739)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670598"
FT                   /orf_name="Pc24g00900"
FT                   /product="Putative uncharacterized protein Pc24g00900 "
FT                   /protein_id="CAP86998.1"
FT                   /db_xref="UniParc:UPI0001833361"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWP8"
FT                   /transl_table=1
FT                   /translation="MSLQIVAVKEDVGFNRPQLRNVSFNTSNQVVHIVDQQTRQFLYCK
FT                   RRGSKHSLPHLRQPMGDTGFGLAGQGVYAKRYMGSQIFETALTRKTRDSQIRGRSNTMH
FT                   QSKGHSSSLVLTIRKLNLWELTRVALITLHHRQCKAMAYTLFLAPSLRTMQHVLGGRSQ
FT                   TKIASQQQGAEIQVQALVASKLEASVLPDKSYQPLLTRIVQQENTLISVTQVECHANKC
FT                   LVYSSSPIQILSHALRPFHMTTIDDESQKVRIAHLGLFLPIDSAYRVIVRFVYMIQLLN
FT                   SDQPIPLPKSYLWLSMQPFKYLQVA"
FT   CDS_pept        join(187574..187710,187805..187890,187936..187984,
FT                   188175..188208)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943638"
FT                   /orf_name="Pc24g00910"
FT                   /product="Putative uncharacterized protein Pc24g00910 "
FT                   /protein_id="CAP86999.1"
FT                   /db_xref="UniParc:UPI0001833362"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWP9"
FT                   /transl_table=1
FT                   /translation="MAHEVGFRDRHPLARLQRYYHSHETLEKNSTRRANQTPRANLDRR
FT                   RSRHDPQAQTFRPSVYDGPGDCCLGTAGAGYNPIRGCVHLVAVIRKNNASGSHELT"
FT   CDS_pept        join(complement(189049..189448),complement(188884..188996))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076477" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127655"
FT                   /orf_name="Pc24g00920"
FT                   /product="Putative uncharacterized protein Pc24g00920 "
FT                   /protein_id="CAP87000.1"
FT                   /db_xref="UniParc:UPI0001833363"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWQ0"
FT                   /transl_table=1
FT                   /translation="MSPRSEVAWEEWEEKNLLAWLDAHRALPWKARSHAYSEQYQMDRS
FT                   AESLRGKKYHILRKQRRIGARPLEHPGHPSHRSRAGAHRSAGHKASLANLTSRRPAQSN
FT                   IEKWIQTILTTETSQIDSIESMKRKGSRPGRAMPLLRPLRREESRSSSQIWNYVHRVCA
FT                   ARKLRYR"
FT   CDS_pept        join(189782..189820,189973..190427,190488..190734)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076481" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943639"
FT                   /orf_name="Pc24g00930"
FT                   /product="Putative uncharacterized protein Pc24g00930 "
FT                   /protein_id="CAP87001.1"
FT                   /db_xref="UniParc:UPI0001833364"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWQ1"
FT                   /transl_table=1
FT                   /translation="MNKALNSQTKPHRWALQTLIATSGLENDLFISACATSLVTSGWEN
FT                   SLSHLDTDPTMGRIRKIPFTDQRQSFRSRLQRALSLSSSGSEDIWSPPGSAEGDTTEEE
FT                   SSLQENGSFGNHQNDIAVEDGQESPPHSWSMGPRPEEGLEQPGQANLAEDCNMIALQCA
FT                   ADLDIRTKLVMRLTRERTKADFPRLMQKALDNSNSWIATIRSDLEDIRSRLAVVETAME
FT                   MMAKEGKNSTTEDNATRRTLRSQQ"
FT   CDS_pept        join(complement(192387..192557),complement(191874..192281))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200310" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670599"
FT                   /orf_name="Pc24g00940"
FT                   /product="Putative uncharacterized protein Pc24g00940 "
FT                   /protein_id="CAP87002.1"
FT                   /db_xref="UniParc:UPI0001833365"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWQ2"
FT                   /transl_table=1
FT                   /translation="MAKDQKPSRGDADRGTATTKPGTGRACAPSPYSARSTASRSKAER
FT                   NPLKAVGNHKGLGHSTAKSTRKKDHEATHRKCLDVMDQIQKEVQLALEEIDEERAHDSQ
FT                   SMQRLHAEKAQDTSKLQEAITARDKALGENQRLEKRALSTAAGAGVISRHHAGPGLMAR
FT                   YSAGLASNAWRASIGDYSVXEHDRRPPEP"
FT   CDS_pept        join(complement(194146..194192),complement(194009..194051),
FT                   complement(193715..193944),complement(193588..193605),
FT                   complement(193181..193366),complement(192999..193044))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943640"
FT                   /orf_name="Pc24g00950"
FT                   /product="Putative uncharacterized protein Pc24g00950 "
FT                   /protein_id="CAP87003.1"
FT                   /db_xref="UniParc:UPI0001833366"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWQ3"
FT                   /transl_table=1
FT                   /translation="MVEVVPTVIGECRRIRMSRMLEKEWDLAISLIHPLNVYKLSARVI
FT                   RLAIESEHIESADFAFEVGILFGEASTEEVTYLLEHPSKDETNENQQVATRRRTKLFSC
FT                   ERSRTKQQRVLPECDSSVAISRGKMAIVEYPSSRALVVEMPQMVAPETKPRFLLWLFPH
FT                   DLEVSWSAMEPWAQLSEIVAIAGQCK"
FT   CDS_pept        194750..195858
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943641"
FT                   /orf_name="Pc24g00960"
FT                   /product="Pc24g00960 protein"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP87004.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00018333E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWQ4"
FT                   /transl_table=1
FT                   /translation="MTYIDTRITVNRKRLFITAQXKGLCDGSLGGLYASRDIIGMGIAT
FT                   TIVPPIYILEISPKAIRGLLTLQYAACQQLGVVLGFFITTAPAKTXWMLPTLLXPLPAA
FT                   PWAIGAFFCPKSPRCRXVNGREEAGTALSKLRHLPVEDPVVADELDGLESQLLMSMSSG
FT                   VQPLYNGFPKRRLVPVASRRRFFLLFTATLFSQWPRANVITQYSXVMFGYLGTVGDSAT
FT                   FPATVIYXVVKSVRTMLFAVVIVDLVCRQRLLLTCRSEFAFVGTCAEAAKDMTTDEMKV
FT                   SPNAEQTSTAAIVAIYLYTVTWSFGWFSIPYLIRPETSPTCIRPLNMSISLLLHWAFHF
FT                   GCSKMLSLFAATNRWGALLFSVRWAWFMFFPHAVEKIVLLMPRSSATMWSGTTRRSLEA
FT                   LDKLFGQPWYTVRKVAHATKDEIRTQIASSSSTKNALETGKSMPRWRPHSRFYCCDRHL
FT                   DCKRVPT"
FT   CDS_pept        complement(196782..197084)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076633" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823362"
FT                   /orf_name="Pc24g00970"
FT                   /product="Pc24g00970 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP87005.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI00018333E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWQ5"
FT                   /transl_table=1
FT                   /translation="MDVQPKLKTKPADAANQKARRRRKSLFKKASXYSSECDADIHLXL
FT                   RMKKSGKIFVLVSNTKDWPLSQHQLVSSLHHRSRRQKGTKLISRSTIILHPFKCL"
FT   CDS_pept        197702..198527
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943642"
FT                   /orf_name="Pc24g00980"
FT                   /product="Pc24g00980 protein"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP87006.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018333EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWQ6"
FT                   /transl_table=1
FT                   /translation="MADNTQPVQLVEKEGASDAMHQEHKEGLNEGVKEGIKVETVQGSV
FT                   ALDIARRTDPPNPWSAQMRKLYLFMTVAYLCSALNGFDGSLMGALLPIEQFRNTFGSGL
FT                   VGAKASLIQGMYTIGGVSALPFVGIILDTWGRRSGMFLGSVGVIVGTILGGTANKMDQL
FT                   LASRFFLGWGYSLASAAAPAYVVEMSHPAYRDILTGLYNCQYFVGAIAAAGACRGCLKY
FT                   QSSLAWRIPIWCQLISSSLVVLTVWFIPESPRWLYSHGHREKAWDVITRYHGEGSRDNA
FT                   YVHLQVREYEEAINLEGADKNAFDFRSLIGTKAARWRLMCVGIASFMSQWAQAGVTTYY
FT                   IGGLLASAGMTDTAQVLNVNLGNTVLSAGLAYLGSYLGPKIQRRPMMMGASVACCVRTC
FT                   PACFFPINQCSTLTILDMKICFACFSATTGVFAKSEDPGAATASIVFIFLIGACFSFAW
FT                   TPLQAMYAVECLSYETRAKGMAMYSVFTNIALLVNQFGVGNAIAVIGWHTYIILAGWNI
FT                   VQGVFIYFFAVETNNRTLEELTEIFEAPNPRKKSTEARQVLVSENENQVVEVKSA"
FT   sig_peptide     197702..197761
FT                   /db_xref="UniProtKB/TrEMBL:B6HWQ6 "
FT   mat_peptide     197762..199417
FT   mat_peptide     197762..198526
FT   CDS_pept        join(complement(199928..200449),complement(199777..199876),
FT                   complement(199544..199725),complement(199393..199500))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076512" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127656"
FT                   /orf_name="Pc24g00990"
FT                   /product="Pc24g00990 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP87007.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00018333EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWQ7"
FT                   /transl_table=1
FT                   /translation="MMNRAQTKHTRPSTVWLDESAFCNQQLSPNSTASPHIQPPTIQKM
FT                   ATAVITPGSMEPHPDRPSASIPQLNQNPWDTFEPAAGSSQDRSLIFARNKSEKGKLVHI
FT                   QQLEKPFSPATGFLELMEQVIHPSFLKLLECYHHDVSCTLIWEPTEVSVSHILASSCSI
FT                   TTDELVGIVKPVLEGIQYLRGLGRALATLGPETILLTQSGDVKIMGVENSCEIKESEMN
FT                   PATMKLCALADVVTKLMLKNRTYEWEAEIQNLPCQLESISVEEILQNEMFTRDSCEGEL
FT                   KLLVSIANKTAYHGIKSYYARC"
FT   CDS_pept        join(complement(201650..201672),complement(201505..201557),
FT                   complement(201322..201346),complement(200921..201263))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076513" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943643"
FT                   /orf_name="Pc24g01000"
FT                   /product="Putative uncharacterized protein Pc24g01000 "
FT                   /protein_id="CAP87008.1"
FT                   /db_xref="UniParc:UPI00018333EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWQ8"
FT                   /transl_table=1
FT                   /translation="MIYLKAKVSPKTRFSWELAGFASAYETVPHVQNHTESFARDIITT
FT                   HPTVGACVGDEMASTQSMKTTQTPSWNNAAMPLALIIPTFTLPTGGTVEAITTAHIPAP
FT                   TRIGPTLPAEGSGNVVWSSTTRWLTLCYLLLLVVKIIDERRTI"
FT   CDS_pept        join(complement(203187..203560),complement(202827..203058))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943644"
FT                   /orf_name="Pc24g01010"
FT                   /product="Pc24g01010 protein"
FT                   /protein_id="CAP87009.1"
FT                   /db_xref="UniParc:UPI00018333ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWQ9"
FT                   /transl_table=1
FT                   /translation="MGSEKTPLREIEPVLVPPCSATDVTPGLCRANQIHLANETIYARM
FT                   LREEADMDMRFSITVGAANWALLAGYLVIPGTFTSLQTLNQVERTLQANEAGRTVLHMI
FT                   QNPPLLAIACLLFVSGIAALIPLCLHAAAGLLTTVINVCTSQGGDWSVMAIITTAVTGA
FT                   TLLSCSALLALYKFYRLERVRKEDEDIRRSRASTALDT"
FT   CDS_pept        join(204051..205041,205103..205633,205695..206100,
FT                   206246..206477)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943645"
FT                   /orf_name="Pc24g01020"
FT                   /product="Pc24g01020 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP87010.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018333EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWR0"
FT                   /transl_table=1
FT                   /translation="MSIDGVKTARVSASNADGSDEEWQKSDQQKGEGTFGAGEGHHFYR
FT                   PIDSYEGLHRWDPNFQWTEKEEKRIVRKIDARVCTFACVTFFALQLDRGNIGQALASTL
FT                   LEDLGMTSNDYNLGQTVFLVCFLLAEMPSQLLSKRIGPDRWIPMQIVSWSXVAACQAFL
FT                   KGRGSYLACRALLGFLEGGFIPDTILFLSFFYKSSELPKRLTCFWISYTVAGIIGSFLA
FT                   FGFLHITDANGGGAWRYLFAYEGLITGVIGIIAAFWMPASPVQTKGGLRGKNGWFTEHE
FT                   EKIIVNRVIRDDPSKGSMHNRQAVTPRRFWESLKDYHMWPIYALGLIWLIPTHPAQSYL
FT                   TLQLRSQGFTTFQTNLLTIPSAVLAIITLIAITWIAERTNQRLLWGVGVEVWNIVLLIA
FT                   LELLPQKSMPWPRWAILTLLVGGPSIHPVVVALTSRNAGSVRTRTVASALYNMSVQLSN
FT                   IAGANVYQEKDAPYYKNGNKVLIALAVVSGFLFIFAKFYYDWWNRRNTAKWDAMTSEQR
FT                   EFYLRENPVLTNKRIDFRFAR"
FT   CDS_pept        join(complement(208900..208927),complement(208200..208837))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076500" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943646"
FT                   /orf_name="Pc24g01030"
FT                   /product="Pc24g01030 protein"
FT                   /protein_id="CAP87011.1"
FT                   /db_xref="UniParc:UPI00018333EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWR1"
FT                   /transl_table=1
FT                   /translation="MVPKDLLHEWVMESIISLPGFLARYFPFCAQHQILQAIQRQLETH
FT                   AFCFLQRWLPSESLAAGWTCPEALELHKFFRLLEVHQGKVKDECFQLTWSTLTGWRRVI
FT                   SSIRHAAVHRIPHDRKTFLKMVRAAIKFSKCIAGFESSKRLCRIQKFVKTSVSEFDQLR
FT                   AQLKHNARLQISLGEANPDHLARRLVLLPEAVRRVLQSVEDDFVSKVKQFLHAEFKST"
FT   CDS_pept        complement(209524..209844)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234786" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823363"
FT                   /orf_name="Pc24g01040"
FT                   /product="Pc24g01040 protein"
FT                   /protein_id="CAP87012.1"
FT                   /db_xref="UniParc:UPI00018333F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWR2"
FT                   /transl_table=1
FT                   /translation="MTGSAPPVSLNRHPLYSKGLENDFYCKCFESFHQLVSTTMDATQS
FT                   LALQYHFNPANSPSGDPRLIRAIVSLRVALDKSRAEETSAEQEWKQQWKVSPVRQSSLR
FT                   WL"
FT   CDS_pept        211296..211667
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976567"
FT                   /orf_name="Pc24g01050"
FT                   /product="Pc24g01050 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP87013.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00018333F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWR3"
FT                   /transl_table=1
FT                   /translation="FRYSTVLIKRRDAGRQGASFSKLQVALHENIVGLVEAFYYSISTH
FT                   FIYNYHGFAVNLTQVGLTPTLELSEKDLASICRSVLRGLEYIHEQLHIVHGGVNYDNII
FT                   LYSDRAIKIGKLYTTLSFIDRTLSPLANIGDSMINDSPTSIDLDRENVSSLLLQLGDSH
FT                   RYMKNPEKIPRKAAYRLSKYATHFIEHVGSSSYSYIFKVRLLFNII"
FT   CDS_pept        211838..212350
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200313" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127657"
FT                   /orf_name="Pc24g01060"
FT                   /product="Pc24g01060 protein"
FT                   /protein_id="CAP87014.1"
FT                   /db_xref="UniParc:UPI00018333F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWR4"
FT                   /transl_table=1
FT                   /translation="MSDTPFHNNXLLALRAGSSPSILEYKPNTVIXTRPNTLPLLXESE
FT                   WEKDKVYNEDPLSYIYYFIERRVTLNNKAIVKDTKEDIVLAPSVYXNLVLEEKLXKVLR
FT                   EKVLYKKGLGWITRRMLLRLMTDPSAI"
FT   CDS_pept        complement(215489..217148)
FT                   /pseudo
FT                   /gene_family="HOG000200306" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(221252..221339,221493..221737)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943647"
FT                   /orf_name="Pc24g01080"
FT                   /product="Putative uncharacterized protein Pc24g01080 "
FT                   /protein_id="CAP87016.1"
FT                   /db_xref="UniParc:UPI00018333F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWR5"
FT                   /transl_table=1
FT                   /translation="MGKLAQDVNVPISGPDRKSIEKNQNFSTSTQISQADRPVCSDLIS
FT                   NSNAVRQPEKREKLRARRISMLARKSQKIFLGDRIGIRRPEGNFVFLREARNSERENHQ
FT                   GKANVR"
FT   CDS_pept        complement(222032..222214)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(222483..222753,222811..223118)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670600"
FT                   /orf_name="Pc24g01100"
FT                   /product="Putative uncharacterized protein Pc24g01100 "
FT                   /protein_id="CAP87018.1"
FT                   /db_xref="UniParc:UPI00018333F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWG0"
FT                   /transl_table=1
FT                   /translation="MPEIRIVQIVRVRGCNTTLIAVVNDTIQALKLNTESAIIQVPRIA
FT                   HVFQLSLNDLLGKIKASPKNDNAELEWKEDRVRALQARDCRHTKQGSQSCYLHQRKPST
FT                   QALNAAALSTIFNPTSQSSCLSRMYERDGIQHILCFGGDSKQLLTHSARSTVSLILHYT
FT                   PRIGDKSIICYSSYSPSSNTQPSFVGLKT"
FT   CDS_pept        complement(223832..224182)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823364"
FT                   /orf_name="Pc24g01110"
FT                   /product="Putative uncharacterized protein Pc24g01110 "
FT                   /protein_id="CAP87019.1"
FT                   /db_xref="UniParc:UPI00018333F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWG1"
FT                   /transl_table=1
FT                   /translation="MQQAAYPSCWPPLENPVTKAPFIYSKTEELVWKWEQSKLCGQSIN
FT                   IRLPSTILPQGRPPNKPDSREEFISIENGVVQVFPQAQLTNLEHHDYQIGILETAQSGN
FT                   LKIILANAKKRK"
FT   CDS_pept        224321..224656
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(225999..226152,226205..226524)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976568"
FT                   /orf_name="Pc24g01130"
FT                   /product="Putative uncharacterized protein Pc16g14860 "
FT                   /protein_id="CAP87021.1"
FT                   /db_xref="UniParc:UPI0001831D24"
FT                   /db_xref="UniProtKB/TrEMBL:B6HA32"
FT                   /transl_table=1
FT                   /translation="MILASAYARGSLGGTLEIIDIDGQCAIWSYDNHGCTGSSEFFSQL
FT                   YGDDCSNLRVKTGTPQGYPVSGVGACGTKKNSSVAWIEVEHTGLVSFFNYQGDKSACTL
FT                   DNGLKHGSRCIASDTVPSTKASSALTTPRSSSSVSESSSTTSQTAPSSDCSAD"
FT   CDS_pept        join(complement(228254..228285),complement(228064..228203),
FT                   complement(227822..227977),complement(227560..227763),
FT                   complement(227275..227442),complement(227148..227200),
FT                   complement(226836..227060))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943648"
FT                   /orf_name="Pc24g01140"
FT                   /product="Putative uncharacterized protein Pc24g01140 "
FT                   /protein_id="CAP87022.1"
FT                   /db_xref="UniParc:UPI00018333F6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWG3"
FT                   /transl_table=1
FT                   /translation="MAEIVDRKRNSNHYVDPGTFKSISKGCLSPRKSSLGPGAISNSRN
FT                   ARSTPGIFTFRSFNSLPSEIGESLTKHLRRTCAQFCVIGSPRRPNHRPRNQQVVNRNAA
FT                   LIPRGGCFFAPRNVSEASGSKRTPRVKRYVPSTNGTIYRGVTCFLMVMMKMCMFVSGYR
FT                   YGYLVAGYTDRDRKSLRWDDACLSTTLCAGARSPIPVQGVAYNPIPTCKSQARFLHRHS
FT                   YLLPTLNRAIRYNRSKLSEFGTGFWQILKTIEKLKKCHSICESNPWAEEEKNKVTSNFK
FT                   ELFQLPWPNPPKRGSTYLPFVGLDKVSNTIISMEVFKRSAQIGK"
FT   CDS_pept        join(complement(229223..229659),complement(228873..229145),
FT                   complement(228610..228820))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976569"
FT                   /orf_name="Pc24g01150"
FT                   /product="Putative uncharacterized protein Pc24g01150 "
FT                   /protein_id="CAP87023.1"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00018333F7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWG4"
FT                   /transl_table=1
FT                   /translation="MLPWNPFLVCEIEVSRNGGPGSCCGMTKKGHPCKNSIKVEDIKIG
FT                   HQRLTTLAREPFDLSSLQPKLCDVARDFLCARWHRQRQADQVGQQWYEAAVTRREYHMA
FT                   PEWLLHQSLYIPASVRHRQPPGAALHQTTLTRHLAGSDKTRRVPWRVSPAQPAILASVA
FT                   NIWAGFQELTLQSLTPSEEVDSIHCVFCLTEDENHANESVILRCGQCQALSHLACAEEW
FT                   LERRDTGSGTSCCVCRNDGALDALIRPLPIPSSDAETHSVHTASESSPASGPRRSARLV
FT                   GPHIPGDPSTSAALRRSARLSTLLG"
FT   CDS_pept        join(230370..230372,230425..232112)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943649"
FT                   /orf_name="Pc24g01160"
FT                   /product="Pc24g01160 protein"
FT                   /protein_id="CAP87024.1"
FT                   /db_xref="UniParc:UPI00018333F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWF9"
FT                   /transl_table=1
FT                   /translation="MEVSLSKAAYTIIGGLTGCVVASRLKQPNPFIPQHPCLGSRSDPS
FT                   TYPNVQTFLGTSPFLARTLTGHIRPSHNPNPRTEYTRSTPGVGRRNVINLSDXRRGHAA
FT                   DYINWVIIVGHERWNYNMFLLYLEGEPIGEVWSVIGVQHSPNGCSGDRCGCQ"
FT   CDS_pept        join(complement(232790..232909),complement(232330..232743))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943650"
FT                   /orf_name="Pc24g01170"
FT                   /product="Pc24g01170 protein"
FT                   /protein_id="CAP87025.1"
FT                   /db_xref="UniParc:UPI00018333F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWF4"
FT                   /transl_table=1
FT                   /translation="MDIPNSTPDREKEGEQQTCALPIASEKDNSQEASDHVPPLLSPSQ
FT                   QGAEARHTLATEPFQPILKVLADLERDDPKSAFPAARLVGLYRRLWESCVSKHIDGQNL
FT                   EQSNQILKEASRHLTKERDGLQLHHDKQLSRLRFFEQALESSRVRLTCVLDDWNHPSRF
FT                   NLHVPGFLDNAREG"
FT   CDS_pept        join(complement(234531..235087),complement(234475..234499))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943651"
FT                   /orf_name="Pc24g01180"
FT                   /product="Putative uncharacterized protein Pc24g01180 "
FT                   /protein_id="CAP87026.1"
FT                   /db_xref="UniParc:UPI00018333FA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWF5"
FT                   /transl_table=1
FT                   /translation="MPLNTSAAMYRMRLSLFPLLIISLTVTWLALASLRSATVHFAVLL
FT                   RDRARSDLVTPSDSILDITFQSLMDNVVDGMVIAALVSALFSIFGFVLVVYPKWLQEKC
FT                   TARFYYGCIQIVVSMIVLSLGAWIASRVHVFQASFELFDRDQIPYYKIMYYGSIGQAAS
FT                   GIFTGHFVVCALCRTRLTWSLAEGGSNGLL"
FT   mat_peptide     join(complement(234531..234979),complement(234478..234499))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWF5 "
FT   sig_peptide     complement(234980..235087)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWF5 "
FT   CDS_pept        join(235854..236342,236452..236495,236562..236660,
FT                   236817..236868)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823365"
FT                   /orf_name="Pc24g01190"
FT                   /product="Pc24g01190 protein"
FT                   /protein_id="CAP87027.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00018333FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWF6"
FT                   /transl_table=1
FT                   /translation="MGIKPTPGCSDIGPEFDRLKADRAIYLDAKLVAFVEKAHSSLQSR
FT                   GRFKQRDCYKRSLLHYAAMGNCTNLLLYLLQSKPDVDSRDQWGRTALSWAAQYGSLAVA
FT                   NILLEQGANLNASDYEGGTPLTWLIHAGNPEMVDIAATEAYLRERGAKEVKLRGIKWAW
FT                   MNVITGAAGKHCGERDKKQASLFEHNEYADMYFISKNPSLAWRSRAVDMAKGLSDVWEQ
FT                   DKTTH"
FT   CDS_pept        237879..239633
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234740" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127658"
FT                   /orf_name="Pc24g01200"
FT                   /product="Pc24g01200 protein"
FT                   /function="ATP binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="lipopolysaccharide biosynthetic
FT                   process"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP87028.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009103"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="InterPro:IPR010440"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI00018333FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWF7"
FT                   /transl_table=1
FT                   /translation="MSGNSPPDYKALFLKAEEERKRAEEERKRAEERERQAEERQRQAE
FT                   ERERQQRERNRPTIFPEFIRLCHDLLWRPLRAQTPSRSTTGKIPAPIGKHCPLRLRLWT
FT                   DCEDKQREIYESVCRYLQPTEGDARELFTSLVALEDHGRRFARRPINSEQDLETYERLA
FT                   VEDHVHDIAAELCKIPEAREEFGLGNGIWFDNHPNALDDDNEVDASQPSTTKPSKPDQF
FT                   CIYQRDGNRRTLLTTVEYKPPHKLSAANLRLGLRPMDFWREVVQPDRVPTEEPEKSRYH
FT                   AERLVGSAIVQEFHVMIQEGLEYSYLTNGLMDVQLWVPYDDPTTLYYHLGEPGIYGMAG
FT                   VAGAGIPRTRIERTLCLCLMSFRAPLRDQAWRNAAKDGLPKWRSILDSDRAQIVLVELP
FT                   RNLDVDGANSESANPEQSTSEYLTSSSPITSGPRVTTRAATTSKLWGVVSREAEVYRVL
FT                   QRAQGSAVPVFLGAINLAQTYFLHGAGRIRHMLLMGWGGESVGHTTPDKSTQRAISRSV
FT                   KEIRRFGVVHQDLRPENILWNAELQRALIIDFHLCTLDRRPLDRRPGTLKRLRYGSAEH
FT                   HSKRVRVV"
FT   CDS_pept        complement(239855..240217)
FT                   /pseudo
FT                   /gene_family="HOG000048617" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(242560..242621),complement(242135..242363),
FT                   complement(241990..242076),complement(241892..241957))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976570"
FT                   /orf_name="Pc24g01220"
FT                   /product="Putative uncharacterized protein Pc24g01220 "
FT                   /protein_id="CAP87030.1"
FT                   /db_xref="UniParc:UPI00018333FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWF8"
FT                   /transl_table=1
FT                   /translation="MSPQIVVAKRSHGSQQTSIKRIQHGPASQTVSVKYVVLSKSTLPT
FT                   GQPIKETRLRLAGLNVYAKMSDVSPPQPTELIYCTALRVFPRQKREYPRRRYNRGQSTT
FT                   INERKDRSSLSSLHPSFLPTEHLMNDSEPSTSHQSGPEDTAPH"
FT   CDS_pept        complement(243894..246122)
FT                   /pseudo
FT                   /gene_family="HOG000213043" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(249073..249154,249217..249824)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076627" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670601"
FT                   /orf_name="Pc24g01240"
FT                   /product="Putative uncharacterized protein Pc24g01240 "
FT                   /protein_id="CAP87032.1"
FT                   /db_xref="UniParc:UPI00018333FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWR6"
FT                   /transl_table=1
FT                   /translation="MDHNLSQVPKKSNTPDTEGHNGRTRQTGNESAGNFRRVDGLFFHE
FT                   NRGPTSQVLLQTVDQSTGSVATEVVTSVATSLASAGASTLSPSVIKTESQDLPPLDGKK
FT                   RAAEPSTLPRKRRRLSHSTSQIPGRSQLVHQKRLPSNIKISRKMVNDTIQYLQTLSDRI
FT                   LISDTISPREWSTMHLATQLLQSRYEEIIVRKEMETDAVSDFDSPPTQPEEKCRKCAAA
FT                   DEERLYD"
FT   CDS_pept        join(251936..251949,252138..252186,252861..252942,
FT                   253095..253319,253596..254169,254211..254565)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976571"
FT                   /orf_name="Pc24g01250"
FT                   /product="Pc24g01250 protein"
FT                   /protein_id="CAP87033.1"
FT                   /db_xref="UniParc:UPI000183347C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWR7"
FT                   /transl_table=1
FT                   /translation="MDYPVIHLYYDQLSAILVVMGMSLRGALLTQDLGCGELGNAAVSC
FT                   RELVLFTQHLPARHIDDADLSCEAPFYTRGARGSERAQVLHHWARGSDSRGHGSSEVLG
FT                   FAAPPLRGLLLTQTYPARHRPILRDTVVDAKPILQDTVVDAEPILQDTVDNAEPILRDT
FT                   VDNAEPILQDTVDNAEPILQDTVDIAEPILRDTVDNAEPILRDTVVDAEPILQDTVDNA
FT                   EPILRDTVVDAEPILQDTVDNAEPILQDTVDNAEPILRGALLTQGLGCEELGNAAVSCR
FT                   ELGNAAVSCRELVNAAVSCGSHLSSQRPPAEFTCTPLRGILMTQTYPARIVVDADLSCE
FT                   APFYTRGARGSEGAQVLHHWARGSDSRGHGDSQARRQERDTMTHRSVRTEVLIFFGLGI
FT                   RLLLYFFGYVSTKEPVAQMVARITVSLISVEAI"
FT   CDS_pept        join(complement(258438..258739),complement(258142..258376),
FT                   complement(257735..257947),complement(257575..257630),
FT                   complement(257477..257506),complement(256850..257222))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943652"
FT                   /orf_name="Pc24g01260"
FT                   /product="Putative uncharacterized protein Pc24g01260 "
FT                   /protein_id="CAP87034.1"
FT                   /db_xref="UniParc:UPI000183347D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWR8"
FT                   /transl_table=1
FT                   /translation="MPNRVTKASTLWPGKYSAMLAKTLEDEARAEKSAHHEVAIECQSE
FT                   SSGSTQTECEGALPGKDDQFGSRHGSKPLRKPDRETELVDSSPCGLYQPTNLANNRSTG
FT                   QVKPGPFKSLSKREEQMERCRKSESKVTKRLIKKGLARDIEILKSEVEDLKQIVIAQQP
FT                   SLSERRKRKRVSFQDDTHENFSCQTPVRLIFQLLSHPRDPSSSRFFQDGTSKVPKLAPA
FT                   TRNIPCTGAKAAGRPSFDSQEFSAPRPILVGIWQEALRSDLLGYLSLVPGEDRYHLQLL
FT                   VEHRDKIRCSSCRQAATTIQKWQRLVSGIRHAAVHRLLQDRESLLRMTRVAIGFSLCIG
FT                   GLSSVEKLRRLLKFLEDRLPNSERRRTQSRAPSFFAKSAPRRSERPISVAAETHPEAGT
FT                   LGF"
FT   CDS_pept        join(260514..260640,260926..260984,261041..261053,
FT                   261500..261685,261722..261800,261893..261935,2
FT                   61971..262210)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976572"
FT                   /orf_name="Pc24g01270"
FT                   /product="Putative uncharacterized protein Pc24g01270 "
FT                   /protein_id="CAP87035.1"
FT                   /db_xref="UniParc:UPI000183347E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWR9"
FT                   /transl_table=1
FT                   /translation="MCVDVSVDKSVDVSVDKSVDERGNERGGEWSGGEGDGPTLRLYHT
FT                   LKSHSDQTQQPTALTSLYYVTFEVRASIGDCKSLKPTLYVGWLYPRTIARVKVDSQQRK
FT                   PSYRGYSLAQDYPIGSCIWESPQYSPAVSHVSISTTAPKPPIVAFWGVVPGICLNSDML
FT                   NVIQGASMLGVQKPTSPWQELLARDRLENDINRQRHAAGLTDLQFQWHPRHMRLSGYFL
FT                   GFDREMGAWDPNIPNTCSKETFLTPT"
FT   CDS_pept        join(complement(263924..264014),complement(263775..263892),
FT                   complement(263682..263728),complement(263512..263533),
FT                   complement(263064..263482),complement(262917..262951))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823366"
FT                   /orf_name="Pc24g01280"
FT                   /product="Putative uncharacterized protein Pc24g01280 "
FT                   /protein_id="CAP87036.1"
FT                   /db_xref="UniParc:UPI000183347F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWS0"
FT                   /transl_table=1
FT                   /translation="MSDVPPQPTELVYWTAPRVSPRQKREYHVAVLLILKSRRSRTEDS
FT                   RPQYTRARTIALCRPFIPRFCQQNIEPLTSHQSGPENTAPQRPFFLVSYIQLFLQVFVP
FT                   QIMNAITDLHAIVYRSSPSLPVKHPCAETYHRTGLRRVLHRVFCLRSHRLHTMTGGVYE
FT                   PLSDYIARSYPITTLQFIITGGLITRLWLSEVARCTQRGFFEATAADCDDLDTTSCQHG
FT                   MNGDHIDEDNLVQALLTRIVQ"
FT   CDS_pept        join(265231..265347,265394..>265672)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670602"
FT                   /orf_name="Pc24g01290"
FT                   /product="Putative uncharacterized protein Pc24g01290 "
FT                   /protein_id="CAP87037.1"
FT                   /db_xref="UniParc:UPI0001833480"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWS1"
FT                   /transl_table=1
FT                   /translation="MESPNSLPGQEKEEQQPSELPILSDKDDNVEPSDHVLPLTSTSQH
FT                   EEVTRHTLATEPFQPILKVLADLERDDPKFAFPAARLVGFYRRLWESCVSKHIDVQKID
FT                   QSNEILKEAGTHLRKERDGLQLHHKKQV"
FT   gap             265674..265773
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(267405..267719),complement(267254..267338),
FT                   complement(266993..267063),complement(266545..266953),
FT                   complement(266398..266432))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670603"
FT                   /orf_name="Pc24g01300"
FT                   /product="Putative uncharacterized protein Pc24g01300 "
FT                   /protein_id="CAP87038.1"
FT                   /db_xref="UniParc:UPI0001833481"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWS2"
FT                   /transl_table=1
FT                   /translation="MYLRLTTQSQAGLVSEALDKFLPFERVLKYCIYRVQHGPASHTVP
FT                   VEDIVLSQSTVQAASRSKGQDLDWLVHLCGDVSLPQSTELVYSTASVRTPKAKARISAS
FT                   QNRGHSTTTHEHKDYVFAVSLSLVLAIRTSGQQQGVNIRLRNSPHRTSILPGKLFVQVF
FT                   VPQIMNAITDLHAIVHRSSPSPPVKHPCAESYHRIGLRRVLHRVFCPRSHRLHTMTSGV
FT                   YEPLAVRIAWFYPIMTVQFIITGGFITRLWLSEVARCTQRGFFEATAGDCDDLDTTSCQ
FT                   HGMNGDHIDEDNLVQALLTRIVQ"
FT   CDS_pept        join(complement(271306..271821),complement(268873..271238),
FT                   complement(268569..268800))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943653"
FT                   /orf_name="Pc24g01310"
FT                   /product="Pc24g01310 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP87039.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001833482"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWS3"
FT                   /transl_table=1
FT                   /translation="MVSYDDDTRRLHLAASNTSAPPDSLIAMDHISFPEGHHISLGPLQ
FT                   RPGYPLMRNPELPSESMYGRLKDRGQPIHVPTDSAQDPVPYQDFQQSTKGAPYEGSPGF
FT                   RAHMGYPLLNRANNAEHLSVSRSLPPVSDSTIYVTQMAKDTPHVGYSQGCYQREVLKAP
FT                   QRKAHRATQACDQCRARKAKCDEGRPCCSHCKVNNLGCVYKEIPLHKEEKTTQLVLDRL
FT                   SQIETRMEERANRIDERFAKWQDQMQEQVGFNLAEEVRHPHPTVQEHPALPPSPVIRQD
FT                   SPLKAAMPQTQDVNGSKFGQQLGAVDPRYRQKEAEGELSIPVEHTTAAHKLLMWPSIKR
FT                   LIHPERYDEDYVTRLEEERGLISIYGQGEISYTADNSQLPMDCDSKGARPGVNGAGEDT
FT                   NVDIDEFGNLDLDATTARRYYDSYFKHMFRLHPFLMEGELRIMVDSFIRRYCRADNSPP
FT                   SSVSSYARPARDGPPPAKKRQSNEDLSVRGEFMETVSNPLRPRVGKNIDAALILLCLAI
FT                   GAICEAPAPLPGPITDNKIDYLNQHIPAPLAPFNSPPPAITTYVTDANGVLPPANSDSA
FT                   AVQTSLSDPLYSVPAQPVGQAFPNSSSNNGVEGLSRRDVTNTRDKQGNTRNYQAIPGLT
FT                   LYGYATAILGHLQGGNELEHVQCGLLAGLYAGQLAHPFQSHSWISQASRACQILVRTKR
FT                   YEQLNEGATKDLYDFAYWTCLQLESDLLAELDIPASGISRSEGRIPIPKGKWTIFLPNN
FT                   LTAPETMMMLFYSAQIHLRKILNRVHTDLYKVEKQDQTQWSFTVQEALSLNLDRWRESL
FT                   PDSMQWDESDPPANEINAARMRAKYYGARYIIHRPLLYHALHYGHTGARVSPFSQTLME
FT                   SPTLQQLSPSILHSAARAPSMAYMSSDMDSTPAAISTHWQPPEVRLHELPKKLKAACYI
FT                   CISSAIKSTEAFDGIGGHRLVVTNIFGTAHAQFGNMLVLSATFMSCLKELVEPEQLKRL
FT                   LVRTISFLIQSENISPTLRADARILTEIYEKIFNEPPDLQQATRMSFP"
FT   CDS_pept        join(272859..273157,273324..273641,273693..273820,
FT                   273872..274027,274107..274644,274726..276070)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976573"
FT                   /orf_name="Pc24g01320"
FT                   /product="Pc24g01320 protein"
FT                   /function="binding"
FT                   /protein_id="CAP87040.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0001833483"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWS4"
FT                   /transl_table=1
FT                   /translation="MPPSDPIPPPDSIPPSDPIPQSDSIPPPDSIPPFDPIPPSDPIPP
FT                   SDSIPPSDSIPPSDPIPPSDSIPPSDSIPPSDSIPPSDSIPPSDSIPPFKPLPLEENAD
FT                   NYNNTPISGGEHSNGGERKRKKKEKKPIGKILEDTANKIRASGPELTIWLESDSGKHRK
FT                   LKRESALQKSFEKNVRNDTSDLKPLVAAKKGEWTQNRNETLLCFSANDLDGFTFEEIIF
FT                   IIEFVAHNQNSLGCEALEVEAIKLISGPWRSSTPPLVGSEERLSVHNLPENGNRRSSSP
FT                   SADPDPNGGFDISLEESSSKYQFATKKRKVASSLSASDGLINDNPHESALTAIPSVSPY
FT                   PTCRPVMTTPASLELLGLFAALGGVKVPSLIFERFLSPQLRWSEDGDPVPAPLPLNSDT
FT                   PGGELFNSPESLTESLEQLRSGSWIYMDHFDKSSYQRFSVSESVREYSAQLLKVKGLHY
FT                   WTLLALQFVCHVFPRDPTLEASFQRHGKILSPVIDHLIEQSKAFELPKSTRITIAEILV
FT                   AKARVGSSQYNRQSLDEATELLGDEIPDYIRASIVLRRSILLRLEGAYHSSEQEILDYQ
FT                   NGAASYEVANPRLRALSRLLLISHLENLIQLEAYEKAEKEIRELNKWEPSEGALWSPME
FT                   LSVNFKKWSTVSKIYQSRGRLESAKSHLVRCYSFLRPERLRNDTELLPDPDPNRFQIIC
FT                   RLSDLLCADGYWVDARSNIEYEINSISSDFPGKFAKALTRLKVSLLDVDIAESKYDQAS
FT                   SGIEWLKQQFVEISPPDISYQWLHVRSIIASARLLHSQRRFKEAISEWDLVLSLVRKYS
FT                   DSFEPEGFFYGLAQLSIALARLQNARSTTDASCISSPSWHADTRQFFDKACAVLAREDV
FT                   NYWVPTLPKTVIPDLLLNIQSTEASWWTADDFLKLQQKYPYLPVFDKRQQRLSSRM"
FT   CDS_pept        276774..277676
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(280715..280852),complement(280383..280662),
FT                   complement(280041..280138),complement(279614..279760),
FT                   complement(278950..279405),complement(278838..278900),
FT                   complement(278616..278780))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943654"
FT                   /orf_name="Pc24g01340"
FT                   /product="Pc24g01340 protein"
FT                   /function="4-alpha-hydroxytetrahydrobiopterin dehydratase
FT                   activity"
FT                   /biological_process="tetrahydrobiopterin biosynthetic
FT                   process"
FT                   /protein_id="CAP87042.1"
FT                   /db_xref="GO:0006729"
FT                   /db_xref="GO:0008124"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="UniParc:UPI0001833484"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWS5"
FT                   /transl_table=1
FT                   /translation="MDHPTSPSPIDRPAKRQCRVSQAPEDEPKLENQPQQVTNGSTIEP
FT                   KIPVRTRGTLTAEFMKVVNLNDSLATPVLKLLDLYFCLWQCYVVKSAQKIRLEEEQRQL
FT                   QASNELLASDSDILLQLCNEEASVLWERKRAVQALFQPKFGVRCHILMAKTFPTQVRRA
FT                   LVGGKLDDSVRSHCTFDDGSSLNGRNASTVFKPRERVKQMDSTPLLGGSESPGEGVSTF
FT                   SALSSVQDSTYGPVDPVGGLKLGLLSYGMVENGAEWNADAGASRVEDSGRDHHKGYELS
FT                   GGHVIQLGNLLVSFLYGVFTPLNIKVCRKSNSLPQQSLTMMASPVNIKVSKGEIFQSVK
FT                   AEIEALLSESGWELLDNDTIRKSFHFKTHTKVLDFINIVGVRCKSRNHHPLVVYDISSV
FT                   TFNWTTHSPPGLSSKDIFMAKYCEEQAKEIGTVSPENTPSCQDSRISKA"
FT   CDS_pept        join(complement(282963..282965),complement(281306..282910))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943655"
FT                   /orf_name="Pc24g01350"
FT                   /product="Pc24g01350 protein"
FT                   /protein_id="CAP87043.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001833485"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWS6"
FT                   /transl_table=1
FT                   /translation="MPNIRDLPNELLLWIVSHLDGSALFALAKSCKDLDFRLQPSTWKY
FT                   NIRFQNSNLLHLAVKYDNVGLADALLQHNANINAFYRGKTPLMRALKYSSAAVRELLLS
FT                   HPDLDINIQNQARDTALSYAIHYGSSSIVKSVLEHRAASVDIKHKHGRTALHLAVFAGR
FT                   IGFVQLLLLSGSDPNLEDDSGQSAWSWACRINRPVMKIMFINGPDCEVYLGARNAQDSE
FT                   LPLHEAVLHGSIDAVKWRLRQKGLNLDIQDRKGYTPLHLAVQSRRLEVVNLILGHPLAN
FT                   VNCKDKDGNTPLWLSTYSSCDEITERLLAEKDIDVNFVGGRGRLEAPSTSLHHAATRLD
FT                   TILLRRLLAVPGIALNLCVAGHSPISVAAYHGHVKTVACLLSMEGVEINGRGLIDPPIC
FT                   RAVSHGHLDVVRLLVQQGARLNVNESTVATHDTALCIAARGGDLEMVRELLRHDRIDVN
FT                   LRNQWFEDPLMLAVRGGHFSIVDALVANPRLTHFSLRRSLDLAKDYCIQKAIRSRIYDD
FT                   NTTKKLLKRSPRRIFDRL"
FT   CDS_pept        join(283704..283753,283812..284310,284415..284458,
FT                   284511..284715)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670604"
FT                   /orf_name="Pc24g01360"
FT                   /product="Putative uncharacterized protein Pc24g01360 "
FT                   /protein_id="CAP87044.1"
FT                   /db_xref="UniParc:UPI0001833486"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWS7"
FT                   /transl_table=1
FT                   /translation="MSWNPFAVCGIPHGGPVKKIGHQKLTTLAREPFDLSTLLSRLCDI
FT                   AKGFLCARWHRQRQAEQVGQQWYEAAVRNQARVPENSRAAAPSIAHPGQRQISSAPRRH
FT                   PTESPDTDRSSHGLREDGPMLPTNPELVQPLNLYVNSTMLRTNSVPWSVSPARPAIPLA
FT                   GFQNLTLQSLTPSEEVDSITFEKRHTGYGTSCCVCRNEGALDALVRPFPTPLSDAETHS
FT                   VHTAGKPSPTGGPRRSTRLSGRHLPPDPSTSAPLRRSARRGLH"
FT   gap             285547..285646
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(287880..>288290),
FT                   complement(287070..287823),complement(286493..287019))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943656"
FT                   /orf_name="Pc24g01370"
FT                   /product="Pc24g01370 protein"
FT                   /function="nucleic acid binding"
FT                   /function="protein dimerization activity"
FT                   /protein_id="CAP87045.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR008906"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001833487"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWS8"
FT                   /transl_table=1
FT                   /translation="TAYYFDKEWSYREVLLGFELICRSETGNDPCDQILGLIQEKGLLH
FT                   RIFSVTVDYRVDENLMLSLREKLTSSGGISSWQCFVGVPGTVQAIQLCLRRYIENITSS
FT                   PEGERVENVREISHANGWTDPSDSDEISHVLGKIRSFAKFVNETPRKRDEFLCLQPAST
FT                   RVLPLDDAKSRWNSVFLMLKRAGRLRRYIDQYCQESVNLQYKLTSTDWRKVDYLVQLIM
FT                   PFIQFTTALLASREATVHKVCFVFKILMEHLDESTRILRRKSALWKRKLSEASLIMKME
FT                   LGEVYEKTFQNFGVMYGPGTFVAPQYKVSAFDEATSSQGLGQPERYIEYLRIFHLQYRP
FT                   QMPTSLSCVNGLSCSPQLLGLDRLLHPLAGLAGSSRCGQDDVDQYLSEGVLNISPCAYW
FT                   KDHQREWPVLTRLARDLLSIPATGAGTERLLTVAQNICRTRGGSLDESTMRDLVMYAYS
FT                   EGSESGKQSISRVERDMASDEEWEEFEVEAERPEPISDDEWDSAEMSVDERSGDDENSQ
FT                   AEAVILEIPPTGDLEQDVTDKGEGGSFLPPPVTRLINSLRRRFSGR"
FT   gap             288293..288392
FT                   /estimated_length="unknown"
FT   CDS_pept        join(289684..289926,289976..290092)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076814" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943657"
FT                   /orf_name="Pc24g01380"
FT                   /product="Putative uncharacterized protein Pc24g01380 "
FT                   /protein_id="CAP87046.1"
FT                   /db_xref="UniParc:UPI0001833488"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWS9"
FT                   /transl_table=1
FT                   /translation="MAMEEENELSEIISSYSEPSESEEQESISEHSEEEDISETSEDRA
FT                   FVVSDGDQSPYSNRSSESSNYSQHCHHRHDDDFSNPVGDKIPISTIAKRVIHQNDSPVV
FT                   QYLVLWRSWEQERPQ"
FT   CDS_pept        join(290820..290865,291070..291103,291165..292044)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076815" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823367"
FT                   /orf_name="Pc24g01390"
FT                   /product="Putative uncharacterized protein Pc24g01390 "
FT                   /protein_id="CAP87047.1"
FT                   /db_xref="UniParc:UPI0001833489"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWT0"
FT                   /transl_table=1
FT                   /translation="MGKLLCTCSLRGVIPSTPTSVPVALAAEHISRVGLSSKNPVTKAP
FT                   FIYSKTEELVWKWEQSKLCGQSINIRLPSTMLPQGRLPNKADSREEFISIENGVVQVFP
FT                   QAQLTNLEHHDYQIGILETAQSGNLKIILANTKKRKQAKSLRASLFHFQHCVLEKVPPY
FT                   FSSWSTEFWVSDSVVIDSKSIEEAELILKALRPERLDETGYVCVGLPVTIFGPLFNTLI
FT                   SKWNASAASFEHSNGFIWIYSAVDPANFKITTGESDSSTNHSVYSLLERMSGKYWLVRA
FT                   KLTFRLETSSREKAAILAELLEVSHVQVTSSHKPNTHS"
FT   sig_peptide     join(290820..290865,291070..291101)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWT0 "
FT   mat_peptide     join(291102..291103,291165..292041)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWT0 "
FT   CDS_pept        join(complement(293732..293816),complement(293643..293692),
FT                   complement(293313..293414),complement(292915..292988),
FT                   complement(292725..292820),complement(292626..292659))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127659"
FT                   /orf_name="Pc24g01400"
FT                   /product="Putative uncharacterized protein Pc24g01400 "
FT                   /protein_id="CAP87048.1"
FT                   /db_xref="UniParc:UPI000183348A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWT1"
FT                   /transl_table=1
FT                   /translation="MAWESDAAKMTLVSNDQKPHFMTWDGVAVAIRRMPTARRASRKNH
FT                   VVLALRFLRLPTSTICLSTILFPIRAFYRVGPFEWFPGTDSPICIEKPLTVGLGLAHWA
FT                   LPIGVGVSHLILVTGMPGTPRPATARKARNSMNYSNKPPECK"
FT   CDS_pept        join(293921..294445,294526..295255,295311..295361,
FT                   295509..295727,295789..296072)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943658"
FT                   /orf_name="Pc24g01410"
FT                   /product="Pc24g01410 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP87049.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI0001833504"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWT2"
FT                   /transl_table=1
FT                   /translation="MSRPVSKFAEWLARASIQDTFGLCGLLALVCWICCSLGRRFRHLP
FT                   LRLQQVSWRSFLKAPTPGVLQWLDIPTYLQVGVLTALVVANTIVISLHAQTWADVQRRA
FT                   GCLAVTHLVPLCSGFSFSLPAHVYYVERDTFYWAHRWLGRICVLHCLLHGSVLGANARN
FT                   TSLGAPLAIPLLAGCSLLSILPWTLAAILRRWPQLGLKVHHMLASIATGALFYHLIDRV
FT                   SSYRWVLLGGICAGCAWSAGTCLHTMWFHRSWRITSRRALARSFNQLLWLDIAVPMGWE
FT                   AQPGQYVQLWMPRSGVRSFLQLPSFYVASVDTVQNAPGPPTTRTLRIVTRPRPGVTGRI
FT                   AQAADHATYSTIHFPVCVLGPYGHPPDLGQYGTVVFVLEDIGLFRALPFIRHLVQESRS
FT                   RRNTVRRLEVLWQVRLKHFNHPHWVGDEISQILELDHTQPVDRIRYRNRNCTRLKYHFH
FT                   VINIGKEMARLMDGRGGTTAVSGMSALPFMHFGFARLTGISVRKQMDTRSKPSCKWWPD
FT                   GDPFINGTSDTIAAPTEPSNIEREFEPGRTPTAMPAAYAVPEQTTRLSGETLVDNRRSW
FT                   RSDDAVVGGNANHKKWVRQKITEGGV"
FT   sig_peptide     293921..294034
FT                   /db_xref="UniProtKB/TrEMBL:B6HWT2 "
FT   mat_peptide     join(294035..294445,294526..295255,295311..295361,
FT                   295509..295727,295789..296069)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWT2 "
FT   gap             297884..297983
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(299659..299796),complement(299248..299604))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976574"
FT                   /orf_name="Pc24g01420"
FT                   /product="Putative uncharacterized protein Pc24g01420 "
FT                   /protein_id="CAP87050.1"
FT                   /db_xref="UniParc:UPI0001833505"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWT3"
FT                   /transl_table=1
FT                   /translation="MDRPTSPSPIDRPAKRQCRVSHAPEDEPMLENHPQQASNGTTIEP
FT                   KVPVRTRGTLTAEAEFIKVVNLNDSLATTALKLLDLYFFLWECYVVKLAQKIRLEEQRQ
FT                   LQTSNDLLASDSDILLQLCNEQASVLWGRKRAVQALCNDVVSALEASDLRAYSVDEPEP
FT                   W"
FT   CDS_pept        join(302228..303012,303065..303389)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127660"
FT                   /orf_name="Pc24g01430"
FT                   /product="Putative uncharacterized protein Pc24g01430 "
FT                   /protein_id="CAP87051.1"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001833506"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWT4"
FT                   /transl_table=1
FT                   /translation="MSSVLPWNPFSVCGIPHGGPVSCCGTTKKGEPCKNSVKFQDTKIG
FT                   HERLTTLAREPFGLSTLQSKLCDIARVFLCARWHRQRQADQVGQQWYEAAIRNQARVPH
FT                   GSRVAALSIAHPGQRQMSSVSRSRPASGNTDRSPHGLRRDPPVPLSTNPEPVQPFNPFV
FT                   TSTMLRTNSVPWHVSPAQPAILTSVANVWAGVQSLTLKDLTLSDEFDDIHCVFCLAEDD
FT                   DLANESVILRCQCKALSHLACAEEWLEKRSAGFGTSCCVCRNEGPLDALVRPIRVQSSD
FT                   AETHHIHTASESSPERELATIRNSSPNDPGQSQPRQRSVGPQGGSVEQSVENGPRRSAR
FT                   LVGAHLPPGPSTSAPPRRSTRLNSTRRES"
FT   CDS_pept        join(305834..306228,306270..306747)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127661"
FT                   /orf_name="Pc24g01440"
FT                   /product="Putative uncharacterized protein Pc24g01440 "
FT                   /protein_id="CAP87052.1"
FT                   /db_xref="UniParc:UPI0001833507"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWT5"
FT                   /transl_table=1
FT                   /translation="MSHVGNPFNVTGFVFTEVPTNYSIGPTYNPLPSEIGSGSSLHPSV
FT                   PQSESWLTRSVSSTVTPSPRPSSSHREIRPRPAPTLPQPETKNEEKQRARRPTKKARRR
FT                   VYTPNQPARRNEMRSAWLVPPTFVTLANHNSATQDQRSRSRDYPPYNRESPPQASVEAL
FT                   QKALKTQVLHSLGALRKIAMDHHALNLVPEIIDGWVAEIEGVDARNIPIASSMATQMFV
FT                   PFERLTSILTECITATGPMRNFTIRDQAIEFLKYILTYAEKYYLVQGSQVYLDIGRWME
FT                   RLTNTNMRN"
FT   CDS_pept        join(complement(310261..310869),complement(309705..310115),
FT                   complement(309304..309645))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194425" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976575"
FT                   /orf_name="Pc24g01450"
FT                   /product="Pc24g01450 protein"
FT                   /protein_id="CAP87053.1"
FT                   /db_xref="UniParc:UPI0001833508"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWT6"
FT                   /transl_table=1
FT                   /translation="MMQSPTKNAAPVDIGLFRFIFRPNVEIPRFSMTYRWWEDEGINML
FT                   WAYDFKDTSQAIRFGLFHDEYSPRNSLLSRNAQFINEFLVAVSEPHEHCRLSELSHPQK
FT                   VEEIMLRSSIRQLPLITWKWFPTIPGCLSDPRAIAIEIERESHRHFQQISFEDIVRSAL
FT                   GYKAVSVEWFFQQHTSLYGILVNHLHMYPEELLLYLEVEKHNMPSRNTPGFAFIAAPIQ
FT                   QLFKNHSSSLSTIFKVLSVLAVRFQKAYRHSDQMNWFAPFETSLPLLEDCLSSSATDLA
FT                   TALTQTDKCLFERLSRETLIAEDAMVLEPLIHWQVLSNSVLECCSALSDLVPYLQTCTL
FT                   ELYEARNYYSLMAILDGLCKYIAVGSNTYRAFDASRAVVTPTSLIPPKVLPLIDPSHNF
FT                   VSYRKRYNQHPGIPFLQPHIREFKQCGKSAQQSLLRLFQAITSSQREDNDPVST"
FT   CDS_pept        join(complement(312823..312889),complement(312312..312655),
FT                   complement(312012..312164))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943659"
FT                   /orf_name="Pc24g01460"
FT                   /product="Pc24g01460 protein"
FT                   /function="binding"
FT                   /protein_id="CAP87054.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001833509"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWT7"
FT                   /transl_table=1
FT                   /translation="MAAGKGKRSSGANEVAPATSTSAPATETTPSMPDESAFAGLRQKI
FT                   EQRLKNQNQSTGKGKKDNTKPSAPAANASANKGKQSPAKPSRPQDSAQGKKRDRNGEVI
FT                   AREQNNGGMNKQEKPKGGKKSNEDETLRQEIMAMGGTEEDLDLLAGVDSESEVEGESGN
FT                   VDDDLRKQLSSMLEAAGHVVPEDLADDEVEEDEIEDDEEEVESEDDLENSEDNAESSGP
FT                   ESDIEEAPAPRIKDNESVVPKEYLKLVSCAPVQHRKAFANMIIKNVLPRSDWYNIPTPS
FT                   AAADTKHMNALPRHLMERVHELANKLLQEENEEYAAAQRASASSSHKFYSTIMASGTLS
FT                   DKISALTLNIQESPLHNTKALETLIGLGKKRSRAQAVEVLRSLKDMFAQGTLLPSDRRL
FT                   KSFTNQPGLVAAFQGAGGRWNEKDPLPGGLKKSELIVWAFENIVKDQFFEVIKILEIWC
FT                   NDEIEFSRTRAVSYVYELLKEKPEQETNLLRLLVNKLGDPGKKIASRASYLLLQLMQSH
FT                   PMMKPIIIKAVEEVLFRPGQSSHAKYYAIITLNQTILRVKEEKVAAQLLDIYFGLFLVL
FT                   LKPSHQGKPAPKGKYNKHGKGPKGKGNDDAAKGQAQDDEMREKLISGVLTGVNRAYPFT
FT                   DNDSEGMSKHLDTLFRITHSSNFNTSIQALMLIQQLTVSNQVSGDRFYRTLYESLLDPR
FT                   VATSSKQSLYLNLLYKSLKNDLNVRRVKAFVKRLVQVLGMHQPSFICGVFFMIRELEKT
FT                   FTGLSALADQPEENDDDDEEVFRDVPDEDDEELEPAPVVEAKKQNNVYDPRKRDPEHSN
FT                   ADRSCLWELLPFTSHFHPSVSLNATNLLEHNPMSGKPDLTLHTLTHFLDRFVYRTPKAN
FT                   ASSRGASIMQPLGGGEAADRLVEAGKKAQNQLPLNTEAFWKKKADDVAAEDVFFHEYFT
FT                   RVNKDKEKVRSKKSKDVDADDHSDEGLSGDEDEIWKALVDSRPELEADEDSDDDLDMSD
FT                   LESAFGSDEEDGEGADEDDSDGGVIFNDESDVPSDEEMAEFSEPEEAAPPAKTKKADKK
FT                   PSKEAEEDSDDFDMDVSDDDAFIDSDEDLPSDMELGGVDLEEPEKPDAAPESNRSKRRK
FT                   LKQLPTFASADDYAALLENEDLGM"
FT   CDS_pept        join(313833..313837,313994..314358,314392..314456)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943660"
FT                   /orf_name="Pc24g01470"
FT                   /product="Putative uncharacterized protein Pc24g01470 "
FT                   /protein_id="CAP87055.1"
FT                   /db_xref="UniParc:UPI000183350A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWT8"
FT                   /transl_table=1
FT                   /translation="MSSQASVGALQRALEAQVLQSLEVLREIAKEFRAFNLGLETINDW
FT                   VAEIKEVDETLIPVASSTAVQVLVPFEKLNFILAKCITASGPMRDFIVRDQALELLKYI
FT                   QTYAEEYHLFKNPRVHLDIDNAKAKIMRWANDVVLPGGRA"
FT   CDS_pept        join(complement(316378..316501),complement(316260..316298),
FT                   complement(316068..316175),complement(315559..315644))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127662"
FT                   /orf_name="Pc24g01480"
FT                   /product="Putative uncharacterized protein Pc24g01480 "
FT                   /protein_id="CAP87056.1"
FT                   /db_xref="UniParc:UPI000183350B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWT9"
FT                   /transl_table=1
FT                   /translation="MEGKSGEIGRLKRRPMLGSSGFSVVSSRNHCQMTGKYAKRVDSLN
FT                   LFELVPGTECKYSSTYRLLLPCVKSLLAVVCCEDLAGLTGVASAKGLSPKTFGRYRFGG
FT                   FDELALTGKDTERK"
FT   CDS_pept        join(317861..318491,318590..319131)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076809" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976576"
FT                   /orf_name="Pc24g01490"
FT                   /product="Pc24g01490 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP87057.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000183350C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWU0"
FT                   /transl_table=1
FT                   /translation="MPGIDAPLCILPTRIIDYLRAIANAKFFMHDCRSLHAHGQLCNQV
FT                   ASRPSYTCSLRICPALAGSMLRERGKHLLLLSPAQPLPQLDQHDGPSLPKVNPPTPAAT
FT                   PVHNLDSRVLPSWSDAGHSIWRHNKLDTTSLHCEYRVDHGVIQAYHCSPGSHYHAPMLL
FT                   RDRDMPSLCLSHETDRPLESTSIPCLPPLGPCHLRQLDSSQKSNVVEPSLPAVVEVGPI
FT                   PSRTGIASTWMLDQSQEQSQVLHDTTMCVNDHSLLDCHVSSRQHGHNLNVENQKFDLHE
FT                   RRFKCKIIGCRMGFKREDHLERHTRNHLKEKPYVCWVPCHRAFSRRDNLKVHCTKTHMR
FT                   HGGRNRYVATLDETSPDYDPEFRGQLSFDGRPLRFLARINSVPEAKPLQP"
FT   CDS_pept        join(complement(320121..320237),complement(319667..320062))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823368"
FT                   /orf_name="Pc24g01500"
FT                   /product="Putative uncharacterized protein Pc24g01500 "
FT                   /protein_id="CAP87058.1"
FT                   /db_xref="UniParc:UPI000183350D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWU1"
FT                   /transl_table=1
FT                   /translation="MNSSEQLPDEDSADHQPSEMPMESDEAYPQAVSDSEPPLQQEATL
FT                   KKPLTIEHFQPILETLADLDRDDPKLAFQAARAVGLYRRLWASRGPKHSESEIPDENDR
FT                   APNEATAKLSNGRDGFQLRPDEQLSRLVFLEQALEQTQERLISVLKDWNQSSRGDLAML
FT                   MDIERCS"
FT   CDS_pept        join(complement(323191..323715),complement(322457..323110),
FT                   complement(322274..322379),complement(321992..322126),
FT                   complement(321563..321936))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976577"
FT                   /orf_name="Pc24g01510"
FT                   /product="Pc24g01510 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP87059.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI000183350E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWU2"
FT                   /transl_table=1
FT                   /translation="MSRPVSEFAEWLARASIHDKFGICGLLALLCWMSYSLGRRFSHLP
FT                   LRLQQVSWRSFFQAPTPGLLQWLDIPSYLQGGVLTVLLIANIIVISLHARTWADVQKRA
FT                   GCLAVTHLVPLCSGFSFSLPAHVYYVERDTFYWAHRWLGRICVLHCLLHGSVLGANARN
FT                   TSHGARLAIPLLAGCSLVSILPWTLAAILRRWPQLGLKVHHMLALTATGALSYHLIDRV
FT                   SSYRWVLLGGICAGCAWSAGTCLHSMWFHRSWRITSRQALARSFNQLLWLDIAVPREWE
FT                   AQPGQYVQLWMPRLGVRSFLQLPAFYVASVDTAQNTPGAPTTRTLRIVARPRPGVTGRM
FT                   AQAADHATYSTIHFPVCVLGPYGHPPNLGQYGTVVFVLEDIGLFRALPFIRHLLVPQFF
FT                   SDALRCHVLTGINHPPWVGDDISQILELDHTQPVDRIRYHKRNCTRLKYHFHVINIGKE
FT                   MARLMDGRGGTTAVSVCASKSTRAAVRRIVHSRTSCDWRLIDLDLEPSCKWWADGDPFA
FT                   DGASDTIAAPTEPSSIEGEFEPGWTPTAMPAAYAVPEQTTRLSGETLVDNRLSWRSDDA
FT                   VVGGNANHKKWVRQKITEGGV"
FT   mat_peptide     join(complement(323191..323601),complement(322457..323110),
FT                   complement(322274..322379),complement(321992..322126),
FT                   complement(321566..321936))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWU2 "
FT   sig_peptide     complement(323602..323715)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWU2 "
FT   CDS_pept        join(325013..325051,325255..325380,325439..326215)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234603" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127663"
FT                   /orf_name="Pc24g01520"
FT                   /product="Pc24g01520 protein"
FT                   /function="DNA binding"
FT                   /function="transposase activity"
FT                   /biological_process="DNA integration"
FT                   /biological_process="transposition, DNA-mediated "
FT                   /protein_id="CAP87060.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004803"
FT                   /db_xref="GO:0006313"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="InterPro:IPR002492"
FT                   /db_xref="UniParc:UPI000183350F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWU3"
FT                   /transl_table=1
FT                   /translation="MGRNKTATLLEDNIFVPGSLVPRGVDEADREKLLHAISENPKITR
FT                   EDMLAEVSHKVKYDSIRRLLNAENMRKWRCSWRPYLTEAHALKRLQWAMKYRHFTPEDW
FT                   GRVYWSDECSVERGIGVKREWTFIRPRAQPREKQCQGLPYKGKQVKQMFWGAFCGDFRR
FT                   TGLIPLFSDSQSERGGINRFVIEDLYRRILPILIAHEDGIFQHDNAPSHTAIIVRQALD
FT                   EMVIEVMDWPPISPDLNPIENLWTLLKQKMYELRPELIHMRNNDETKELLVATAQEAWN
FT                   LLDWKHLETYLLRCRIVWKLLLKVRAGTHSIS"
FT   CDS_pept        join(327056..327154,327253..327318,327703..327819)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943661"
FT                   /orf_name="Pc24g01530"
FT                   /product="Pc24g01530 protein"
FT                   /protein_id="CAP87061.1"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="UniParc:UPI0001833510"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWU4"
FT                   /transl_table=1
FT                   /translation="MILNEDLLNDRPRMMKDAVGLIFVPKKGMGELQAPGRLHEHDKVT
FT                   ASVVTQCVKVRDIASKGGHASGGSFQPGDPRAKEAGRKGGHSSGQPEE"
FT   CDS_pept        join(complement(329354..329647),complement(328822..329286))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127664"
FT                   /orf_name="Pc24g01540"
FT                   /product="Putative uncharacterized protein Pc24g01540 "
FT                   /protein_id="CAP87062.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI0001833511"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWU5"
FT                   /transl_table=1
FT                   /translation="MNLKLVPEQISWGRAFANSREPAKMLKILGNSPRSLNTGIVDIEV
FT                   RPVPVAIGPKEKPVKDLGDMRSLPNELVDMIVNTLDLPSAIRLSYVNRVAHHFTQIRMN
FT                   WNILELKEAIIRENCVVCGEACVQLYLPTMERICHPCVHDNHAYWCLPVQQAAIIFGLG
FT                   LPDLIDTQTMYLPQLSKVDLDFGDLGAWVVPIKLALTKALELYGTRKGVKRAAEGNSPI
FT                   ADKDEKYDNPDDEEFVVENRRDIYRAATLH"
FT   CDS_pept        join(complement(331283..331402),complement(330829..331236))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943662"
FT                   /orf_name="Pc24g01550"
FT                   /product="Putative uncharacterized protein Pc24g01550 "
FT                   /protein_id="CAP87063.1"
FT                   /db_xref="UniParc:UPI0001833512"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWU6"
FT                   /transl_table=1
FT                   /translation="MDSPNSSPDQKKEGEQQPSELPSLGDKDNPPVTSNHVLPLLSPAQ
FT                   HEEGTRHTLATEPFQPVLKVLADLERDDPKFAFPAARIVGLYRRLWESCVSKHIDGQKL
FT                   NQSNQNLKEAGTHPRKERDGLQLHHEKQLAQLHFFEQALESSRERLISLLDDWNYPFRP
FT                   NLTGLPDVAREG"
FT   CDS_pept        join(complement(336223..338065),complement(333737..336158))
FT                   /pseudo
FT                   /gene_family="HOG000076699" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(339000..339176,339224..339475)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127665"
FT                   /orf_name="Pc24g01570"
FT                   /product="Putative uncharacterized protein Pc24g01570 "
FT                   /protein_id="CAP87065.1"
FT                   /db_xref="UniParc:UPI0001833513"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWU7"
FT                   /transl_table=1
FT                   /translation="MPPTTINQNALSRLTELSAWVSETNEFKAEQENLFRCSDEGRHVR
FT                   VDPLLGELGFNKIKGYGYSIWRITGKIALKATRHYQSLFFPLSIKSGSGSAAGEVQAAG
FT                   EVLTPGSYISFSSPLTLDSQLDCLIVYLPKTDDSSVAE"
FT   CDS_pept        join(complement(341741..342644),complement(341513..341690),
FT                   complement(341292..341455),complement(339747..341242))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823369"
FT                   /orf_name="Pc24g01580"
FT                   /product="Pc24g01580 protein"
FT                   /protein_id="CAP87066.1"
FT                   /db_xref="UniParc:UPI0001833514"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWU8"
FT                   /transl_table=1
FT                   /translation="MPCSRRFGFEGDDAAYIWYLEDRIFELETSLHRLSRQDARIETLH
FT                   PLRGQDNFVSNRGKDFAGARYHRSGDSGTFDGQGRGDRTQPELEASPSRGDEDHNHEAE
FT                   DADNDRTGLKIIEYNPLSKDSKRAGPSLNQGGGQQLRVKSEFTSFLTDLPSLKDWTSPI
FT                   DEARRKIILRELVRDCRSAASTCISSNDQSEAQSCTSAEPVNIIPILHQYAHFTARDSS
FT                   LDRKIAYFRELVFVSSCAVALRIHKEKDQVYEVMRAFRGSNAQSKHLSKLVCGAKWANR
FT                   AISLLSQTKWASRSWSVIFAAERPVTFYGRFAEYSTETEGLLLKRIRDIVNDSSGHGIT
FT                   DEAAPLVIPLILERLFKDTTSLKVICECLGYSWTDVNSYRPLFNEALKPYDNKRPSTSE
FT                   QSRHSKRRCQGQHNKPDCDDNTLRPRTQHLIQRSGKNRGIQQNSEQNNAIFDEATSLSP
FT                   RTPQSHRSLSSDLQASLASSSHTSPRANSTFSALAAPSLASGFPQDVFNDLPNPSCPAD
FT                   PFPASDFPHGIFRDLPNLPESGQPSYLADPFPASDFPHGIFRDLPNLPESGQPSYLADP
FT                   FPASDFPQDVFNDLPNHSFPADPFPASDFPHGIFRDLPDLPESGQPSYLADPFPASDFP
FT                   QDVFNDLPNHSFPADPFPASDFPHGIFRDLPDLPESGQPSYLADPFPASDFPQDVFNDL
FT                   PNHSFPADPFPASDFPHGIFRDLPSLPESGQPSYLADPFPASDFPQDVFNDLPNHSFPA
FT                   DPFPASDFPHGIFRDLPSLPESGQPSYLADPFPASDFPQDVFNDLPNPPFPAEPFPASD
FT                   FPHGSFRGLPNLPESSQPSYIADTSPASDFPHESFNALPAGSLPAEDSHDTPKGCSVNF
FT                   AVTGEPGKCSTDSVATPGSRQGNLADFMSPSSHLPNLTSSVA"
FT   CDS_pept        join(343477..343631,343684..343964,344011..344088,
FT                   344139..344592,344974..345115)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076532" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943663"
FT                   /orf_name="Pc24g01590"
FT                   /product="Pc24g01590 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP87067.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001832C39"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWU9"
FT                   /transl_table=1
FT                   /translation="MSSLTSGHVLRGACWNYRVLEPVKGDNTHISTVFKAQIVARDSRV
FT                   VPEVPEWALIKVASPSDQNATKNLQREVLTYRLPDVASAKCFRKMYDVIDDSTIALEWL
FT                   DTTLAEVEYHPDIRTYSLIGTFLRAAFTGCVVLENHRHVNTDYKPANILLSGIRTDRAI
FT                   AKVGDLGLVVPVGELFNAQPYAMRAPEVFIGNACTEPSQVWAVAAMLLCWIKPGVLGVW
FT                   DSPHPLINEAWSMAKIQRLFPHWEIPPPEMVNGDILKVAVNSARSLCKEMPELLAILPF
FT                   DEETQKVEMPQQLRDLLRFILVPDPKARPSASSVLASREFRRSRMPFEPVMLGHASALQ
FT                   SRPIRMSPAGFTKAKLISVLAIFEQDNSA"
FT   CDS_pept        join(345357..345565,345616..345793)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823370"
FT                   /orf_name="Pc24g01600"
FT                   /product="Putative uncharacterized protein Pc24g01600 "
FT                   /protein_id="CAP87068.1"
FT                   /db_xref="UniParc:UPI0001832C3A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWV0"
FT                   /transl_table=1
FT                   /translation="MALIGHVFNRVLNKYIPVYIAESGNGFIRLTAYIDQKVKDAAFAT
FT                   VKAPFENGKLFKDDDMKQMEQLSITNMSHSSLGDTNAHYSVQGETGAGSKVKGNHAQED
FT                   QSKQTVIPAPPLHVGINAQLIPSL"
FT   CDS_pept        join(complement(346754..346998),complement(346514..346603),
FT                   complement(346217..346313))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943664"
FT                   /orf_name="Pc24g01610"
FT                   /product="Putative uncharacterized protein Pc24g01610 "
FT                   /protein_id="CAP87069.1"
FT                   /db_xref="UniParc:UPI0001832C3B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWV1"
FT                   /transl_table=1
FT                   /translation="MSQWAFISGSSCTALAMPWNDRSGRASSGRSNNTASTSSPIMVKC
FT                   RLEVQLVSSDKMLVAEGSSVLSSDSFPPQGSTSSLPAGAYAATNRASIELEYQPALWDI
FT                   SIDIFIFRSMICSDRRTLRSGAKKGSARFATRYDREPLV"
FT   mat_peptide     join(complement(346754..346950),complement(346514..346603),
FT                   complement(346220..346313))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWV1 "
FT   sig_peptide     complement(346951..346998)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWV1 "
FT   CDS_pept        join(348906..348953,349088..349657)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976578"
FT                   /orf_name="Pc24g01620"
FT                   /product="Pc24g01620 protein"
FT                   /protein_id="CAP87070.1"
FT                   /db_xref="UniParc:UPI0001832C3C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWV2"
FT                   /transl_table=1
FT                   /translation="MAPKQYKLLQISTSWYPWDVLHIREQHANMVTVGATGWKLEISLD
FT                   EMKSSISGCAFLLDHGGYFWCIIRHTLQHWRNPEWRPLSGADGLRVGSKTQKGILHLCP
FT                   VFYGDTSALVPFSMLEMTTPGRIMIWLAENQVTQYTLKLKAKLLLQIIKAGLIGNWKFS
FT                   RRLILDIAICGQRVMLIVIVITMRLVNTMWERRFANSFEPLE"
FT   CDS_pept        join(351325..352188,352240..353298)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670605"
FT                   /orf_name="Pc24g01630"
FT                   /product="Pc24g01630 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP87071.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001832C3D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWV3"
FT                   /transl_table=1
FT                   /translation="MPPHHQSESAVRTRARTACQSCRKTRTRCIGGPPCENCVRLRKEN
FT                   CEFVHTPSSKKLVTPEPRPVRDACLPCCMEKALCNGGPRCENCVAEGREVCAFDLESHK
FT                   EVRPRKRRTWACLPCRLRKIRCTGGGPPCGTCTSRGVESTCEFIETTKDDPEDTRMHTI
FT                   QGQSNGNSESSRNAVMEAGTIQQPDSTLDERPENRPSPNTFTALDTRQVCRKKSLSCSE
FT                   TLSTISNANPLSDLSKSPSLDGSDSDKGAHLASLIGCSSHGELLDVLPNCQMVDYLIER
FT                   YFESISTLFCVINATSFKAEYEVFCRNPNVTPKSWLSLLFAVLALSCRAEEDPERGCCS
FT                   DRLSTLYEKAAWDCLLTNDPPFEPSPTSLKAIILIIYGRTHRGADVFSNLQLAYHTAGS
FT                   TKCHIDTTQCVVEPMVCEEYRQLLIGLKMLFLLNAQVHDYYRNRDITQGIERRADIYKS
FT                   TERPHLPISVEGSPTTQMTFTILNLQLLEISDKICVSAERGLMSEWSLTGLETELFRIK
FT                   EQCSEIYTKVSESDSQLGSHPGSQGILHCYINYLLHLLFLPDLQRYLNGDIASGTIISQ
FT                   SKCIAFAKASLQCFNFLAEDIQSKSYGWYIRGLEVTMLSSQHILSSEVVQGYRKMTNTK
FT                   RSGLY"
FT   CDS_pept        join(354097..354306,354356..354766)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976579"
FT                   /orf_name="Pc24g01640"
FT                   /product="Putative uncharacterized protein Pc24g01640 "
FT                   /protein_id="CAP87072.1"
FT                   /db_xref="UniParc:UPI0001832C3E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWV4"
FT                   /transl_table=1
FT                   /translation="MSFDHTIPYSAMEVMGYSKLQASSPPESMVREVERSLRSRPNEVS
FT                   ETVTYGRGDHDACESFLRFGIQDHDFTRKIEEVIARPAFLLHQGPVIVHSPDFPTNWGI
FT                   NAAHPVRNGVSVFRTLSGNLEDRVAILKLYPVSHHLSSTEFAQERGTPISFYLRPNEVL
FT                   FVRGALKMEIKLPAGGFLVWQGFSKEPWGMDPSAREAFAFMRI"
FT   CDS_pept        357371..358952
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(360003..360400,360478..360659,360723..360747,
FT                   360800..361076)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823371"
FT                   /orf_name="Pc24g01660"
FT                   /product="Putative uncharacterized protein Pc24g01660 "
FT                   /protein_id="CAP87074.1"
FT                   /db_xref="UniParc:UPI0001832C3F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWV5"
FT                   /transl_table=1
FT                   /translation="MHWNPFAFCGIHHGGPVSCCGVTKKGEPCKNSVKFQDTKIGHERL
FT                   TTLGREPFDLSTLQPKLYDIARVFLCARWHRQRQADQVGQQWYGAAVRNQARVPRGSRV
FT                   ATPSIVYPGQRQMFSASRRHLTGSDKTHRISWHISPAQPAILTSVANVWAGVQSLTLKD
FT                   LTLSDEFDDIHCVFCLAEDDDLANESVILHCFRTSCCVCRNEGPLDALVRPIRVQPSDA
FT                   ERELATIRKSSPNDPSRSQLRQRSVGPQGRSVEQSVENGPRRSARLGAHLPQGPSTSAP
FT                   PRRSTRLNSTRR"
FT   CDS_pept        join(complement(362526..362642),complement(362405..362458),
FT                   complement(362181..362342),complement(361983..362123))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076806" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127666"
FT                   /orf_name="Pc24g01670"
FT                   /product="Putative uncharacterized protein Pc24g01670 "
FT                   /protein_id="CAP87075.1"
FT                   /db_xref="UniParc:UPI0001832C40"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWV6"
FT                   /transl_table=1
FT                   /translation="MAITYLKKELPRRTNQHSDREAPKPGEGTAQSLPNQDHTYSYPIS
FT                   EVDQVTSTEPIQATPPYVRSHCTFDDGSSLNGRNASTVFKPRERAKQMDSTPVLGGPES
FT                   PGEGVGTDRNTQDGAEEKAPVRAGHVNISPGAKFANRDMRGDEFLEYFCGRRD"
FT   CDS_pept        join(363964..364442,364531..364714)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127667"
FT                   /orf_name="Pc24g01680"
FT                   /product="Putative uncharacterized protein Pc24g01680 "
FT                   /protein_id="CAP87076.1"
FT                   /db_xref="UniParc:UPI0001832C41"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWV7"
FT                   /transl_table=1
FT                   /translation="MTSHDTATQAQGSRSCNYPPYNQESPPQASVEALQKALKAQVLHS
FT                   LRVLRKIAMDHHALNLVPEIIDGWVAEIEGVDAKNIPIASSMAAQMSVPFERFTILTKC
FT                   ITATGPMQKLTIRHQATELLKYILAYAEEYYLVQGSQVYLDIGRWIERLTKTNMRKSLF
FT                   NVMGICSVMSHPRVPVPLSRIRPMKASVLSLRWVSRDYSNVLPIAHLGTSIVLCDTE"
FT   CDS_pept        join(complement(365679..365813),complement(365510..365568),
FT                   complement(365399..365465),complement(365143..365271),
FT                   complement(364907..365047))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823372"
FT                   /orf_name="Pc24g01690"
FT                   /product="Putative uncharacterized protein Pc24g01690 "
FT                   /protein_id="CAP87077.1"
FT                   /db_xref="UniParc:UPI0001832C42"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWV8"
FT                   /transl_table=1
FT                   /translation="MAKTFPTQVRRALVGGKLDDSVSLSIAEEELRRSDIATGDGLYLM
FT                   SAVHLFTPQAHASHPGLNNRQIHNRKLFLTFPINGLAQIISQVCPRNVGFLFTAPPLQH
FT                   PLSPSPFPHPFSGCRPSRTTLALADDGFHGGSNTNSLLNLGIIIRSGSHRLMIYGSPAG
FT                   SFRERIGPIPCAT"
FT   CDS_pept        join(complement(368262..368870),complement(367700..368110),
FT                   complement(367299..367640))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194425" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670606"
FT                   /orf_name="Pc24g01700"
FT                   /product="Pc24g01700 protein"
FT                   /protein_id="CAP87078.1"
FT                   /db_xref="UniParc:UPI0001832C43"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWV9"
FT                   /transl_table=1
FT                   /translation="MMQNPTSSAPPVDMGSFPFVFRPSVAIPQFCVAYRWWEDEAINML
FT                   WAYDFNDISQAIRFGLFHDETSPRSSLLSRNMQFINEFLLAASKPYEHCRLSDLSHPQK
FT                   VEEILLRSSIPQRPLLTWNWIPTISGGSSDPRTIALEIEAESYSHFQQIAFEDIVRSAL
FT                   GYKAMSVEWFLQQHTSLYGILVNHLHIYPEELLLYLEVEKHNMPSRNTPGFAFIAAPIQ
FT                   QLFKTHSSSLSTIFKVLSVLAVRFQKAYRHSDQMNWFAPFETSLPLLEDCLYSSATDLA
FT                   TALTQTDKCLFERLSRETLIAEDAMVLEPLIHWQVLSNSVLECCSGLSDLVPYLQTCTL
FT                   ELYEARNYYSLMAILDGLCKYIAVGSNTFRAFDASRTVVTPTSLIPAKVLPLIDPSHNF
FT                   ASYRKRYDQHPGIPFLQPHIRESKQCGKSAQQPLLRLFQAITSSQREDNNPVSC"
FT   CDS_pept        join(370343..370394,370783..371263,371327..371837)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670607"
FT                   /orf_name="Pc24g01710"
FT                   /product="Putative uncharacterized protein Pc24g01710 "
FT                   /protein_id="CAP87079.1"
FT                   /db_xref="UniParc:UPI0001832C44"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWW0"
FT                   /transl_table=1
FT                   /translation="MALSGLHLARNWMQAGVDSNQTYDCDSMYHDENSSSGSPTYPLVG
FT                   VPIDYPYGLTPAPLMDSAPAINPASNVCWSFDQAQNWTTTPASPTVTLPPLPILRCREI
FT                   RPRPLHESASTLPPVQPGKEEQHSRHRKLGEKNTRRAHRQLDQGHLKKTARSAIRTASE
FT                   VTDTTKKQVRVGRMRAKPPKVARGDSATQGPRPWSPGCSSNHPEDSSQASVRALQKALK
FT                   AQVLQSLEVLREIAKEFRVFNLGLETIDDWVAEIKEVDETLIPVPSSTAVQLLVPFEKL
FT                   NFILTKCITASGPMRDFIVRDQALELLKYIQTYAEEYHLFKNLRVHLDIGRYIERLRQG
FT                   KDNEMGK"
FT   CDS_pept        join(375979..376032,376118..376294,376409..376553,
FT                   376685..376698,377092..377130,377317..378591)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076809" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944673"
FT                   /orf_name="Pc24g01720"
FT                   /product="Pc24g01720 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP87080.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001832C45"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWW1"
FT                   /transl_table=1
FT                   /translation="MVFSARSGRERAVFPSCLSRTFLRRLTIPTFKQPRKSGDESRAPN
FT                   GPLMLLKRLFPLGQPIATTCSPPFICTITSSHGYPVNDTSIHERQAPKVHRWRVDYKRD
FT                   RIAVIVRMRNGSSDSCGHDIVSKLFQIDYVPRKRTRHSLVPGIDALLCILPSRIIDYLR
FT                   AIANAKFFMQYCRSLHAHGQLSNKVASRPSYTCSLRNCSALAGSMFQERGKHLLLLSPA
FT                   QPFPQLDQHDGPSLPKVNPLTPAATPVHNLXSQVLPSWSDVGHSIWRHNKLDTTSLHRE
FT                   YRVDHGVIQAYHCSPGSHYHAPMLLRDRDMPSLCLSHETDRPLEWTSIPCLPPLGPCHL
FT                   RQIDSSPMPNVVQRVPGAGSSTMQTVNPALVFPSALTTASETLDITSSLPAAAEVGPIP
FT                   SGTGIVSTWILDQPQEQSQVLHGTTMCVNDHSLLDCHVNSRQHGHNLNLENQQFDMHER
FT                   RFKCKIIGCRMGFKREDHLERHTRSHSKEKPYVCWVPGCHRTFSRRDNLKVHCTKTHTR
FT                   RGGRNRYVATLDEASPDYDPEFRGQLSFDGRPLRFLAPISSVPEAKPLQP"
FT   CDS_pept        join(complement(379578..379694),complement(379126..379521))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944674"
FT                   /orf_name="Pc24g01730"
FT                   /product="Putative uncharacterized protein Pc24g01730 "
FT                   /protein_id="CAP87081.1"
FT                   /db_xref="UniParc:UPI0001832C46"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWW2"
FT                   /transl_table=1
FT                   /translation="MDSPEQLPDQDRADRQPSEIPMESDEAYPQAVSDSEPPLQQEEIL
FT                   KKPLTIEHFQPILETLADLDRDDPKLAFQAARPVGLFRRLWASCEPKHSESEIPDENDR
FT                   APKEATTKLNKQRDGFQLRPDEQLSRLSSLEQALEQTQERLISVLKDWNQSSRGDLAML
FT                   MGMKTCS"
FT   CDS_pept        join(complement(382667..383191),complement(381801..382586))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944675"
FT                   /orf_name="Pc24g01740"
FT                   /product="Pc24g01740 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP87082.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI0001832C47"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWW3"
FT                   /transl_table=1
FT                   /translation="MSRPVSKFAEWLARASIQDTFGLCGLLALVCWICCSLGRRFRHLP
FT                   LRLQQVSWRSFFQAPTPGVLQWLDIPTYLQGGVLTALVIANTIVISLHAQTWADVQRRA
FT                   GCLAVTHLVPLCSGLSFSLPAHVYYVERDTFYWAHRWLGRICVLHCLLHGSVLGANARN
FT                   TSLGAPLAIPLLAGCSLVSILPWTLAAILRRWPQLGLKVHYMLASIATGALFYHLIDRV
FT                   SSYRWVLLGGICAGCAWSAGTCLHTMWFHGSWRITSRRALARSFNQFLWLDIAVPMGWE
FT                   AQPGQYVQLWMPRSGVRSFLQLPSFYVASVDTVHNAPGPPTTRTLRIVTRPRPGVTGRI
FT                   AQAADHATYSTIHFPVCVLGPYGHPPNLGQYGTIVFVLEDIGLFRALPFIRHLVQESRS
FT                   RRNTVRRLEVLWQVRLKHFSWFPNSSRMLCAVMCLLE"
FT   mat_peptide     join(complement(382667..383077),complement(381804..382586))
FT                   /db_xref="UniProtKB/TrEMBL:B6HWW3 "
FT   sig_peptide     complement(383078..383191)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWW3 "
FT   CDS_pept        join(383296..383380,383544..383590,383694..383788,
FT                   384010..384103,384227..384292)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076811" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944676"
FT                   /orf_name="Pc24g01750"
FT                   /product="Putative uncharacterized protein Pc24g01750 "
FT                   /protein_id="CAP87083.1"
FT                   /db_xref="UniParc:UPI0001832C48"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWW4"
FT                   /transl_table=1
FT                   /translation="MAWESDAAKMTLVSNDQKPHFMTWDGVAVPTVEVDQHSEKHLHMG
FT                   SGSYLPYAFSGFQRQRSVSQPYCFLSGLSTGRVDSRVVDFPWHILQIDGHVVGCPKVAA
FT                   DGTDVARDLLRHQLVVLDLGGPSV"
FT   CDS_pept        complement(385057..385791)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076815" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670868"
FT                   /orf_name="Pc24g01760"
FT                   /product="Putative uncharacterized protein Pc24g01760 "
FT                   /protein_id="CAP87084.1"
FT                   /db_xref="UniParc:UPI0001832C49"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWW5"
FT                   /transl_table=1
FT                   /translation="MLPQGRPPNKADSREEFISIENGVVQVFPQAQLTNLEHHDYQIGI
FT                   LETAQSGNLKIILANTKKRKQAKSLRASLFHFQNCVLEKVPPYFSSWSTEFWVSDSVVI
FT                   DSKSIEEAELILKALRPERLDETGYVCVGLPVTIFGPLFNTLISKWNASAASFEHSNGF
FT                   IWIYSAVDPANFKITTGESDSSTNHSVYSLLERMSGKSWLVRAKLTFRLETSSREKAAI
FT                   LAELLEVSHVQVTSSHKPITHS"
FT   CDS_pept        join(complement(387240..387479),complement(387046..387186))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076814" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670869"
FT                   /orf_name="Pc24g01770"
FT                   /product="Putative uncharacterized protein Pc24g01770 "
FT                   /protein_id="CAP87085.1"
FT                   /db_xref="UniParc:UPI0001832C4A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWW6"
FT                   /transl_table=1
FT                   /translation="MAMEEENELSEIISSYSEPSESEEQESISEHSEEDISETSEDRAF
FT                   VVSDGDQSPYSNRSSESSNYSQHCHHRHDDDFSNPVGHKIPISTIAKRVIHQNDSPVVQ
FT                   YLVLWRSWEQERPHMSGIAEKT"
FT   CDS_pept        join(388193..388249,388305..389465,389522..390275,
FT                   390326..390864)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823655"
FT                   /orf_name="Pc24g01780"
FT                   /product="Pc24g01780 protein"
FT                   /function="polynucleotide 5'-phosphatase activity "
FT                   /biological_process="mRNA capping"
FT                   /cellular_component="mRNA cap methyltransferase complex "
FT                   /protein_id="CAP87086.1"
FT                   /db_xref="GO:0004651"
FT                   /db_xref="GO:0006370"
FT                   /db_xref="GO:0031533"
FT                   /db_xref="InterPro:IPR004206"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="UniParc:UPI0001832C4B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWW7"
FT                   /transl_table=1
FT                   /translation="MDLRTIMNTDGGASNPPPPSNSASSPISDQTPQKRPKKAASYSEY
FT                   PTRPPQPSPLQHPQHASPERSSPYTSVQSPYQQFNSAPVINTAQRSQTPPHISTPYGPG
FT                   TRDPFGAPAYGSHPQHPGGSLVSPYTPQPTSAGPQHPEQQSYFAQQRSQQRSQSLQSVM
FT                   TTSRAPVESFRSPPVASQPLPLQHFSPTAHRSVPGTPLGPPPTFATRQSPSSARPPSSG
FT                   HNSPINPLSSPRPTQEAPSRDQVPTQSPVAQRQFSPHNYHPSEPTHLPSGGSKQEPTES
FT                   ASPKSISRHNSIIAASESANAGQIRTSEDRMLVESPAAQKPTVAGSDLLTSPLAPGSQM
FT                   NSSPSGARGGAHAVEMEVDHQPRVDAQQPKPKRRRYNEPPIYARLTPRNTSRRPIIPNP
FT                   RPPIPKHARQSQQDFSLDTRRRSSSIMAAIPAARVTRAPAVASPSTSMPRAQGPPAPSA
FT                   PPLRPPSNSQAVGSLGPWEPSITGFIPHEELTKTLCDFLFQHVVMRNDVNAGPAGSAAA
FT                   GQGTIIEIEAKLGHIIDMDSRDRIHLPILTESVLNRENAREQHRAMNNFLNEAVKASIP
FT                   QPNSTRIPLAYVHKKERDTFYEIQAADLPPVIRQNLNPRHKPKVRVTTDERTGEIIAKI
FT                   VKCRIADVDVCSPRTTVDWRVSVNLEMEYTGDVSHLPVVDAAVSKGGRGDRIKDRMSYR
FT                   HLAYQVDLTQVAKSDVSLYKCSVSPSKXSLLTMSQQQPGKNEFEHELEVEVSAEEIRRQ
FT                   GQLAMSGDPKNQYEDLVKGFVDNIRLLARAVPP"
FT   CDS_pept        join(complement(392855..393524),complement(391709..392720),
FT                   complement(391560..391619),complement(391442..391520))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076798" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823656"
FT                   /orf_name="Pc24g01790"
FT                   /product="Putative uncharacterized protein Pc24g01790 "
FT                   /protein_id="CAP87087.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832CD2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWW8"
FT                   /transl_table=1
FT                   /translation="MATRGLVSPILDTNQHPMQVVHGLSVKNQENCQHQHQSKFAQSHD
FT                   AHHPANILAIPTELLYDALDYLSTEDLVSFAFCRWDMFHALIGFLERKARPSLQGLGLL
FT                   VTLFEEQWPRKWLRIIVPICARSEQPILRDLETLAELFEDNHWPKEQLRDIIIVSARRD
FT                   QPTVHSCVELVFEEPACLYLRKSPHTLFDTNNFHMTVLHFSVLNRSQNIVQEIGSIAHN
FT                   MHCLGYTPLMNACHLGRDEIVHCLVDRGADIQATNNFNLSALECIMTGESRTKKTLLQR
FT                   ICPHATQMQLNRALWLAINDKKEFVGILLEFGADGQYAGNFKEDGLYDSEQNGNPSATT
FT                   QGPVEASTPLSRRHLSPSIATGVTSREPDFLADLSPIITTEAGTDDDGIVDGFGTFRGS
FT                   PIIIFRYGPDFVAKFSAKYTDGHGVSERLGVSSFDVRITQLRDYNDLGKYWRYSKENVV
FT                   GICGVAFEERKFPDRIYKLRKAVWVKIKWRNIVIIDRGLLQGDFSWIPRDDFVRLCGSK
FT                   NVAESKLREAWKRQEERYIIWKYRDESQVTRVGRWLASFPWDFALVIHWWRGIDYLSTK
FT                   LGGLVAMSLAYTVVKANEHGYEHQEELQLN"
FT   CDS_pept        join(394393..394825,395050..395204)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127930"
FT                   /orf_name="Pc24g01800"
FT                   /product="Pc24g01800 protein"
FT                   /protein_id="CAP87088.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832CD3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWW9"
FT                   /transl_table=1
FT                   /translation="MAIPPRSMTVIDSEFQHLKGIREICFDEDVMAFLHDAQATLKYQG
FT                   IYNQRGPSKRSLIHYAAMGDCAELLLYLLQDGTAKDDLDQNKRTPLSWAAQYSALRAVK
FT                   LLLDNGAEINSMDDMYTTPLSWLVQAGRGPNRAATINYLRILLDPLNTNALQQDKVSKR
FT                   RATSILFCHGVKKMKNAKKHRLNDEMGAGGTF"
FT   CDS_pept        complement(395671..396216)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823657"
FT                   /orf_name="Pc24g01810"
FT                   /product="Pc24g01810 protein"
FT                   /protein_id="CAP87089.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832CD4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWX0"
FT                   /transl_table=1
FT                   /translation="MTGIKPTPGCSDIGPEFERLKAVREISLNGKLVAFVEKAHSSLQS
FT                   RGRFKQRDCYKRSLLHYAAIGNCTKLLLYLLQSKPDVDSRDQWGRTALSWAAEYGSLAV
FT                   VKTLLEQGANVNASDYEGGTPLAWLIHAGNPEMANLAATEAYLRERGAKEVKLRGIKWA
FT                   WVKVLSYSRLLRYIRPRI"
FT   CDS_pept        join(398192..398692,398764..398817)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944677"
FT                   /orf_name="Pc24g01820"
FT                   /product="Putative uncharacterized protein Pc24g01820 "
FT                   /protein_id="CAP87090.1"
FT                   /db_xref="UniParc:UPI0001832CD5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWX1"
FT                   /transl_table=1
FT                   /translation="MSLTTSATMIRTRLVIASLTVTWLALASLNSATVHFAVLLRDRAK
FT                   SDLVTPSDSILDITFQTLMDNVVDGMVIAALVSAVFSIFGFVLVIYPKWLQENCAARFY
FT                   YGCIQIVVSMIVLSLGGWIASRVHGFQTSFEFFDRSHIPYYKIMYYGSVGQAAFGSLVI
FT                   IMSLRRLDDFQKRREVEAKKD"
FT   sig_peptide     398192..398284
FT                   /db_xref="UniProtKB/TrEMBL:B6HWX1 "
FT   mat_peptide     join(398285..398692,398764..398814)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWX1 "
FT   CDS_pept        join(complement(401052..401142),complement(400846..400884),
FT                   complement(400282..400478))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944678"
FT                   /orf_name="Pc24g01830"
FT                   /product="Putative uncharacterized protein Pc24g01830 "
FT                   /protein_id="CAP87091.1"
FT                   /db_xref="UniParc:UPI0001832CD6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWX2"
FT                   /transl_table=1
FT                   /translation="MSLQIVAVKEDVGFNRPQLRNVSFNTSNQVVYIVDQQTRQFLYLN
FT                   LWELTRVALITLHYRQCSTQSHGLHTNPSPVASNNAACPRWKIANQDSESTTGCGHPRA
FT                   NFVA"
FT   CDS_pept        join(401976..402095,402142..402690)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944679"
FT                   /orf_name="Pc24g01840"
FT                   /product="Putative uncharacterized protein Pc24g01840 "
FT                   /protein_id="CAP87092.1"
FT                   /db_xref="UniParc:UPI0001832CD7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWX3"
FT                   /transl_table=1
FT                   /translation="MDSPNSSPDQEKQGEQQPSELLILSDKDNNGEPSDHVPPLTSTSR
FT                   HEEETRHTLATEPFQPTLKVLADLKRDDPKFAFLVTRLVGLYRRLWESCVSKHIDGQKL
FT                   QQSNQILREAGTHLRKERDGLQLHHKKQVARLRFFEQALESSRERLISLHDDWNYPSNQ
FT                   NWQGCQTLQEKSKELPIPGCPVLYRQHRNTTSGDAVQGKLHRMQSRVYIPEAFNKKGTK
FT                   "
FT   CDS_pept        join(complement(404186..404327),complement(403796..404130))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944680"
FT                   /orf_name="Pc24g01850"
FT                   /product="Putative uncharacterized protein Pc24g01850 "
FT                   /protein_id="CAP87093.1"
FT                   /db_xref="UniParc:UPI0001832CD8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWX4"
FT                   /transl_table=1
FT                   /translation="MDYPTLPSPIGRPPKRQRRVSQDAEDQSKLETHLQQSSNGTNVEA
FT                   KVVTPRTLMVEFMKLLRYNDTLVTPALKLPDLHSSLWECYVIKSAEKMQFEDKQRQLLE
FT                   SNEWLASVNDILLQLCDEQAMELRDRKLAVQALCNGVVSALQASDPQAYHVDEP"
FT   CDS_pept        join(complement(406457..406459),complement(406116..406403),
FT                   complement(404798..406081))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976806"
FT                   /orf_name="Pc24g01860"
FT                   /product="Pc24g01860 protein"
FT                   /protein_id="CAP87094.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832CD9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWX5"
FT                   /transl_table=1
FT                   /translation="MLNIRDLPNELLLWIVSRLDGGAVFALARSCTTLYLKLQPSTWKY
FT                   NIKFQNSNLLHLAVKYDNVGLAEALLQYNANINAFYRGKTPLMRAFQYSSAAISTFQNQ
FT                   ARDSALSYAIHYGTFSTIKSILEQPNVRVDVKHKNGRTALHLAVFAGRIGFVHLLLSSG
FT                   SDPDLQDGPGHSPRAWACRFNRPAMKTVFFNDPDSEVFLGTLLSQDAELPFHQAVSHGS
FT                   IEAVKQRLRQKGLNLDIQDRKGYTPLHLAIQSKRLEMVNLLLSHPRVNVECKDKDGNTP
FT                   LWLSTYSSCDEIAERLLAEKDINVNSVGGRGRLETPSTSLHHAAARLDTVLLRRLLVVP
FT                   GIDLNLSVAGHSPISVAASHGRVNTVDCLLSIADVEINGRGLIDPPICRAAAHGHHDVA
FT                   RLLVQQGTRLNINESTLASHDTALCIAARGGDLEMVQGLLRHDRIDVNIRNRWFEDPLM
FT                   LAVKGGHFSIVDALVANPGLKYFSLKRSLDIARNGCIKRAIRSRTEDNNIPQTLLKRSP
FT                   GTKFGGL"
FT   CDS_pept        407060..408430
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976807"
FT                   /orf_name="Pc24g01870"
FT                   /product="Putative uncharacterized protein Pc24g01870 "
FT                   /protein_id="CAP87095.1"
FT                   /db_xref="UniParc:UPI0001832CDA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWX6"
FT                   /transl_table=1
FT                   /translation="MVSNAGVKKTPKTERRAPKHRQETLENLLGEAQREENSNEEGPSD
FT                   GEQGAAGPGPLDDRPSADREQPDQPNSSQGSDISGDTHRGTGPADEPQLRDEEMSDAEP
FT                   DITNESTSDGTAGAQTRGMNDSSVGPQLFVDFEKLNINECRREKKGRHEDPQPGDIAGF
FT                   GGIGKSRFFIFRVGPAQAPRHVFRRTRAYSTEGFENLSHNRISLLRYNAPNGDRHWQYT
FT                   RRNIAGFRGIAIDETESNLKCPQTWINVEWKDIKEEHRYLLVDECSWTPRTDVIWLSGR
FT                   KVTSTGIRAIWNLQETLHIKAIQKEGKLVSPLPFPLATFEGDKIKPERSRTPAQLRSFS
FT                   STTKTRPSTSGDHMANGNKQEQEQETSTVVPSRSATQDDPGSNVVEVESSGSSQSKNQA
FT                   PKKFNFQTYMASAEKMEKWNAMSEGEREERYRRALANYDHYREERLNKGDVEVEEEL"
FT   CDS_pept        409059..409880
FT                   /pseudo
FT                   /gene_family="HOG000213042" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(410563..410573,410682..410751,410846..410965,
FT                   411183..411512)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944681"
FT                   /orf_name="Pc24g01890"
FT                   /product="Putative uncharacterized protein Pc24g01890 "
FT                   /protein_id="CAP87097.1"
FT                   /db_xref="UniParc:UPI0001832CDB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWX7"
FT                   /transl_table=1
FT                   /translation="MPQNASTDAEIMGWRLCGRRKRCAVPAPSNVDSTRISTPWAHRHW
FT                   RTFQKLQMKIVFLWEGMTKFSTVRFCDAGLSDDLRESRSGRFYWWPGEKLERIAKVQTR
FT                   STSPKFRPSVSDGTGLCCLGGTAGADEYLEYHRLWRQNGRLQTDPWLCSPGRSHEKVSS
FT                   PIKWQGALCQSVV"
FT   CDS_pept        complement(412112..412628)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(413337..413499,413583..413648,413797..413939)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976808"
FT                   /orf_name="Pc24g01910"
FT                   /product="Putative uncharacterized protein Pc24g01910 "
FT                   /protein_id="CAP87099.1"
FT                   /db_xref="UniParc:UPI0001832CDC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWX8"
FT                   /transl_table=1
FT                   /translation="MAYTTMPLNVMLGGSKEFFTPATIGGIHAGGSRGIKHSHDRPIHS
FT                   TLFKQKLAFCFTYHFRYHVPRTTWKYLAEVAEIWSLCYNWEKATSLVMFCAKIDSLMKL
FT                   QPKTLCSHSSVTEADHLAN"
FT   CDS_pept        complement(415117..415647)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944682"
FT                   /orf_name="Pc24g01920"
FT                   /product="Pc24g01920 protein"
FT                   /protein_id="CAP87100.1"
FT                   /db_xref="UniParc:UPI0001832CDD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWX9"
FT                   /transl_table=1
FT                   /translation="MVPRDAHMSSTSMDNPKTQRNLHNFGSYRFSESACSVRRPWLSRK
FT                   GLGWPPRSVHNDKTERRRPPRPKYDEEEMYFIWYHRVNLNQQWKVVQESFNRQFPSRQR
FT                   GSFQGLQCKFYRFIKAKKGPAPRGQHHMDSSSFLHGGTAFSRSFPSPQFGVVKSTKVWY
FT                   PWMRGNCDEIVRD"
FT   CDS_pept        join(complement(420300..421182),complement(418436..420249),
FT                   complement(416981..418369))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076699" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127931"
FT                   /orf_name="Pc24g01930"
FT                   /product="Pc24g01930 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA integration"
FT                   /protein_id="CAP87101.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI0001832CDE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWY0"
FT                   /transl_table=1
FT                   /translation="MSALVHDSPDRAVTAIEPLTGSDNFATWKRLMTSYLKARQVWDVV
FT                   SGGLQRPDCLFKYAKPITADIHPLVEPHLNGAVRQRAIEARLEVEVQAFERHREWSRRE
FT                   AEAYHTIFRYLSPHISIHVAGLETSRDLWNELEERYRRMELATFCELFAQLRETTGERC
FT                   GSAREFVDRVRLLVHRLNAIAPGSIGDRAHIAILLTQIGPEYVLIVDAIQNDKDPVNPT
FT                   TIGNRLSNAEQTVRRKESPTPLQAASGPSINTVQQTAKKCNYCKKRGHVVAQCWKKQRE
FT                   AQPSRDHALKAERSGRSAGPADFQETEDQYREGEGDDPLYPRTATPVDSGLGRHQPHLL
FT                   GPELLQQSAAPPRDAGHGGRSSGSRRDWYGEAHAPGEVQPTPGVKECVLRATRRDEPDQ
FT                   CTEVIARPLLGGGAPAERLCATPRTDGGDRLPCRGGSVDPAVPCSKRSRERVQLARAPA
FT                   THGHADSLEPQAVAMDVDDPRESSDAECAASTSELGGEAVILEEDACKGVDQASEALWH
FT                   ARMGHLNRGDLRVVLRQTGTPYRPLTQAQLLATPQCPACMSGKQHQKRNSRARRPRLHS
FT                   TRIFEMIHSDIMEMPIAKDGSRYVITFTDDYSRGSWAYAMRWKHEALQKFRQFEAWVHR
FT                   QFGAQIKRFLTDNGREYLPIGTHLETQGVEFDTSPPYCKGQNGLAERTNRTIRERINTL
FT                   LSDAKLPPSWWTEIVDTVVYLKLRAPASILQKKTPFEILYGKPPSLLHLRRIGSCAWVL
FT                   IPKEHRAKLGPRSSECRLLGYCEPNQYKLYEIHSGKTVFSRDVEFDERTPVAPLIEGET
FT                   GNDLPDNAPPSPVFSPVVPPPPSALPTPPASPPDLAERLKMPSQHVKEILPPVNPIKQE
FT                   AESTQDLGYSIYGRRRRPSRRLLESLGKAVSGPNQLEWWAAIQKEYASLLEHATWEKIL
FT                   RTDVPVGDHAIGCKWVFKTKANGTRKARLVIKGYRQKHGIDYHETFAAVSRMDSVRCII
FT                   ASAVLRGWKLHQFDAVTAFLHGDVDSSSYMELPEGFEEPGYVYRLRRSLYGLKQAPRIW
FT                   YQCVHRVLAAHGFTMAQADNCVFYKSNCVICVYVDDFLVAAANSHEIDQVQRALETEFQ
FT                   LNDLGTPRSFLGIQFDFQADGSVSIHQHQYIQKVLSDFGMETCQTKNTPMNPKQVLNRR
FT                   PDEEPPDEETKARFATAVGSLMYLMVGTRPDIAFALGTLSRFTSQPQSHHQVALQRLLR
FT                   YVKSTQSHRITYRSGQLIGYTDADFGGSVVTDGAYSTSGYVFQLAGAPVSWSSKRQGEV
FT                   ATSTTHAEYIGQYNAILHLQWLRTFLAETQLYRSPVTNIMADNQSAIALSRNPEFHKRT
FT                   KHFNVKFHYQRAVLITEA"
FT   CDS_pept        join(421660..422230,422404..426884)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976809"
FT                   /orf_name="Pc24g01940"
FT                   /product="Pc24g01940 protein"
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /protein_id="CAP87102.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI0001832CDF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWY1"
FT                   /transl_table=1
FT                   /translation="MTRKRRSYKRHRWTDEELNLVCYLRYIRQWHFSQIQKANFPLLSR
FT                   HALGGVYGRLPLEERTRRAIAAAPVIGKSRNTTGRNPQRQAQPAFSNPEQGPSHLNSTN
FT                   TEIGHAPLTSNGNNSNRYNLRPNRPTTFTERKPRYMVDRVRFPHFFESYSNHLKSYELQ
FT                   DSEYVPPSHTPTPSSSENSHSVNSSQPSLSSFYNAIPTLDNANDWSQWNQKVKEFLRTS
FT                   PVTKDGTIPPLEEEEAQQWSHRQTFYSSMIAAKLTHNAAQRINAFEITRVQSLIEAVKE
FT                   NFKPEGSGTYVNLQRRYMSLTRAKCGSAQTLGAEIRKIHAEKLLLDPACVTSEIERTFF
FT                   FLHALGPEYESFRDHIFRQMDIVNDRDENGHITKAAPTFDYIENKATEEEHRKGQLSNQ
FT                   PADANALPAFTLSRSLRDKKIIPSSDGKTCRIEINNVPFCVFCQRPYHREPECFKKNPN
FT                   LRDQEKERRTRRPRPSDAYTDLRKPSKRRASTDHEDDDSEGPRDPKRPTFMATQASKQD
FT                   INAAFGREVEGNLATFGHIPSMMATKTLSIRDAWIVDSGCAQHVCNNASRFVKIDKYDG
FT                   PPLRSVDTSTAPSGIGVANVLCNVRGRKKWLVLDDVLFVPTAHANLISVLQLLNRGAKI
FT                   DFSSNGAIIRNKSDGKNLFTSSQYHGVYALDLWANPAFPAYHVSPQSALWHNRLAHMSG
FT                   ANIQRLKKQAHGIRDDTPRQPCNPCLQGRMIETPHRRSDACKRAKYAMELLHIDVAGPF
FT                   EEGLDGSRYWLTIVDGHTGWVEIVPIPRRQEYVVESLRYFLDHNERPERKCRRIRLDRI
FT                   PEQVGEEMKFTLFSRAIQAEVTGVDQHQQNGVAERAHKTIYDRVGPTLAHAKLPPKFWP
FT                   EIARTAAFLSNRSPSSKRNMTPYQAWYGDKPDLSRLRVIGSKGEYLIPPKQRKKLTGPR
FT                   TRPCLLLGYEGNTNYRILLEDGRIIGTPNAEFHEVLNTPSTQTREDVGAKQQSFPVATA
FT                   AAAGGSETVGLINQPSASMRHASVPASGRQISLAPQGQIQPRSRDDIVQVHLPQSSDNN
FT                   SQPAVAGQGDITFSPTRSDDTFGPLSPASQDSVLRIDSPPGSDQQQGDAQQGRIPDWLD
FT                   CSELREGGAKHIVQQASLERHPELKLRDTQTFQDTPGDDQEELILMNIPDKNVIPTFLT
FT                   VAAEEIEPFEPKSLRQAKSDPRWLEWEKGMGEELQSLNQNKTWEMVDPPKDRRVLSGKW
FT                   IFKLKRGPGGEIIRYKCRWVVRGFTQEEGVDYDQTFASVVKPMSYKALFAIAAALDLEI
FT                   EQMDVKTAFLYGEVDHEIYVEQPHHTTDGMSRVCKLRKALYGLKQAPRIWYQMLTNFLR
FT                   DLGFEPINADLSIFVRSSMYIAVYVDDLLIIGPSIAEIKKIKRSLRNRFHMTDLGPCSY
FT                   YLGMTIRRDRQNRILYLSQEAYVHKVLQQFGMLDCAQVSTPIDTSPLPESGPEYICPSN
FT                   VKNEYQRVIGSLMYIMLGTRGDIAYAVSAASRHLANPGPQHMKLARRILRYLKGTKSLS
FT                   LAYKGQLQMLRGFTDADWAGCHQTRRSTAGYLFNIGSGAISWQSKRQNIVALSTCEAEF
FT                   MGQTQATKEAIWLRRLLHELNMGQGKRATIICGDNQGAIALASNPQYHSRTKHMEIQRK
FT                   WQGEVQNAKTVELKYIPTSEQIADGFTKPLARDRFQWFRKGLGIE"
FT   CDS_pept        join(427498..427515,427659..427721,427919..427954,
FT                   428254..428557,428801..428904)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944683"
FT                   /orf_name="Pc24g01950"
FT                   /product="Putative uncharacterized protein Pc24g01950 "
FT                   /protein_id="CAP87103.1"
FT                   /db_xref="UniParc:UPI0001832CE0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWY2"
FT                   /transl_table=1
FT                   /translation="MSPSDYIYCFYNTSIGETSRQYNVSGFYCGTCTWLKHCKATHTLK
FT                   IRPTRRRSIYEEPLEIPFVGSTKHRDAIASALRSRSHRFSRRLQVTQAYSTVGWLYPRT
FT                   IASVKVDSQQRKPSYRGFSLAQEYPISSYIWVSPQRWRGEFDKYILNAERIVDAWRTES
FT                   DESLAGAACAR"
FT   CDS_pept        <432115..>433846
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944684"
FT                   /orf_name="Pc24g01960"
FT                   /product="Pc24g01960 protein"
FT                   /protein_id="CAP87104.1"
FT                   /db_xref="UniParc:UPI0001832CE1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWY3"
FT                   /transl_table=1
FT                   /translation="DTEGSTSFTAEQALFLGKFYTLYPASINLAGYFAFFGIHDVPDRK
FT                   RPETWIFFFYISWHSSLEEQEATTDWSITTSEGFSTQFTEPWKSEFSWLPDDQEVWYVS
FT                   LTDFEPRRHRWDSRDGRVTLARDAAHAMTYQRGQGLDHLLTCSLQGMRLSLCAD"
FT   CDS_pept        join(complement(437140..437175),complement(436710..437085),
FT                   complement(436300..436587),complement(435054..436260))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        438052..438641
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        440588..440995
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944685"
FT                   /orf_name="Pc24g01990"
FT                   /product="Pc24g01990 protein"
FT                   /protein_id="CAP87107.1"
FT                   /db_xref="UniParc:UPI0001832D65"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWY4"
FT                   /transl_table=1
FT                   /translation="MSPVCGMFNIKAPWQEVRVEPSAFRGTILPGPTQLRTGHNWLSAH
FT                   RKKIGYSDDDRCECGAQETVAHVLMKCPRLRMLQAELRRKVGDTMNSVSNLLGVSNEGE
FT                   QGKPVTVSRAKTVQAVLDFAEASQRFRSRAP"
FT   CDS_pept        complement(442327..442945)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(446907..447038,447136..447327)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823658"
FT                   /orf_name="Pc24g02010"
FT                   /product="Putative uncharacterized protein Pc24g02010 "
FT                   /protein_id="CAP87109.1"
FT                   /db_xref="UniParc:UPI0001832D66"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWY5"
FT                   /transl_table=1
FT                   /translation="MADGITLPHSTRCQLILLLVWINFPIAVTGGFVAWSLSQGIGNGG
FT                   ALVQTHIDVFDSFKDVVPHQGCNENGVRLGGSTHEPAVESLHVGIVASQLKQSHPQAAL
FT                   PLI"
FT   sig_peptide     446907..446996
FT                   /db_xref="UniProtKB/TrEMBL:B6HWY5 "
FT   mat_peptide     join(446997..447038,447136..447324)
FT                   /db_xref="UniProtKB/TrEMBL:B6HWY5 "
FT   CDS_pept        448364..448723
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(449203..449638),complement(449057..449109))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944686"
FT                   /orf_name="Pc24g02030"
FT                   /product="Putative uncharacterized protein Pc24g02030 "
FT                   /protein_id="CAP87111.1"
FT                   /db_xref="UniParc:UPI0001832D67"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWY6"
FT                   /transl_table=1
FT                   /translation="MSSRAWFEQLQSNFGSLREYIDDLHARRTDEETVLVNIDNETDEN
FT                   VVATAVKKWVSTRMGIVGRSLLLELKTPWNPPVPVCGAVDIEQRRVFAACDENGLPILA
FT                   AERNNCSAQDAKVIERLVSLESGPFEKGRAVLDMADMDRLLVCKHRGFLSSETYDKWP"
FT   CDS_pept        join(450473..450559,450662..450944,451111..451150,
FT                   451187..451478)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944687"
FT                   /orf_name="Pc24g02040"
FT                   /product="Putative uncharacterized protein Pc24g02040 "
FT                   /protein_id="CAP87112.1"
FT                   /db_xref="UniParc:UPI0001832D68"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWY7"
FT                   /transl_table=1
FT                   /translation="MGKLAQDVNVPISGPDRKSIEKTKTSPLPVNETLSSKYEPELLRK
FT                   MQEKAALYTTALETPHNNKSRKPTGRHTQTLYPTGTPSANRKRENSCTKDVSPCLRASL
FT                   RRYSSGTGLVSKARRKLCFLLVPSTYSLSWPTRPRVDGRTAAVPLRAKSFESSYTLNQT
FT                   EAVNPVAVVAFMLPSWRTTFKIVVMLRRDPRQLPLSWSAKHCQSYLALFSRIANRADML
FT                   LNPSSTFGIKV"
FT   CDS_pept        <452395..>454266
FT                   /pseudo
FT                   /gene_family="HOG000213043" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(456141..456924),complement(455773..456104))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944688"
FT                   /orf_name="Pc24g02060"
FT                   /product="Putative uncharacterized protein Pc24g02060 "
FT                   /protein_id="CAP87114.1"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001832D69"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWY8"
FT                   /transl_table=1
FT                   /translation="MSSILPWNPFSVCEIPPGSPASCCGMTKKGEPCKNSVKFQDTKIG
FT                   HERLTALAREPFDLSTLQSKLCDIARVFLCARWPPQRQADQVGQRWYEAAIRNQARVPH
FT                   GPRVAAPSIAHPGQRQMSSVSRSRPASGNTDRSPHGLRQDPPVPPSTNPEPVQPFNPFV
FT                   TSTMLRTNSVPWHVSPAQPAILTSVANIWAGVQDLTLKDLTLSDQVDDIHCVFCLAEDE
FT                   GLANESVILRCQCKALSHLACAEEWLEKRSAGLKRHAVCDADQYSRNEGPLDALIRPLR
FT                   VQSSDAETRHIHTASESSAERELATIRNSSPNDPSRSQPRQRSVGPQGRSVEQSVENGP
FT                   RRSARLGAHLPRGPSTSAPPRRSARQNFSRR"
FT   CDS_pept        join(457769..457887,457969..458163,458240..458306,
FT                   458377..458461,458567..458688)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127932"
FT                   /orf_name="Pc24g02070"
FT                   /product="Putative uncharacterized protein Pc24g02070 "
FT                   /protein_id="CAP87115.1"
FT                   /db_xref="UniParc:UPI0001832D6A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWY9"
FT                   /transl_table=1
FT                   /translation="MSCNPAHLQCNGYWAKYWVIPCTVSGAYGQEMTGIIVKTLDFPQL
FT                   QSSYFALSADVIAVGQKCGPPDFCICWIKPKMSRFTWNLVIRLYWYINGQPACATMSPQ
FT                   PLARAVKIEDPDVLQATSVFKCACVLSTSLTNEFRTEWPPEGSLFSHDDPTASFGDASG
FT                   DGAAVRRVRSTSEAAVGISGRGFDRLILRKNI"
FT   CDS_pept        join(459366..459503,459557..459907)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944689"
FT                   /orf_name="Pc24g02080"
FT                   /product="Putative uncharacterized protein Pc24g02080 "
FT                   /protein_id="CAP87116.1"
FT                   /db_xref="UniParc:UPI0001832D6B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWZ0"
FT                   /transl_table=1
FT                   /translation="MDHPTSPSPIDRPAKRQCRVSHAPEDEPKLENHPQQASNGTTIEP
FT                   KVPVRTRGTLTAEFIKVVNLNDSLATPALKLLDLYFCLWECYVVKSAEKIRLEEEQRQL
FT                   QASNDLLASDSDILLQLCNEQASVLWERKRAVQALCNGVVSALEASDLQAYSVDEPGP"
FT   CDS_pept        join(complement(461563..461679),complement(461113..461516),
FT                   complement(460967..461063))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944690"
FT                   /orf_name="Pc24g02090"
FT                   /product="Putative uncharacterized protein Pc24g02090 "
FT                   /protein_id="CAP87117.1"
FT                   /db_xref="UniParc:UPI0001832D6C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWZ1"
FT                   /transl_table=1
FT                   /translation="MDASNSSPDQEKGEQRPCELPNLSNKDNNVEPSDHVPPLASPSQH
FT                   EEETRHTLATEPFQPILKVLADLKRDDPKFAFPAARLVGLYRRLWESCVSKHIDGQKLE
FT                   QSNQNLKEAGTHLRKERDGLQFRHDKQLARLRFFEQALESSRERLTSLLDDWNYPYSPN
FT                   LAGLTDVAREENTTSGDAVQGKLHRMQSRLYIPEAFNKKGTK"
FT   CDS_pept        join(462490..462576,462751..462962,463010..463111,
FT                   463158..463313,463479..463815,463902..463928)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076631" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944691"
FT                   /orf_name="Pc24g02100"
FT                   /product="Putative uncharacterized protein Pc24g02100 "
FT                   /protein_id="CAP87118.1"
FT                   /db_xref="UniParc:UPI0001832D6D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWZ2"
FT                   /transl_table=1
FT                   /translation="MSLQIVAVKEDVGFNRPRLRNVSFNTSNQYTSWTSKPDSSCTARD
FT                   VVPSRFTAPFTPADRRYEIWISWSRRLCEEVSAIASWSTVAALVDHRFGVQLLTLRGTA
FT                   RSVDVRTQCTRARATASCGLFIPGLDHQKIEPLGAHQSGTDNPAPPSVQSHGLHTIPSP
FT                   VASNNAACPRWKIANEDSESTTGGTPSSTVKYTVASGLFRQIEDKTKVAADERAPSRLP
FT                   PSSPPPSHYCGVLNLWHRDTFIHHGSVMFIASGFVTRVYCLNKLSCASQGGFFEASADC
FT                   DELECDVAWLVTALQRVVRYDNSSN"
FT   CDS_pept        join(complement(464544..464668),complement(464253..464422),
FT                   complement(464115..464167),complement(463980..464030))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670870"
FT                   /orf_name="Pc24g02110"
FT                   /product="Putative uncharacterized protein Pc24g02110 "
FT                   /protein_id="CAP87119.1"
FT                   /db_xref="UniParc:UPI0001832D6E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWZ3"
FT                   /transl_table=1
FT                   /translation="MVFANSASAWIGNACIRTNRVHHNTFDSPHDAGSCMPEVILGWTC
FT                   ANSLIVCRGTLICQEARQNISIPVPFSSSGKTPNVIRRQRGSRIRYQQPTPLEDKSNDD
FT                   LIRRINREKEAEGSSSRQDICSRGIRLE"
FT   CDS_pept        join(complement(467160..467188),complement(466334..466484),
FT                   complement(466205..466296),complement(466081..466096))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944692"
FT                   /orf_name="Pc24g02120"
FT                   /product="Pc24g02120 protein"
FT                   /protein_id="CAP87120.1"
FT                   /db_xref="UniParc:UPI0001832D6F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWZ4"
FT                   /transl_table=1
FT                   /translation="MAVAATSPAIVDVSVDVSVDVSVDVSVDVSVDVSVDVSVDVSVDV
FT                   SVDVSVDVSVDVSVDRGGERGGEWSGGEKGGQRLDLAIGPCHPQIIMSYD"
FT   CDS_pept        join(470823..471288,471332..471642)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976810"
FT                   /orf_name="Pc24g02130"
FT                   /product="Putative uncharacterized protein Pc24g02130 "
FT                   /function="nucleic acid binding"
FT                   /function="protein dimerization activity"
FT                   /protein_id="CAP87121.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR008906"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001832D70"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWZ5"
FT                   /transl_table=1
FT                   /translation="MKTHLAKHNVFEKSNPEDLGEGSSVTKQYSIASMFRFRAERDINA
FT                   LLQYTSKPSLEQSMSKLNQDNKRQSLEARVLQKLQPQVIQHSDIDRYFGRYRACNKKRD
FT                   WLFAWRMHKDEYPRMVAAARDYLAIPAAEVALERLFSRGRDLVGLCRHSLKVRRAPSEN
FT                   SWNVMLIFPTSCCSDSTNPVIFSTNKKRYCIRDRVKCLRITNIRNEYGYIRYSYSCSLF
FT                   VPTPKVCLNYVTFSIRLDYGLMNGASKVKVSRGITN"
FT   CDS_pept        join(complement(473382..473640),complement(472613..473310))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18127933"
FT                   /orf_name="Pc24g02140"
FT                   /product="Pc24g02140 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP87122.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001832D71"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWZ6"
FT                   /transl_table=1
FT                   /translation="MTLSQGTTKLLRLQAFWQPTMQPTLHMRRRLATDAGIKQTLPKEP
FT                   LQKTDQRFQAFQLRGKVFAVTGGGRGLGLTMAEALVEAGGEVHCLDRLPEPHEEFYTAQ
FT                   ARANPQFGGSLHYHSLDVRDRESTNQIMSTIANGKNRLDGLVAAAGVNHIGSGINHSAA
FT                   DIERIISINYTGAFTSATAAATQMLNKQSRGSILLISSMSGMIANKGMKSSIYNSSKAA
FT                   VIQLARSFAMEWTDIDTEGRGGIRVNCLCPGHIMTPMAKMVMDGTPGTKEIWESENMMG
FT                   RLARPEEFRGIALLLMSNASSFMTGSTIVADGGHTAW"
FT   CDS_pept        join(474260..474458,474644..474729,474850..474952,
FT                   475010..475342,475546..475637)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127934"
FT                   /orf_name="Pc24g02150"
FT                   /product="Pc24g02150 protein"
FT                   /protein_id="CAP87123.1"
FT                   /db_xref="UniParc:UPI0001832D72"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWZ7"
FT                   /transl_table=1
FT                   /translation="MELGELLHRMFQDCVNVHRELSLILMAVLPGPYVRIAVEAGDADV
FT                   FRFSAGAQPCIILISSNNIPNGWGFFFADLLLRNYAIIRSRHNIQEGGKGGAKPMFLLC
FT                   AHNQSMTWFKKKGFRLGAEFAARLSDVIAPKSENISSIPLNKTLTIPQKIITATELLDN
FT                   VGDTVDTIATNLGANRLDRRSYRKYLCDYADRAASDAQLINASREATLNVPTWRASSLR
FT                   PYGVVMLACGKTTIPSQLPNGKIPFLHGGVKYRNLSVSVESSCGSPEV"
FT   CDS_pept        complement(<475867..>476601)
FT                   /pseudo
FT                   /gene_family="HOG000078713" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(<476812..>477159)
FT                   /pseudo
FT                   /gene_family="HOG000184691" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(479188..479333,479507..479738,479884..479934,
FT                   480003..480133,480608..480770,481060..481119)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127935"
FT                   /orf_name="Pc24g02180"
FT                   /product="Putative uncharacterized protein Pc24g02180 "
FT                   /protein_id="CAP87126.1"
FT                   /db_xref="UniParc:UPI0001832D73"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWZ8"
FT                   /transl_table=1
FT                   /translation="MAPQQRAGTSPWCWGPVFEYSKSIRRRKDLRNISVICFIFRIIAI
FT                   GYIKDVSVVVRVDVSVEVSVEVSVEVSVEVSVEVSVDVCVDVCGNVCGDVCGDERGGEW
FT                   SGGEGRWSPPRSCHRSMPPSDYIYCFYYKSNGETSRQYNSHHYFIYFRSHSQVSFRPDS
FT                   TVHRFDKLGSIHLARYVSLVLWDLRSQSFSRRLQVTQAYSNVGWLYPRTIASVKVDLQQ
FT                   RKPAKNIRSAPTFGSRPNISTHGRTESDESLAGAACAR"
FT   CDS_pept        join(complement(482191..482362),complement(481256..481614))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127936"
FT                   /orf_name="Pc24g02190"
FT                   /product="Putative uncharacterized protein Pc24g02190 "
FT                   /protein_id="CAP87127.1"
FT                   /db_xref="UniParc:UPI0001832D74"
FT                   /db_xref="UniProtKB/TrEMBL:B6HWZ9"
FT                   /transl_table=1
FT                   /translation="MTVQFIITGGFITRLWLSEVARCTQRGFFEATAGSCDDLDTTSCQ
FT                   HGMNGDHIDEDNCAEKCRCLVLHNDRGALLSLLAMLLVQIRVQGEGEENPFVSDLQANF
FT                   GTSYEPRRQGRLYRGTAEPTKEPKIPSNKVPSDPTPHCSGVRDIRTSGNEPRGNIRSYQ
FT                   VGIRNVSFGTGVW"
FT   CDS_pept        join(complement(483848..484515),complement(483649..483793))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944693"
FT                   /orf_name="Pc24g02200"
FT                   /product="Pc24g02200 protein"
FT                   /protein_id="CAP87128.1"
FT                   /db_xref="InterPro:IPR007604"
FT                   /db_xref="UniParc:UPI0001832D75"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX00"
FT                   /transl_table=1
FT                   /translation="MRKPDDEFINRFRERFGDLLLSCQGERGWRGVQFDVGDPMLPTSY
FT                   AIGNEPIDVAPTDEANTGQTLWRESGYPKHQSFHAPNSFSPMVNVKKYETFDDRNLSRP
FT                   GTDIYNNVEDIRSPSVQWNTNISPILDKPIQPIPQSFWNGPGCFTPLAESQGCLYDNTY
FT                   FGQADGISTLIHHDFEYATLGGVDQDIFTCCCSEKSDRKFDLATPKAQVNENWPYGHRE
FT                   KFRYNVTLQAPTAMHEHGNEKPVTYLNKGQPYSLTVADSMEYFPQSLN"
FT   CDS_pept        join(complement(485444..485520),complement(485188..485352),
FT                   complement(484999..485067),complement(484724..484856))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976811"
FT                   /orf_name="Pc24g02210"
FT                   /product="Putative uncharacterized protein Pc24g02210 "
FT                   /protein_id="CAP87129.1"
FT                   /db_xref="UniParc:UPI0001832D76"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX01"
FT                   /transl_table=1
FT                   /translation="MDLGCHSVDWLQRLLVMVVLVLFYCRGAPVPASKSLVRRADSDVV
FT                   YRDRTFFFCMTLAEIFGYFPVCTVSLATGIPGYLQTLDAGRLQRPKYVAIDGYLPTGKS
FT                   TALAPKSGPTPHTLAPYADFYWPGYKSDIESIVAKDTDVEEYF"
FT   mat_peptide     join(complement(485188..485348),complement(484999..485067),
FT                   complement(484727..484856))
FT                   /db_xref="UniProtKB/TrEMBL:B6HX01 "
FT   sig_peptide     join(complement(485444..485520),complement(485349..485352))
FT                   /db_xref="UniProtKB/TrEMBL:B6HX01 "
FT   CDS_pept        join(486492..486670,486871..487468,487687..487728)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976812"
FT                   /orf_name="Pc24g02220"
FT                   /product="Pc24g02220 protein"
FT                   /protein_id="CAP87130.1"
FT                   /db_xref="UniParc:UPI0001832D77"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX02"
FT                   /transl_table=1
FT                   /translation="MSVSVILSQLEALVTKMELVGSRLCNKRIRPTADQLNDFQNLHTR
FT                   FKATLANFDTGIQKLYPSKILASSESTSLEKHHVSLAFPNQFVLRSPHVIAAGYKPISH
FT                   TNACPSLMTYVRDKGVSFQGTGATDKQLEVSLVVEIDNGSLPSDKILNDWGPNMLSCGE
FT                   RPGRGSDAFDTMTRRIRNARFADVHEKDYKSPMRPWPRNQEMKGAGMVNFQHSMNEIRG
FT                   LVYVVAHKVWPPATLESPCVCREAAKRAQRRFHICIKGDSKVTHAKTIKP"
FT   CDS_pept        join(complement(489914..489995),complement(489469..489550),
FT                   complement(489114..489308),complement(488776..488921),
FT                   complement(488456..488552),complement(487977..488340))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944694"
FT                   /orf_name="Pc24g02230"
FT                   /product="Putative uncharacterized protein Pc24g02230 "
FT                   /protein_id="CAP87131.1"
FT                   /db_xref="UniParc:UPI0001832D78"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX03"
FT                   /transl_table=1
FT                   /translation="MPPKARQYARNPTEQEERFYLPYPLLKNILSLFDSAVLKSLLISP
FT                   LMSRSRKSRELVCDGVSQRHQYEGGLEPSEEILGIGRSYKNAFGVVMCEVLVIRDRNLD
FT                   WKTVDSTQLAGHDEFRLWGMSPVIQTVHKHWTRQYKSSAMVELMKGLKYCNTLRDNQPI
FT                   SRDHAHQYSGIDLFGALPGTVPRYLKRTQSAVRPVRQHATQQPLKRTLPTSSYVSTGSH
FT                   SPTQIHVEKPCSIYSRTSLEDYALAMLAYTQSQVSSLVDLDENHGTSSRSRSSISSGTS
FT                   EGSDLSAKSALPHQGPGLSNSAEAEEAGRQTANSAGCIQA"
FT   CDS_pept        complement(490239..490544)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(492981..493017),complement(492712..492918),
FT                   complement(492521..492646),complement(492241..492361),
FT                   complement(491639..492176),complement(491138..491581))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000182178" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944695"
FT                   /orf_name="Pc24g02250"
FT                   /product="Pc24g02250 protein"
FT                   /function="solute:hydrogen antiporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP87133.1"
FT                   /db_xref="GO:0015299"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniParc:UPI0001832D79"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX04"
FT                   /transl_table=1
FT                   /translation="MANSFLPYHEPGTIDILIVVSFFFFLSLARWVSATAIQAGIIGQI
FT                   AVGIIYGVPLANILEHHWQETFVTLGYVGLILIIFEGGLGARVDLLKQNFTLSMIGAAT
FT                   GVLFPIGLSYLLLYLGFGYGTTFAVISSTSDSVNLAETRVGSVLVSAAVIDDVVGLVML
FT                   SVIGDLGKLSGGGDSVNLGWLIGRPIVASIGMAAVTPIVTKWVFAPFFRKFIEHRFARY
FT                   DHISNIILMILVLSAFIAIAGFTGTSVLFGAFLAGVFLTYIPSKHPEGPFVVLSREEGE
FT                   READKSPTFIHTFEKYLLGPQQYLMEPLFFSSIGFAIPFLKLWTGERIWKGIVYTLLMT
FT                   FAKYIVGIWVPIWQLASGGKSHKESHGEQKSQGQLKTEVNNPSDEEQSDQEKGKMWKRA
FT                   WLAATLLGSAMVARGEIGLLIIEIGHNETPYVSDEGFYTGVWAILLNTIIGPVSVGLLV
FT                   RFYAHELKGGDWGVQRTPLAISGHGISGHGAV"
FT   mat_peptide     join(complement(492712..492853),complement(492521..492646),
FT                   complement(492241..492361),complement(491639..492176),
FT                   complement(491141..491581))
FT                   /db_xref="UniProtKB/TrEMBL:B6HX04 "
FT   sig_peptide     join(complement(492981..493017),complement(492854..492918))
FT                   /db_xref="UniProtKB/TrEMBL:B6HX04 "
FT   CDS_pept        join(493644..494001,494122..494744)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976813"
FT                   /orf_name="Pc24g02260"
FT                   /product="Pc24g02260 protein"
FT                   /protein_id="CAP87134.1"
FT                   /db_xref="UniParc:UPI0001832D7A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX05"
FT                   /transl_table=1
FT                   /translation="MLVVIWNTDIRKLSYQTPVRLIFQLLSHPRDPSSSRFFQDGTSKV
FT                   PKLPGDQALTAKDFPRRGQSCEARSHPSVSMQWNQNDIATNKQGQPETTTVSLTVSRYM
FT                   AGGTSIRSSWLSQPVISSSYKFRSAPTNRRVRTTVLQVLYSLLGVPMTNIPFCAQNLFL
FT                   QAIQRHLEFDAFQFVHKWLLEESLMVGWACPEELELNRLFRFLVEHRDKIRCSSCRQAA
FT                   TTIQKWQRLVSGIRHAAVHRLLQDRESLLRMTRVAIEFSLCIGGLSSVEKLRRLLKFLE
FT                   DRLPNSERRRTQSSAPSFFAKTAPRRSERPISVAAETLPESSSPD"
FT   CDS_pept        <495597..>496421
FT                   /pseudo
FT                   /gene_family="HOG000213044" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(497729..497981,498172..498315,498399..498431,
FT                   498492..498501,498537..498600,498875..498962,4
FT                   99020..499462)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127937"
FT                   /orf_name="Pc24g02280"
FT                   /product="Putative uncharacterized protein Pc24g02280 "
FT                   /protein_id="CAP87136.1"
FT                   /db_xref="UniParc:UPI0001832D7B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX07"
FT                   /transl_table=1
FT                   /translation="MSPRSEVAWEEWEEKNLLPWLDAHRALPWKARSHAYYEQYQVDRS
FT                   VESLRGKMYHILRKQRRTGAGSPKHAAHRNRAEACRSVGRRAMPLLRHSRHEETRSSSQ
FT                   IWDYVHRVCAVRKLRYRWTELSSYQQFVVRLQDDEYRYDLAKDFPGIVEHDRDPSISRR
FT                   TPETKVPQVGRPTARNMSGSQSVSRVSAKTGDILHWGPKIGPMKSQYRVQREYNHHGKA
FT                   WCRGKYIALRTFYRLDRQRAACHLTGELLQPGNTTTDRAVAYHSVAKAYVIFQILTVPA
FT                   VPPKQQCPVPTDIDSRQHWARESCLDRFKSFQFLLQATSRTPLTYSPVGRRWDLRRRKV
FT                   PASV"
FT   CDS_pept        join(complement(500080..500217),complement(499702..500025))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944696"
FT                   /orf_name="Pc24g02290"
FT                   /product="Putative uncharacterized protein Pc24g02290 "
FT                   /protein_id="CAP87137.1"
FT                   /db_xref="UniParc:UPI0001832D7C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX08"
FT                   /transl_table=1
FT                   /translation="MDHPTSPSPIDQPAKRQCRVSHAPEDEPKLENHPQQGSNGTTIEP
FT                   KVPVRTRGTLTAEFMKVVHLNDSLATSVLKLLDMYFCLWECYVVKSAQKIRLEEQRQLQ
FT                   ASNEWLESDSDILLQLCNEQALILWDRKRAVHALCNGVVSALQASDTQG"
FT   CDS_pept        join(complement(502326..502328),complement(500669..502273))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944697"
FT                   /orf_name="Pc24g02300"
FT                   /product="Pc24g02300 protein"
FT                   /protein_id="CAP87138.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832DFC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX09"
FT                   /transl_table=1
FT                   /translation="MPNIRDLPNELLLCIVSHLDGSALFALAKSCKDLDFRLQPSTWKY
FT                   NIRFQNSNLLHLAVKYDNVGLADALLQHNANINAFYRGKAPLMRALKYSSAAVRELLLS
FT                   HPDLDINIQNQARDSALSYAIHYGSSSIVKSVLEHRAASVDVKHKHGRTALHLAVFAGR
FT                   IGFVQLLLLSGSDPNLEDDSGQSAWSWACRINRPVMKTMFINGPDCEVYLGARNAQDSE
FT                   LPLHEAVLHGSIDAVKWRLRQKGLELGIQNRNGYTPLHLAVQSRRLEVVDLILGHPLAN
FT                   VNCKDKDGNTPLWLSTYSSCDEITERLLAEKDIDVNFVGGRGRLEAPSTSLHHAATRLD
FT                   TILLRRLLAVPGIALNLCVAGHSPISVAAYHGHVKTVACLLSMEGVEINGRGLIDPPIC
FT                   RAVSHGHLDVVRLLVQQGARLNVNESTVATHDTALCIAARGGDLEMVRELLRHGRIDVN
FT                   LRNQWFEDPLVLAVRGGHFSIVDALVGNPRLTHFSLRRSLDLAKDYCIQKAIRSRICDD
FT                   NTTKKLLERSPRRIFDRL"
FT   CDS_pept        join(503062..503178,503245..503834,503887..504202)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944698"
FT                   /orf_name="Pc24g02310"
FT                   /product="Putative uncharacterized protein Pc24g02310 "
FT                   /protein_id="CAP87139.1"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001832DFD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX10"
FT                   /transl_table=1
FT                   /translation="MSWNPFAVCGIPHGGPASCCGVTKNGQPCKNSVKFQDTKLCDIAR
FT                   VFLCARWHRQRQADQVGQRWYEAAIRNQARVPHGSRVAAPSIAHPGQRQMSSVSRSRPA
FT                   SGNTDRSPHGLRQDPPVPLSTNPEPVQPFNPFVTSTMLRTNSVPWHVSLAQPAILTSVA
FT                   NVWAGVQSLTLKDLTLSDQVDDIHCVFCLAEDEDLANESVILRCQCKALSHLACAEEWL
FT                   EKRSTGFGTSCCVCRNEGPLDALIRPLRVQSSDAETRHIHTATESSAERELATIRNSSP
FT                   NDPSRSQLRQRSVGPQVGSVEQSVENGPRRSARLGAHLPRGPSTSAPPRRSARLNSTRR
FT                   "
FT   CDS_pept        join(507641..507722,507785..508392)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076627" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944699"
FT                   /orf_name="Pc24g02320"
FT                   /product="Putative uncharacterized protein Pc24g02320 "
FT                   /protein_id="CAP87140.1"
FT                   /db_xref="UniParc:UPI0001832DFE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX11"
FT                   /transl_table=1
FT                   /translation="MDHNLSQVPKKSNTPDTEGHNGRTGKTGNESANNFRRVVGLFIHG
FT                   NRSHTSQVLQPPVGQSTGPVATEAVTSVGTSLGSSRASTLSPSVIRAENQDLPPLNVKK
FT                   RAAESSTLPRKRRRHSYSNSQIPGHPQLAYQKRPPCLIKISRKMVNDTIQYLQTLSDRI
FT                   LICDTISPREWVTMHLATQLLQSRYEEIIVRKEMETDAVPDFDSPPTQPEEKCRKCAAS
FT                   DEERLYD"
FT   CDS_pept        join(509129..509194,509367..509601,509831..510042,
FT                   510073..510114)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127938"
FT                   /orf_name="Pc24g02330"
FT                   /product="Putative uncharacterized protein Pc24g02330 "
FT                   /protein_id="CAP87141.1"
FT                   /db_xref="UniParc:UPI0001832DFF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX12"
FT                   /transl_table=1
FT                   /translation="MVVAASTRCWSHGSCERSLHGHLPSLYFWRVVGHRKPRICPWTSF
FT                   PSAVKGNKILRKLSYVEQCGHLSIRMESLISSRFMFVMAVQLIVSWKKIHVPSTVSQSQ
FT                   LPISMSAPTTRESHTAATTKLTGPHRRDRLKVVTGPPKSLCLPHLSGLENIASVLIDFE
FT                   LELHQTPLIFSMGVKYTCCWC"
FT   CDS_pept        511302..511847
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944700"
FT                   /orf_name="Pc24g02340"
FT                   /product="Pc24g02340 protein"
FT                   /protein_id="CAP87142.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832E00"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX13"
FT                   /transl_table=1
FT                   /translation="MTGTKPTPGCSDIGPEFDHLKAVRAIYLNAKLVAFVENAHSSLQS
FT                   RGRFKQRDCYKRSLLHYAAMGNCTNLLLYLLQSKPDIDSRDQWGRTALSWAAEYGSLAV
FT                   ANILLEQGANLNALDYEGGTPLTWLIHAGNPEMINLAATEAYLRERGAKEVKLRGIKSA
FT                   WVWVLSYSHLLRYIRPRI"
FT   CDS_pept        513306..>514100
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944701"
FT                   /orf_name="Pc24g02350"
FT                   /product="Pc24g02350 protein"
FT                   /protein_id="CAP87143.1"
FT                   /db_xref="UniParc:UPI0001832E01"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX14"
FT                   /transl_table=1
FT                   /translation="MSGNSPPNYKALFLKAEEERKRAEEERKRAEERERQAEERQRQAE
FT                   ERERQQRERNRPTTFPEFIRLCHDLLWRPLRAQTPSRSTTGKIPAPIGKHCPLRLRPWT
FT                   DCEDKQREIYESVCRYLQPTEGDARELFTSLVALEDHGRRFARRPISSEQDLETYERLA
FT                   VEDHVHDIVAELCKIPEAREEFRLGNGIWFDNHPNALDDDNEVDASQPSTTKPSKPDQF
FT                   CIYQRDGNRRTLLTTVEYKPPHKLSAANLRLGLRPMDFWREVV"
FT   gap             514102..514201
FT                   /estimated_length="unknown"
FT   CDS_pept        <514203..515117
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234740" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944702"
FT                   /orf_name="Pc24g02360"
FT                   /product="Pc24g02360 protein"
FT                   /function="ATP binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="lipopolysaccharide biosynthetic
FT                   process"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP87144.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009103"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="InterPro:IPR010440"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015730"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0001832E02"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX15"
FT                   /transl_table=1
FT                   /translation="GPRVTTRAAASCAPLSGPHHHESSSDSEADPTSSAGRKRGFSQVT
FT                   SSPPTQRSAPRADRQGKQSGQSRSHDAPYCTQKCLLGLQQGGTLDPKCPNTELHMLGGR
FT                   VDRHPIGAADLVKRFKMQLDQDLDHNCTPIGPCGSSGAPFKITCAIFGYTVVGKGTTSK
FT                   LWGEVSREAEVYRVLQRAQGSAVPVFLGAINLAQTYFLHGAGRIRHMLLMGWGGESVGH
FT                   TTPDKTTQRAICRSVKEIRRFGVVHQDLRPENILWNAELQRALIIDFHLCTLDRRPLDR
FT                   RPGTLKRLRYGSAERHSKRVRVV"
FT   CDS_pept        join(complement(515482..515700),complement(515338..515409))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048617" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127939"
FT                   /orf_name="Pc24g02370"
FT                   /product="Pc24g02370 protein"
FT                   /protein_id="CAP87145.1"
FT                   /db_xref="UniParc:UPI0001832E03"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX16"
FT                   /transl_table=1
FT                   /translation="MAAEQKTIRTRHSNSLKSIRQKQARRRNSLLRKSFEYCRECDADV
FT                   FMMIRLKRNGNILFFNSCAQWPLSRQQLITWHDMATKYAGGEGVSADEPTA"
FT   CDS_pept        join(complement(519515..519529),complement(518299..519459),
FT                   complement(517488..518241),complement(517127..517437))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670871"
FT                   /orf_name="Pc24g02380"
FT                   /product="Pc24g02380 protein"
FT                   /function="DNA binding"
FT                   /function="protein dimerization activity"
FT                   /protein_id="CAP87146.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR003656"
FT                   /db_xref="InterPro:IPR008906"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001832E04"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX17"
FT                   /transl_table=1
FT                   /translation="MSLSSLFNHPSGIVTLEDRPRSPPAKLTRFAPGRRDWVLYDSDQE
FT                   KEFLSWWLETEYGQQLTKNGKYKFRWSAESRSSKVWKHFDQVAELRSGRPKVVCRSCLT
FT                   PLNHPHHPRHKSHGTSTMGKHLKSNSCRRSKEEVSVSAVTPGPIQESRASFSPMRSRFT
FT                   KAQLEGHLLRTITSANLSFEVTEEPTFRELLDLVYSGPQALEVPSSKKLRHYMHDIVTT
FT                   YQESQLQDLPGDSKVSIALCCWKGPFGQDFMAITAYYFDKEWSYREVLLGFELIRRSET
FT                   GNDPCDQILGLIQEKGLLHRIFSVTVDYRVEENLMLSLREKLTSSGGISSWQCFVGVPG
FT                   TVQAIQLCLRRYVENITSSPEGERIENVREVSHANGWTDPSDGDEISHVLGKIRSFARF
FT                   VNETPRKRDEFLCLQPASTRVLPLDDAKSRWNSVFLMLNRAGRLRKYIDQYCQESGNLQ
FT                   YKLTSTDWRKVDYLVQLIIPFIQFTTALLASREATVHKVCFVFKILMEHLDESTRILRR
FT                   KSAPWKRKLSEASLIMKMELGEVYEKTFQNFGVMYGPGTFVAPQYKVSAFHEATSSQGL
FT                   GQPERYIEYLRIFHLQYRPQMPTSLSCVNGLSCSPQLLGLDRLLHPLAGLAGSSRCGQD
FT                   EVDQYLREGVLNVSPCAYWKDHQRKWPVLTRLARDLLSIPATGAGTERLLTVAQNICRT
FT                   RGGSLDESTMRDFVMYAYSEGSESGKQSISRVERDMASDEEWEEVRSRGRKA"
FT   CDS_pept        join(519899..519918,520333..520525,520575..520687,
FT                   520731..520765,520797..520882,520938..521099)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944703"
FT                   /orf_name="Pc24g02390"
FT                   /product="Putative uncharacterized protein Pc24g02390 "
FT                   /protein_id="CAP87147.1"
FT                   /db_xref="UniParc:UPI0001832E05"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX18"
FT                   /transl_table=1
FT                   /translation="MSYSIAIEPSESEEQESISEHSEEEDISETSEDRAFVVSDGDQSP
FT                   YSNRSSESSNYSQHCHHRHDDDFSNPVGHKIPIXTIAKRVIHQNDSPVVQYLVLWRSWE
FT                   QERPHTEAVHIINLPATMSSLFSRKPYDFSVFPNQIWPYRHTRETVSSHCLHVSGSTTS
FT                   KGRLVPTSTXSARSNNHFIRKEVTNPRRSNRKLSVEASH"
FT   CDS_pept        join(521796..522275,522380..522673,522882..522937,
FT                   523241..523808,523902..524012)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944704"
FT                   /orf_name="Pc24g02400"
FT                   /product="Putative uncharacterized protein Pc24g02400 "
FT                   /protein_id="CAP87148.1"
FT                   /db_xref="UniParc:UPI0001832E06"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX19"
FT                   /transl_table=1
FT                   /translation="MAMCNYAERSREHISRVGLSSKNPVTKAPFIYSKTEELVWKWEQS
FT                   KLCGQSINIRLPSTMLPQGRPPNKADSREEFISIENGVVQVFPQAQLTNLEHHDYQIGI
FT                   LETAQSGNLKIILANTKKRKQAKGLRASLFHFQDCVLEKVPPYFSSWSTEFWVSDSSQX
FT                   XGPLFNTLISKWNASAASFEHSNGFIWIYSXVDPANFXITTGESDSSTNHSVYXLLEPM
FT                   SGXSWLVRAKLTFRLETXSREKAAILAELLEVSHVQEDQRNAWDDRSLANSPHLDFTLS
FT                   NSVAVLLRPIRYLHSGGLFEEFLYPRAEEKPGKHDGQQRVYLVCILFRAFLAVADRGVP
FT                   GIPVTKIRCDSHLHRWATKIQPIDVPEDHVQHSIVWQLQMFRERETMITPSEQDQDPPA
FT                   EVFLYICDYLCRKSQYHQRPLWNNRPRDRAGSRMVDGRSVDSAKANPLLYYLLVYTGRM
FT                   TPIRVPSWIDQNLRIDLFGAPPGIFPRYLKRTYSVEIPDRKQYG"
FT   CDS_pept        join(524570..525094,525175..525343,525605..525960)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944705"
FT                   /orf_name="Pc24g02410"
FT                   /product="Pc24g02410 protein"
FT                   /protein_id="CAP87149.1"
FT                   /db_xref="UniParc:UPI0001832E07"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX20"
FT                   /transl_table=1
FT                   /translation="MSRPVSKFAEWLARASIQDTFGLCGLLALVCWICCSLGRRFRHLP
FT                   LRLQQVSWRSFFQAPTPGVLQWLDIPTYLQGGVLTALVIANTIVISLHAPTWADVQRRA
FT                   GCLAVTHLVPLCSGFSFSLPAHVYYVERDTFYWAHRWLGRICVLHCLLHGSVLGANARN
FT                   TSHGARLAIPLMAGCSLVSILPWTLAAILRRWPQLGLKVHHMLALTAIGALFYHLIDRV
FT                   SSYRWVLLGGAQTTRTLRIVTRPRPGVTGRIAQAADHATYSTIHFPVCVLGPYGHPPNP
FT                   GQYGTVVFVLEDIGLFRALPFIRHLVKESRSRRNTVRRLEVLWQVRLKHFSGFPHSSRM
FT                   LCGVVCLPE"
FT   sig_peptide     524570..524683
FT                   /db_xref="UniProtKB/TrEMBL:B6HX20 "
FT   mat_peptide     join(524684..525094,525175..525343,525605..525957)
FT                   /db_xref="UniProtKB/TrEMBL:B6HX20 "
FT   CDS_pept        join(527338..527448,527525..528676,528714..529491,
FT                   529542..530164)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127940"
FT                   /orf_name="Pc24g02420"
FT                   /product="Pc24g02420 protein"
FT                   /function="DNA binding"
FT                   /function="protein dimerization activity"
FT                   /protein_id="CAP87150.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR003656"
FT                   /db_xref="InterPro:IPR008906"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001832E08"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX21"
FT                   /transl_table=1
FT                   /translation="MASSSSSSSRSMHQAFNPPLSIEPSSDVFLDSDIQSSPFTGSRES
FT                   YDITSRRPPATLKRVGPQRRKNWILYQSALEREFLGWWEETEYGQKLNGDGQSQIKWST
FT                   ESRHADVWKHFDQVADIDSGLPRVFCQACLTLLDHPQYKKNGTSAMSRHQKSNSCRKGK
FT                   KRGSHQALISNSLQNHSLRESLSGHRVTAFQLEEQLLKTITCLRLPFQTVENPVFQRLL
FT                   NLLYSGPGTLELPSAKTLRRRLRDAVTVQQESQLLDLPEDAKVSLALDCWTSPFQQAFM
FT                   AITVYFIDKAWNYREMLLGFEPLHGPHTGINLSDVLHQLLKERKLLGRIFSVTTDNATN
FT                   NETLIRALQEKLISTGAIGSRESIVRVPCMAHVIQLCLKQLLGHIRAAPKNKEVKSFWS
FT                   DTQAIGLRDSANHGDVAHALAKTEYLSRQIRSFAMFVNASPQRRDAFLCLQSGGTRLFP
FT                   LHDVQTRWNSTFLMLRRARRLRNIIDKYCCDHEYSQFKVTDVEWRQIDYLVHLTKPFFR
FT                   FTMALMKTKDVTIHSVFLVYRKLLEHIERSNRKLRKKTTPWKKDMYTALLAARQKLKEY
FT                   YEKTYRDHGFLYGTGTLLAPQYKLSAFDDREYSTCHEDTSKRYCEYLRTCFTQYQQQNP
FT                   ELLLRTVHRASALQSSELDRLLEPVDDFMLHEGTEHDEVDQYLREANVPVPPRLYWREH
FT                   EREFPVLSRLARDLLSVPATGAGVERLFNSARDICHYRRGSLHEATIQDLMMYMCSEKF
FT                   TLEGQQLTLLEKPMEGESQEALEEDEALRANEEDAAPISDDEEVEETEDVESNIEPEAL
FT                   YQVEGILAEAQQPSMHNQTYDVEGDEEEMEEGEVDEDDEADLLPPPITQLGDRSQKRSS
FT                   GRVTMPSSRLQGYEIY"
FT   CDS_pept        join(531045..531236,531296..531580)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944706"
FT                   /orf_name="Pc24g02430"
FT                   /product="Pc24g02430 protein"
FT                   /protein_id="CAP87151.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832E09"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX22"
FT                   /transl_table=1
FT                   /translation="MKPTTGCSDTGPEFDRLKTIKEVSLNADLVAFVEKAHSSLQPEDA
FT                   LSNGIVTRDLSFITLPWGTWGRTPLSWTAEYGSLAVAKILLEQGANANALDYEGGSPLT
FT                   WLIHAGNPEITSLEATEAYLRERGAKEARLSGIKLAWIWVLCYSRLLRYIRPRI"
FT   CDS_pept        join(complement(532735..533188),complement(532479..532534),
FT                   complement(532239..532309),complement(532132..532204))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944707"
FT                   /orf_name="Pc24g02440"
FT                   /product="Pc24g02440 protein"
FT                   /protein_id="CAP87152.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832E0A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX23"
FT                   /transl_table=1
FT                   /translation="MAIPPRSMVVIDGEFQRLKGIREICFDEDIITFLQDAQATLKYKG
FT                   IYNQRGPSKRSLIHYAARGDCAELILYLLQDGTAKDDLDQNKRTPLSWVAQYSALRAVK
FT                   ILLDNGAEINSMDDMHTTPLSWLIQAGRGPNQAATIDYLRRNGATRRAIKPPTSNPLNT
FT                   NASQQVKPIQKGLEKTVVYLINAKSDGELVELALKLQNILPQSSDLVSDTRSQP"
FT   CDS_pept        join(533459..533502,533588..533742,533834..534246)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944708"
FT                   /orf_name="Pc24g02450"
FT                   /product="Putative uncharacterized protein Pc24g02450 "
FT                   /protein_id="CAP87153.1"
FT                   /db_xref="UniParc:UPI0001832E0B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX24"
FT                   /transl_table=1
FT                   /translation="MEQVTEGWQSEFNSIVSIKPDEQHNWSDIEVPAMAWSLYISVGLN
FT                   EGKSRGQFSSHWTSVVPDSRARKICRIFLAKIRPYRIQCILLVASWFRRLKFMRGYNEI
FT                   QQDSVRTNDGQSTQDPSITVCEDFGISLAGLPSSIAPKSLETNFLVTITPDTNQTPMQS
FT                   VNGLSVENQENLQRQPQSEFGRLHETQHRANILALPTELL"
FT   gap             534431..534530
FT                   /estimated_length="unknown"
FT   CDS_pept        join(534547..534687,534873..534969,535053..535214,
FT                   535303..535406)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944709"
FT                   /orf_name="Pc24g02460"
FT                   /product="Putative uncharacterized protein Pc24g02460 "
FT                   /protein_id="CAP87154.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832E0C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX25"
FT                   /transl_table=1
FT                   /translation="MERFLGILVELFEDSHWAKEQLRNIILVSARRDQPTVHSCVELGL
FT                   EENIPLDYAITNSSSTIVNMLISAGARINDTDRLGHKQFQPLGPGMHNDWWKPKEEDPV
FT                   AAYMSPCYPAATEQSTLARIKGLRDLSRTVLLATLTNNFNSPSYEPRVNISFCHISREH
FT                   DETE"
FT   CDS_pept        join(complement(537273..537341),complement(536625..537218))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823659"
FT                   /orf_name="Pc24g02470"
FT                   /product="Pc24g02470 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP87155.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003577"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="UniParc:UPI0001832E0D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX26"
FT                   /transl_table=1
FT                   /translation="MTDKVTLVVVGEADVGKSALAIRLCLDKFAEGLGATLDDSYRTQV
FT                   VVDNRPCILEIMDTAGDGTDAALHEDHIRDGEAFIIAYSVTSRASFSHVRAYYNQIKNV
FT                   KHDMSIENTLQQSPSHRPCRSPIVLVGTKKDLRSQREVSAREGRILAQSLDCWFYETSA
FT                   KHNAGVEKTFKDTIRCFRQLNSPSLLTQAWKGSNETTGRFWGTERQKEHNSRWCIVL"
FT   CDS_pept        join(complement(539235..539353),complement(538400..539135))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944710"
FT                   /orf_name="Pc24g02480"
FT                   /product="Pc24g02480 protein"
FT                   /protein_id="CAP87156.1"
FT                   /db_xref="UniParc:UPI0001832E0E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX27"
FT                   /transl_table=1
FT                   /translation="MPFLTWDMALHPKPIWTLYSFPMSMREICCYDSVREAIFRPENNT
FT                   RPSTSSYVDHPIAKVRKEHGDSEQPARAQNGALACPFLHWMLLKFTHPVHLGILLDSSM
FT                   RQTWIDISARLSGEIPLPCEAFAPNTDADVLLHSRNIFRVGGNVTMPLGKCHVMASNGN
FT                   LIPITAQKLTVSAVENLGGKPVEIALATPQKLLTRSTSGRREDNAENNQLPNTLPIVKS
FT                   QQVRSNNRGMVNLSFFWGRLQFPRAPQEKDAAVHLQETLRVRVQVIATLSTGAEAPVSE
FT                   IFS"
FT   CDS_pept        complement(540880..541296)
FT                   /pseudo
FT                   /gene_family="HOG000167895" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(542589..542643),complement(541986..542290))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944711"
FT                   /orf_name="Pc24g02500"
FT                   /product="Putative uncharacterized protein Pc24g02500 "
FT                   /protein_id="CAP87158.1"
FT                   /db_xref="UniParc:UPI0001832E0F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX28"
FT                   /transl_table=1
FT                   /translation="MPVAVPVAKILVPPSNTHDNPGLIRWCGLVPGLHQPHITTLCHTF
FT                   PHNITTHRWAQGYPAPNLQYAPNYDVLVALLAVLSLLILVLAKIRPNASVIAPAKTPIV
FT                   NPPPSAGYHTWPYQG"
FT   CDS_pept        545881..547563
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   gap             548540..548639
FT                   /estimated_length="unknown"
FT   CDS_pept        549189..550835
FT                   /pseudo
FT                   /gene_family="HOG000078715" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(551087..551089,551142..552746)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823660"
FT                   /orf_name="Pc24g02530"
FT                   /product="Pc24g02530 protein"
FT                   /protein_id="CAP87161.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832EA4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX29"
FT                   /transl_table=1
FT                   /translation="MPNIRELPNELLLWIVSHLDGSALFALAGSCKVFDFRLQPSIWKY
FT                   NIRFQNSNLLHLAVKYDNVGLAEALLQHNANINAFYRGKTPLMRALQYSSAAVRELLLN
FT                   RREFDINIQNQARHSALSYAIHYGNFSAVKSVLDQPNVRVDVKHRYGRTALHLAVFAGK
FT                   IGFVHLLLSSGSDPDLHDDSGHSPWDWAHRFNRPVMEMVFSNDPKSKVFLGTPSSQDAE
FT                   LPLHQAVSYGSVDADKRLLRKKGLNLDIQDRKGYTPLHLAVQSRRLEVVNLILSHPLAN
FT                   VNCKDKDGNTPLWLSTYSSCDEITERLSAEKDINVNFVGGRGRLEAPSTSLHHAAIRLD
FT                   TVVLRQLLAVPGVNPNICIAGHSPISVAAYHGNVNTVACLLSMEGVEINGRGLIDPPIC
FT                   RAVAHGHLDVVRLLVQQGARLNVNESTVATHDTALCIAARGGGLEMVRELLRHDQIDVN
FT                   LRNQWFEDPLMLAVRGGHFSIVDVLVANPRLTHFSLRRTLGLAKDNCIQRAIRSRIYDD
FT                   NTPKKLLKRSPRRIFDRL"
FT   CDS_pept        join(553199..553336,553397..553750)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944712"
FT                   /orf_name="Pc24g02540"
FT                   /product="Putative uncharacterized protein Pc24g02540 "
FT                   /protein_id="CAP87162.1"
FT                   /db_xref="UniParc:UPI0001832EA5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX30"
FT                   /transl_table=1
FT                   /translation="MDHPTSPSPIGRPAKRQCRVSHAPEDEPKLENHPQQASNGTTIEP
FT                   KIPVRTRGTLTAEFMKVVNLNDSLATPVLKLLDLYFCLWQCYVVKSAEKIRLEEEQRQL
FT                   QASNDLLASDSDILLQLCNVQASVLWERKRAVQALCNGVVSALEASDLQAYSAEEPEPC
FT                   "
FT   CDS_pept        join(complement(555574..555582),complement(555424..555510),
FT                   complement(554974..555377),complement(554588..554711),
FT                   complement(554437..554487))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944713"
FT                   /orf_name="Pc24g02550"
FT                   /product="Putative uncharacterized protein Pc24g02550 "
FT                   /protein_id="CAP87163.1"
FT                   /db_xref="UniParc:UPI0001832EA6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX31"
FT                   /transl_table=1
FT                   /translation="MGTEKEEQQPSELPILSDKDNNVEPSDHVLPLTSTSQHEEVTRHT
FT                   LATEPFQPILKALADLERDDPKFAFPAARLVGFYRRLWESCVPKHIDVQKIDQSNEILK
FT                   EAGTHLRKERDGLQLHHDKQLARLRFFEHALESSRERLINLLDDWNYPYSPNLAGLTDV
FT                   AREEGSVGGSLVNRECVERLEYGRDSVRGQRDSRKPVPVARTACQISGQIAQTEILSSA
FT                   PL"
FT   CDS_pept        join(556757..556851,556894..556994,557577..557723,
FT                   557868..558004)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670872"
FT                   /orf_name="Pc24g02560"
FT                   /product="Putative uncharacterized protein Pc24g02560 "
FT                   /protein_id="CAP87164.1"
FT                   /db_xref="UniParc:UPI0001832EA7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX32"
FT                   /transl_table=1
FT                   /translation="MSDVSPPQPTELIYCTAPRVFSRQKREYPRRSRGDLEPRKIDHNK
FT                   RAQGPQLFVVSSSLVFANRTFGFVARLWGSEVARCVRGGFFEVTAGECDELDTTSYQHG
FT                   MNGDCIAEDNWGTAMFPLLESKRASALSARAPRYRCDPMLYRPDMTIGGIDDEPM"
FT   CDS_pept        complement(559802..560674)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976814"
FT                   /orf_name="Pc24g02570"
FT                   /product="Pc24g02570 protein"
FT                   /protein_id="CAP87165.1"
FT                   /db_xref="UniParc:UPI0001832EA8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX33"
FT                   /transl_table=1
FT                   /translation="MPEPIISLNNTRLQEMPLPSTEYNKLPHIHTMADAAANHSKAHAI
FT                   LLGIIAAHRLKKIFTLHLVHKHFDIPEGRCMVYENIQSKAHDDFVLCSPRLPEKCPDLR
FT                   GLYFKATVEGKMVAYEFTTEPGADLSAYEDFVAEFSSAVIELGVQNVFALTALSICPKN
FT                   KILTEFELSEVLSTVLVSDASWLPAQDKAKSTSTDWVATQDYAQYAEGPVPGIIQLKCT
FT                   QTKAGNHYNVTCSTTRSGKHYEQQTKKGGPNFGGEPRDLALEIDGEVFHEGSKPHAIVS
FT                   HALSLVDII"
FT   CDS_pept        561855..562853
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076525" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976815"
FT                   /orf_name="Pc24g02580"
FT                   /product="Pc24g02580 protein"
FT                   /protein_id="CAP87166.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001832EA9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX34"
FT                   /transl_table=1
FT                   /translation="MPEITCDEDLPKLLNTPTKQVKRAKKLILKHLGSAVDRVDRPPMQ
FT                   GMFSRTLFLILKDKREIVHQFRTEPLDLNAFKTARQALGSIVPNATALEDEELLAQGVW
FT                   AYSFNLLPGEMWLRGISGKGAQGRIAINKSLGRVLSKGCLANNSDEAVDGRIRSHLEAL
FT                   LTSSEDDIRPYQHQLQNFLDKLEQFKELPLWVAHYDLNEVNVLIDEDCNVTGLIDWELS
FT                   TPLPFGICFGRIHTYAGEYSGGEFCVPDEFEDAERAFWHELFDGMPTEIRRKLKDEMNL
FT                   VQDAVILGTLLDCFSLENGKVIVSKVAKKALPKLLTYQIPFIRGQGPPYRD"
FT   CDS_pept        563651..564309
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        566060..566977
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076695" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670873"
FT                   /orf_name="Pc24g02600"
FT                   /product="Pc24g02600 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP87168.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001832EAA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX35"
FT                   /transl_table=1
FT                   /translation="MPANMLLTGGSPQMEQQIAPPSSQICGENDLAFSNGIQTLFHDSA
FT                   KLKANIAPGPAEWPGMEYHQNHGGLVIYQALAHSVQKHEGGCDGHYHGQPGCSIDPGSI
FT                   YCGSRPVICWLEYLPTSVPSNHLLLGPPPENFDYVPSFFGTCLFPNQANINSPYPRPLE
FT                   ALQHDSQNNVAEPCQAFGQPVNLLYSSQDPSNSSLAGSQTNVPRRQFKCGVQGCRSHFK
FT                   LRKTLNRHLASHSGERPHFCWVPGCQRSFLRRDNLKAHYARHGKRKGRNRYVATLDKTA
FT                   SVYNPEFCGQLTPEGWPLDYSGQD"
FT   CDS_pept        complement(567407..567999)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(569720..569744,569823..569914,570145..570411)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944714"
FT                   /orf_name="Pc24g02620"
FT                   /product="Putative uncharacterized protein Pc24g02620 "
FT                   /protein_id="CAP87170.1"
FT                   /db_xref="UniParc:UPI0001832EAB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX36"
FT                   /transl_table=1
FT                   /translation="MRGPPGADYPLVTRQSFLDGTGRVQLYRMESTTVHTTGKPKRRRG
FT                   LTGQTYKHASKESDRLGAEFRVQLRNYCGPTRSIGLECMAAFNHSEAEMAIQPDVAHNA
FT                   KSSNVVGDLPQTSASLNSPSQPR"
FT   CDS_pept        join(570691..571866,571912..571950)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127941"
FT                   /orf_name="Pc24g02630"
FT                   /product="Putative uncharacterized protein Pc24g02630 "
FT                   /protein_id="CAP87171.1"
FT                   /db_xref="UniParc:UPI0001832EAC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX37"
FT                   /transl_table=1
FT                   /translation="MVSLPRTDPLETAPPPRTAPLPRTAPPPRTAPPPRTSLPPRTAHC
FT                   PPGVSLPKYCWICCRPIELSNYAPDTWKNVFQPLHISGDKGHLVPVRRHSLTEQPAVHA
FT                   CCWKVAELVLGRSSFDPQLLNTIANHLFNLRLFAKPTPYNCETNGLDYALFAEPDALSE
FT                   TADEDICRDNFSPEFFQQCFALLDQQPNVITIDQVERVDPCLACWISEWNQYDLQNDKN
FT                   LNIRSCVQRIVKNIKECDQSRFPKTYNFRVAWSNVHEAVNAMNNFPLPIFVANDPQLPA
FT                   SPYRRKQCIPAKTCRRLEFIFSSYVSSPCLSGIAYDGKLLGFKLRSSKSYHVRINDLKG
FT                   LVLGRNSVGSITAIKVKNGENWSQWYGEPQSACSDIELEWENQNKMLIFHIDMLSRRIS
FT                   DVGAK"
FT   CDS_pept        complement(573312..574901)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944715"
FT                   /orf_name="Pc24g02640"
FT                   /product="Pc24g02640 protein"
FT                   /protein_id="CAP87172.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832EAD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX38"
FT                   /transl_table=1
FT                   /translation="MSLSSLPPELTLLISSHLNSPKDLSSFLRTSQKFYYLLTNELYQN
FT                   NVRSDGGSALLWYASRGDEVGVRNMLRAGANVNLRSPDRAQSTALLEAVSTKRTSVVQI
FT                   LLENGALPDMADARSRRPLVLATKGRSDVTITKLLLEHGAVANSVVLDKHAPLLEAVRS
FT                   NQESKVVLLLKHGADTHILDSRTGMTLVHIAASKNATPGIINILIGSGIQVESQDNMGR
FT                   TPLQVAADHSCTRAVRLLLNLGANPNFKNNNQYWKGWSALFYAATNPSIHRNGRKSIIR
FT                   TLFLHGAEIEARNHAQKTPLLHAISQSAXKQAQALVECGASIMARDANGETALHLAASS
FT                   SSWCSSLLGWLVETGADVNWVGGKHSETPIFNAIRRFYARQGMECIQTLLSLGADVQFR
FT                   NMDGLTPLSLAVRMGSIESTKILLEHGSCVNSRDKNGKSPLHYAAEAWNVHKIVKLLIQ
FT                   YGADVNSRDMLGFTPLHRIVAKEEAWEAAGELLKAGADRYAIAHNGKFPHEMVPDGPWA
FT                   ETKRSLIRFYMS"
FT   CDS_pept        complement(577005..577379)
FT                   /pseudo
FT                   /gene_family="HOG000076695" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(579348..579903),complement(578848..579254))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823661"
FT                   /orf_name="Pc24g02660"
FT                   /product="Pc24g02660 protein"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAP87174.1"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniParc:UPI0001832EAE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX39"
FT                   /transl_table=1
FT                   /translation="MVRPVSDDFPRPGVEFRHVLNISQQPGGLTLCTPLLQTHFAGIWG
FT                   KVDVVACCEAGGFVYASAPALQDNVPLALIRESGKLPTPTVSVFKSTSHIPSSTSDYLE
FT                   GNRIVMERDLIPKGASVMVVDDVLATGKTLCAVLDLLNKANIGAKDVSIMVVAEFPVHR
FT                   GRELLRQRGFGGVNIQSLLVFGEIHVLKSLYRKALRLCSLEAWLCQSCSWDWVGLFRSS
FT                   LQIELSTPCQVPMTHPQTSSQPYVLQLGEINNCYFRGIAGDQLYNLRHQMFVDLLYFVL
FT                   RVDYECGIFDGAAWLHDLSVSEMRYGFKYYTDLQYCHHV"
FT   CDS_pept        join(580425..581166,581314..581369)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823662"
FT                   /orf_name="Pc24g02670"
FT                   /product="Pc24g02670 protein"
FT                   /protein_id="CAP87175.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832EAF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX40"
FT                   /transl_table=1
FT                   /translation="MSIRPSDFFRLPNELLLIVATKLNQRDLVFLSCTCKSNFNLLKSA
FT                   LAEFKLFDALLDGNDDLARQLTGQPFIDLSVLHKGLSLLHVAVAQGNPCITAWLISKSK
FT                   RLLEVHDGTGQTALMSAVCWKEENISRFLIDKGASVNAQDDSGFTALHFAAEDGDTSMV
FT                   SQLLEAGASVLLADSNGWTAVLLAVKENHVPIVVKLITQGANPNAKNSSGQNALYWAVR
FT                   NGNMDMVRLLINNGADPKSIDTDKDANLLGEPFRNFYDIGAII"
FT   CDS_pept        join(complement(586623..586792),complement(582569..586552),
FT                   complement(582353..582507),complement(581834..582204))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(587286..587514,587553..587628,587660..587797,
FT                   587856..588134,588186..588378,588700..588887,
FT                   589001..589136,589335..589544)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944716"
FT                   /orf_name="Pc24g02690"
FT                   /product="Putative uncharacterized protein Pc24g02690 "
FT                   /protein_id="CAP87177.1"
FT                   /db_xref="UniParc:UPI0001832EB0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX41"
FT                   /transl_table=1
FT                   /translation="MIGEVYEPLAIRIARSYPVTTVQFIITDGFVTCLWLSQVARCVQR
FT                   GFSEATAGDCDDLDTTSCQYRMNGDCIDEGNSNLSSRSKQKFCDLYELISHNKSSKWGR
FT                   PRGPVTQVEFEARKCIVCSGSPIPMRSHALSPDMTIGGIDDEPISCADASTRYISQIPM
FT                   AYATVRLSAFEDRERIALPNWITVQWVAPRCYRMASGGLSSLIIRQAPRNADVSSCLMA
FT                   GEPTFAVGHVVSPKPRARSYELRRQGRLYRGTAEPTKKPKIPSDTVPSDPTPHCSGVRR
FT                   IRTSGNEPSGNIRSCIKSPLNRCLSHPAAFSQQQSMLDRMNPGTTPQKATIGGLSAVVG
FT                   IDTWETAGDINCSYQRGDYLQCCGDSQIRVGLSDLQSPTEAMTSNKAESIALRYLVEPT
FT                   SGIRAAPHQMPLHLKTSVLRLGVLIDLDTAHKAHGFAMSYFHLPMGGHSVGWPMGRLLT
FT                   SPSRTHLLYNVLATYRSHNTTYSD"
FT   CDS_pept        join(590830..591036,591084..591278)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234925" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670874"
FT                   /orf_name="Pc24g02700"
FT                   /product="Pc24g02700 protein"
FT                   /protein_id="CAP87178.1"
FT                   /db_xref="UniParc:UPI0001832EB1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX42"
FT                   /transl_table=1
FT                   /translation="MKTLKLPREAEEIRKEIKQMIPETALPPKQFNPTQAELLNEDENG
FT                   NRRYGGDLLALKIAVLTGGMKIGTGWKWRVLYWSKAAKLINERKQGYLIPLKDIDLNPG
FT                   GKLHEGDYIDVTNEPELSSEAAAVFIVPS"
FT   CDS_pept        join(complement(593055..593960),complement(592853..593025),
FT                   complement(592636..592802),complement(592510..592587),
FT                   complement(591339..592447))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823663"
FT                   /orf_name="Pc24g02710"
FT                   /product="Putative uncharacterized protein Pc24g02710 "
FT                   /protein_id="CAP87179.1"
FT                   /db_xref="UniParc:UPI0001832EB2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX43"
FT                   /transl_table=1
FT                   /translation="MTRQIPFEGDDAAYILFLETRIFQLEDSLRQPAQKSTIRTSSGPA
FT                   DFNGVRNQVEVCERPHHHRRQIHIAPETQSPDGDTEPSPEEFDEQGGVHKDGANPDAFN
FT                   IIEYNPTAHLDPNWTRKRARDQSKKHQPKTLSRFISFIDNLPESEIWKNWVSALDEIQR
FT                   KEYLEALVQNCGSGTSNFASLGTAKELADVSSKPTDISILSQYASFMVSFGTLNQQLAC
FT                   FQNLVFVSLCAVALEKTENKDGVHAVMREVLGSDASSKQLVKLVRGAKWANSLVSLLSK
FT                   TKWASRSWDILCVGMVTVFMLRPVSFYARLNDCSVDPKEVLERMGTNVHESLFLPESIH
FT                   SPAPFAIPLVVERVFKNSTSLKVICECLGYELSSVNSYRAAFNNALEYRNTKKRPASTR
FT                   CKPSKRHRQGHSSSTPDHDGQSAQYHCSRVANISASGSPLSEVHDNNTSRSTAQPQSHF
FT                   QPPQADITSEEAAFGTGFLVCAREVTALDYEHTSLDGNPQSTHLHSLANGSVIREDVPL
FT                   EPQSTFNTPGRLEVSNLIDFHADAAPIPAQDSIDTLLDRHALGVGNFIDLHADAAPIPA
FT                   QDSIDTLLDRHASGVGNFIDFHADAAPIPAQDSIDTLLDRHASGVGNFIDLHADAAPIP
FT                   AQDSIDTLLDRHASGVGNFIDLHADAAPIPAQDSIDTLLDRHASGVGNFIDFHADAAPI
FT                   PAQDSIDTLLDRHASGVGNFIDFHADATPIVTRPSLGIPPSTFTTPDRPSMTFNLFDAT
FT                   SGEARDRSVGLSTECPNQTHPEGLANMSSSLSSEWVPLDDTLSPRSIIQTIHVVPNG"
FT   CDS_pept        join(595663..595934,595985..596101,596452..596521)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944717"
FT                   /orf_name="Pc24g02720"
FT                   /product="Putative uncharacterized protein Pc24g02720 "
FT                   /protein_id="CAP87180.1"
FT                   /db_xref="UniParc:UPI0001832EB3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX44"
FT                   /transl_table=1
FT                   /translation="MDFPIIPVVDIDIPFVNPQAKALDIERFSASTLIFLFGLQEPLTS
FT                   YVLPVNGLYSAKMRTATTSRTHGPSPGSHRGVESRVKFDKTILSGTSTRICGYTREFLW
FT                   QDTHFFWKFMSNSRPNEHGATESSSPEKKYNLAWMAIVKLAIVDMYRD"
FT   CDS_pept        join(597101..597154,597207..597776)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944718"
FT                   /orf_name="Pc24g02730"
FT                   /product="Pc24g02730 protein"
FT                   /protein_id="CAP87181.1"
FT                   /db_xref="UniParc:UPI0001832EB4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX45"
FT                   /transl_table=1
FT                   /translation="MEKLLSAAITYLMVLKLEPWDMLHIREQHGNMVTVGATGWKLEIS
FT                   LNEMKSSISGCAFLLDHGGYFWCIIRHTLQHWRNPEWRPLSGADGLRVGGKAQKGILHL
FT                   CPLLYGDTSALVPFSMLEMTTPGRMMIWLAENQVTRYTLQLKAKLLLQIIKAGLIGNWK
FT                   FSRRLILDIAICGQRVMLIVIVITTRLVNTMWERSFANSFEPLE"
FT   CDS_pept        join(599293..600156,600208..601446)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944719"
FT                   /orf_name="Pc24g02740"
FT                   /product="Pc24g02740 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP87182.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001832EB5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX46"
FT                   /transl_table=1
FT                   /translation="MPPHHQYECAVRTRARTACQSCRKKRTRCIGGPPCENCIRLRKEN
FT                   CEFVHTPSSKKLVAPETRPDCNACLPCCMEKSVCKGGPPCENCVTEGREVCAFDLESHK
FT                   EVRPRKRRTWACLPCRLRKIRCTGGGAPCGTCISRGIGSTCEFIETTKDHPEETGIHTT
FT                   QNQYNGNGELSRNAVMEAGTTQQPESTLQERPENRPSPNTFTALDTRQVCRKKSLSCSE
FT                   TLSTISNANPLSDLSKSPSLDGSDSDKGAYPASLIGCSSHGELLDVLPNCQMIDCLIER
FT                   YFESISTLFCVINATSFKAEYEVFCRNPNVTPKSWLSLLFAVLALSCRAEEDPERGCCS
FT                   DRLSTLYEKAAWDCLLTNDPPFEPSPTSLKAIILIIYGRTHRGKDVFSDLQLAYRTASS
FT                   TKCHIDTRQCGVEHIICEEYRCLLLGLKTLSLLNAQLHGCYRNRDITQGIECLADTYES
FT                   TERPHLPISVEGSPTTQMTFTILNLQLLEISDKICVGTERGLMSEWSLAGLETELFRIE
FT                   KQCSEIYTKVRESDSQLGSHPGSLGILHCYINYLLHLLFLPDLQRYLNGNIAPGTRISQ
FT                   LKCIAFAKASLQSFNLLADDMQSESYGWYIRGLGSYYAEQSAYTLIRSRAVLQENDQYQ
FT                   EVRSILKRTLEIFSAFLDRSIFSTRGAFVIENQCMSRSSKAISRACISNFTSGFHAEHL
FT                   GRGDGT"
FT   CDS_pept        join(602048..602275,602325..602723)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670875"
FT                   /orf_name="Pc24g02750"
FT                   /product="Putative uncharacterized protein Pc24g02750 "
FT                   /protein_id="CAP87183.1"
FT                   /db_xref="UniParc:UPI0001832EB6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX47"
FT                   /transl_table=1
FT                   /translation="MTSTQDMSFDHTIPYSAMEVMGYSKLQASSPPESMVREVERSLRS
FT                   RPNEVSETVTYGRGDHDACESFLRFGIQDHDFTRKIEEVIGRPAFLLHQGPVIVHSPDL
FT                   PTNWGINAAHPVRNGVSVFRTLSGDRVTLKLYPISHHLSSTEFAQGKGTPRSFNLTSNE
FT                   VLFVRGALKMEISLPAGGFLVWQGFSEDPWGIDPSAPEAFAFMRI"
FT   CDS_pept        join(605345..606837,606906..606989)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        608269..608631
FT                   /pseudo
FT                   /gene_family="HOG000048617" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(608852..610285)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234740" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976816"
FT                   /orf_name="Pc24g02780"
FT                   /product="Pc24g02780 protein"
FT                   /function="ATP binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="lipopolysaccharide biosynthetic
FT                   process"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP87186.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009103"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="InterPro:IPR010440"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015730"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0001832F4E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX48"
FT                   /transl_table=1
FT                   /translation="MDFWREVVQPDRVPTEEPEKSRYHAERLVGSAIVQEFHVMIQEGL
FT                   EYSYLTNGLMDVQLWVPYDDPTTLYYHLGDPGIYGMAGVAGAGIPRTRIERTLCLCLMS
FT                   FRAPLRDQAWRNAAKDGLPKWRSILDSDRAQIVLVELPRDLDVDGANSESASPEQSTSE
FT                   YLTSSSPITSGPRVTTRAAASCAPLSGPHHHESSSDSEADPTSSAGRKRGFSQVTSSPP
FT                   TQRSAPRADRQGKQSGQSRSHDAPYCTQKCLLGLQQGGTLDPKCPNTELHMLGGRVDRH
FT                   PIGAADLVKRFKMQLDQDLDHNCTPIGPCGSSGAPFKITCAIFGYTVVGKGTTSKLWGE
FT                   VSREAEVYRVLQRAQGSAVPVFLGAINLAQTYFLHGAGRIRHMLLMGWGGESVGHTTPD
FT                   KTTQRAICRSVKEIRRFGVVHQDLRPENILWNAELQRALIIDFHLCTLDRRPLDRRPGT
FT                   LKRLRYGSAERHSKRVRVV"
FT   gap             610286..610385
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(<610386..612011)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234740" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670876"
FT                   /orf_name="Pc24g02790"
FT                   /product="Pc24g02790 protein"
FT                   /protein_id="CAP87187.1"
FT                   /db_xref="UniParc:UPI0001832F4F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX49"
FT                   /transl_table=1
FT                   /translation="MSGSSSPDYKALFLKAEEERKRAEERERQAEERERQEAELRRQAE
FT                   ERERQQRERNRPTTFPEFIRLCHDLLWRPLRAQTPSRSTTGKIPAPIGKHCPLRLRPWT
FT                   DCEDKQRKIYESVCRYLQPTEGDARELFTSLVALEDHGRRFARRPISSEQDLETYERLA
FT                   VEDHVHDIVAELCKIPEAREEFRLGNGIWFDNHPNALDDDNEVDAKQPSTTKPSKPDQF
FT                   CIYQRDGNRRTLLTTVEYKPPHKLSAANLRLGLRPMDFWREVVQPDRVPTEEPEKSRYH
FT                   AERLVGSAIVQEFHVMIQEGLEYSYLTNGLMDVQLWVPYDDPTTLYYHLGDPGIYGMAG
FT                   VAGAGIPRTRIERTLCLCLMSFRAPLRDQAWRNAAKDGLPKWRSILDSDRAQIVLVELP
FT                   RDLDVDGANSESASPEQSTSEYLTSSSPITSGPRVTTRAAASCAPLSGPHHHESSSDSE
FT                   ADPTSSAGRKRGFSQVTSSPPTQRSAPRADRQGKQSGQSRSHDAPYCTQKCLLGLQQGG
FT                   TLDPKCPNTELHMLGGRVDRHPIGA"
FT   CDS_pept        join(complement(612719..612879),complement(612494..612683))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944720"
FT                   /orf_name="Pc24g02800"
FT                   /product="Putative uncharacterized protein Pc24g02800 "
FT                   /protein_id="CAP87188.1"
FT                   /db_xref="UniParc:UPI0001832F50"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX50"
FT                   /transl_table=1
FT                   /translation="MNMVGKVDEPSTRSPEERSLVAWPAPPQVKDSTAARQQTICHWRK
FT                   ASVRRSSASTGHMAGGTTGAADQSLEPVFPEDPGSRRRRVQIPSFEMITAVNPFRSFFA
FT                   LRGWNRQMLPQL"
FT   CDS_pept        complement(615182..615679)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823664"
FT                   /orf_name="Pc24g02810"
FT                   /product="Pc24g02810 protein"
FT                   /protein_id="CAP87189.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001832F51"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX51"
FT                   /transl_table=1
FT                   /translation="MPPQTTTIIDGEFERLKSIQMNALDKNVMAFLEATHKSVQAKGIC
FT                   NPRGPFERSLIHYAAMGDCTELLLQLLETEAPIEDRDQNKRTPLSWAAEYGSYNVTKIL
FT                   VQNGAQVNSLDDTYTSPLTWLKYAGHPDCKSLPATKRFLKSNGATTRGFKRAWILQKLG
FT                   RL"
FT   CDS_pept        join(619372..619513,619594..619730,619793..619936)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944721"
FT                   /orf_name="Pc24g02820"
FT                   /product="Putative uncharacterized protein Pc24g02820 "
FT                   /protein_id="CAP87190.1"
FT                   /db_xref="UniParc:UPI0001832F52"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX52"
FT                   /transl_table=1
FT                   /translation="MMTKMNHPTSPSAIDRPAKGQWSIPRSRRPSWKTIHSSFKRHNYR
FT                   TQERTRGTLTAEFMKLVNLNDSLATPVLKLLDLYFCLWECYVVKSAQKQYPSTALQWTS
FT                   FSIMGRKRAVQALCNGVVSALEASDLQAYSVDELEL"
FT   CDS_pept        join(complement(621588..621707),complement(621134..621541))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944722"
FT                   /orf_name="Pc24g02830"
FT                   /product="Putative uncharacterized protein Pc24g02830 "
FT                   /protein_id="CAP87191.1"
FT                   /db_xref="UniParc:UPI0001832F53"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX53"
FT                   /transl_table=1
FT                   /translation="MDSPNSSPDQGKQGEQQPNELPIHNDKDHTLEPSDHVPPLPSPSQ
FT                   HEEVTRHTLATESFQPILKVLADLERDDPKFAFLATRLVGLYRCLWKSCVSKHIDGQEL
FT                   QQSNQVLREAGTHLRKERDGLQLCHDKQLARLRFFEQALESSRERLISLLDDWNYSSSP
FT                   NLTGLSDVAREE"
FT   CDS_pept        join(622558..622648,622833..622854,622929..623027,
FT                   623075..623176,623223..623339,623542..623878,6
FT                   23979..624197)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076631" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944723"
FT                   /orf_name="Pc24g02840"
FT                   /product="Putative uncharacterized protein Pc24g02840 "
FT                   /protein_id="CAP87192.1"
FT                   /db_xref="UniParc:UPI0001832F54"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX54"
FT                   /transl_table=1
FT                   /translation="MSLQIVAVKEDAGFNRPQLRNVSFNTSNQVANQTVPVLWSRCLYE
FT                   EVSAIASWSTVAALVDHKFEVQLPTLRGTARSVDVRTQCTRARATASRGLFIPGVDHQN
FT                   IEPLGAHQSGPDNPALPSVQSHGLHTIPSPVASNNAACPRGTPSSSVKYTVASGLFREI
FT                   KDKTKVAADERAPSRLPPSSPPPSHYCGALNLWHRETFIHHGSAMFIASGFVTRVYCLN
FT                   KLSCAPQRGFFEASADCDELECDVAWLVTALQRVLVQDQSLLTRIVQQEDTLIFVTQVE
FT                   CHANKRLVCSSSPIQILSHALCPFHMTTIDDESPEGSYRVPRPLSPY"
FT   CDS_pept        join(626718..626786,627057..627172,627215..627569)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944724"
FT                   /orf_name="Pc24g02850"
FT                   /product="Putative uncharacterized protein Pc24g02850 "
FT                   /protein_id="CAP87193.1"
FT                   /db_xref="UniParc:UPI0001832F55"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX55"
FT                   /transl_table=1
FT                   /translation="MPISISARKLLDHKLPRERNGKYGLGCGELGNAAASCRELVNAAV
FT                   SCGSHLSSQRPPAEFTCTPLRGILMTQTYPARIVVDADLSCEAPFYTRGARGSEGAQVL
FT                   HHWARGSDSRGHGDSQARRQERGTMTHRSVRTEVLIVFGLGIQLLLYFFGYVSTKEPVA
FT                   QMVARIIVSLISVEAI"
FT   CDS_pept        join(complement(628666..628791),complement(628371..628562))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944725"
FT                   /orf_name="Pc24g02860"
FT                   /product="Putative uncharacterized protein Pc24g02860 "
FT                   /protein_id="CAP87194.1"
FT                   /db_xref="UniParc:UPI0001832F56"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX56"
FT                   /transl_table=1
FT                   /translation="MGYKEGFDPGLLPHILSGLVVISLAGQKKRELEQNHHNLRRLGCR
FT                   RAGSTHVREPIGFSKPEAFYLSSCGLSIIGINLYKPSARVIGIAVDLEQMERKCYGSKR
FT                   V"
FT   CDS_pept        join(complement(630674..630833),complement(630375..630620),
FT                   complement(630331..630337),complement(630118..630292))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944726"
FT                   /orf_name="Pc24g02870"
FT                   /product="Putative uncharacterized protein Pc24g02870 "
FT                   /protein_id="CAP87195.1"
FT                   /db_xref="UniParc:UPI0001832F57"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX57"
FT                   /transl_table=1
FT                   /translation="MNSSNSYDEEPTTPLTLPGALVDCHRHEAILLSADKIRVFSVPGV
FT                   YIAARFPEDAVVVVKELGENKYIISPNPPALLSECQTLYNSRELDFSFAQVYVAMMKMS
FT                   RKHTLEGPIGDWLRFMMRKCLCSTELNRGDEGLRYDISISEVVLETFLPRHERPENSCT
FT                   PELWFVEFLSDYSYSVLKEAAISELACSFSYV"
FT   CDS_pept        complement(631194..631867)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(633118..633348)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944727"
FT                   /orf_name="Pc24g02890"
FT                   /product="Pc24g02890 protein"
FT                   /protein_id="CAP87197.1"
FT                   /db_xref="UniParc:UPI0001832F58"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX58"
FT                   /transl_table=1
FT                   /translation="MPAIEFLQSNGSPVARGGIAKRDNWAAEEPGVILVFCIVFLVGCG
FT                   ILVLIIQKTVKQRLEERAQWEVSEVRNEKSY"
FT   CDS_pept        join(634663..635059,635116..635339,635409..636059,
FT                   636149..637054,637123..637929)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944728"
FT                   /orf_name="Pc24g02900"
FT                   /product="Pc24g02900 protein"
FT                   /EC_number="3.6.3.6"
FT                   /function="ATP binding"
FT                   /function="hydrogen-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP87198.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0008553"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001832F59"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX59"
FT                   /transl_table=1
FT                   /translation="MSSKRNDDVENGAASRRASVLSYKEDAKIDEYTRLVRFMSTYRDD
FT                   SKSDKDAGEIRESRSWYAPWQKKKYRWKYVGVGQEYPDGWRFTDINHGLSDSDVDERRR
FT                   TVGFNELTAEKTNQFRKILSYFQGPILYVMEIAVLLAAGLEDWVDFGVIIGILCLNAAI
FT                   GWYQEKQAEDVVASLKADIAMRSTVVRNGQEVDLLARELVPGDVIIVEEAATVPADAQL
FT                   VSDYGEKQRGWQKYQQMREDGTLDKKRNSDVEEAGDEEEGSDDEDQGFPILACDHSAIT
FT                   GESLAVDRYVGDQVFYTTGCKRGKAYAIVQATGIKSFVGRTAAMVQGATGKGHFQIVMD
FT                   SIGTSLLVIVMAWLLAMWIGGFFRNISIASPGEQTLLFYTLNLLIIGVPVGLPVVTTTT
FT                   LAVGAAYLAKKKAIVQKLTAIESLAGVDILCSDKTGTLTANQLSIREPYIAEGIDVNWM
FT                   FAVAALASSHNVRSLDPIDKVTILSVNQYPKAKEILQEGWKTESFTPFDPVSKRIVSVV
FT                   SKNEERYTCTKGAPKAVLQLANCSEETAKLYRKKATEFAYRGFRSLGVAVQKEGEEWTL
FT                   LGMLPMFDPPREDTAATIAEAQNLGIKVKMLTGDAIAIAKETCKMLALGTRVSNSEKLI
FT                   GGGLNGAMAGELIEKANGFAEVFPEHKYQVVEMLQDRGHLTAMTGDGVNDAPSLKKADC
FT                   GIAVEGASEAAQSASDIVFLEPGLSTIIDSIKVARQIFQRMKAYVQYRIALCIHLEVYL
FT                   VTTMIIINESIRTELVVFLALFADLATVAVAYDNASHENRPVQWQLPKIWIISIILGVL
FT                   LAAATWVIRGTMFLPNGGFIQNWGSIQEIIFLEVALTENWLIFVTRGGNTWPSLPLVIA
FT                   IAGVDALATCFCLFGWFSNRDMITNPFDAYIPKETANGWTNIVDVVRLWGYCIGVEIVI
FT                   ALVYFALSRWTWLDNLGRTKQSKGDVAIGNVLSHLSTLAIEFEKDSENHGRMWLGRGKE
FT                   EEEID"
FT   CDS_pept        join(639424..639567,639631..639734,639787..639909,
FT                   639969..640101)
FT                   /pseudo
FT                   /gene_family="HOG000169808" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(641178..641252,641384..641635)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823665"
FT                   /orf_name="Pc24g02920"
FT                   /product="Putative uncharacterized protein Pc24g02920 "
FT                   /protein_id="CAP87200.1"
FT                   /db_xref="UniParc:UPI0001832F5A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX60"
FT                   /transl_table=1
FT                   /translation="MTTAVAATSPAMSELCFLAALRPASVTLRREELREQELQSFRDHG
FT                   CRCHEPSDVRFAPPHSQMSPVFVKLRSVTQDLARQGLVMAPQQWAGTSPWCWWLVPEYF
FT                   KSIR"
FT   sig_peptide     join(641178..641252,641384..641395)
FT                   /db_xref="UniProtKB/TrEMBL:B6HX60 "
FT   mat_peptide     641396..641632
FT                   /db_xref="UniProtKB/TrEMBL:B6HX60 "
FT   CDS_pept        join(complement(644237..645059),complement(643639..644195))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944729"
FT                   /orf_name="Pc24g02930"
FT                   /product="Pc24g02930 protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP87201.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001832F5B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX61"
FT                   /transl_table=1
FT                   /translation="MSSASSIALSLDGWTSQNSLPMLATNAHWMSSAFQQYRACIEFVE
FT                   IEGSHSGENLANIVATVLERFHISDKVMTITADNASNNDTLHRYLYQKLSQRYDGYLSE
FT                   TIIREGTMKFTHNSQIHCFAHILNLVMKTILRSLRASSHKEACDLLDDVAKRSWKRVNA
FT                   PTSPIAKLRLLVLWIARSPERIQKWDNRPGCTKAINYDVDTRWNSTFVMIVRAEECRRQ
FT                   LEDTVNDDPDIEALRLTLNDWRQLSDIKKILAPFSEYTEYVSRDSPSIHMAARTTRRVA
FT                   EGLASNNCSCFRSNLTPREVPRLRQRQRHILIASVLDPRIKTKWLKTLPDGEKIIDRIR
FT                   EFLKKAYSTTKQPVSIAPSTNWMSFEYRFLEAIQPTQYYVAESDIDKYFDTPTISTGCD
FT                   ISQSQSEFIRNWWKANMLEYSCMAKVAQDHPCYTSSRGRYREIVQWWERCARDSTFLHE
FT                   R"
FT   CDS_pept        645378..645473
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(646195..646273),complement(646116..646141),
FT                   complement(645660..646046),complement(645560..645607))
FT                   /pseudo
FT                   /gene_family="HOG000235063" [ FAMILY / ALN / TREE ]
FT   CDS_pept        646688..647341
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(647681..648100)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   gap             648821..648920
FT                   /estimated_length="unknown"
FT   CDS_pept        649349..650365
FT                   /pseudo
FT                   /gene_family="HOG000158359" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(651044..651080,651184..653066)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(654002..654049,654194..654231,654424..656017)
FT                   /pseudo
FT                   /gene_family="HOG000076781" [ FAMILY / ALN / TREE ]
FT   CDS_pept        657486..658649
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(659737..659780,659912..660047,660336..660432,
FT                   660575..660652,661320..661477)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944730"
FT                   /orf_name="Pc24g03020"
FT                   /product="Putative uncharacterized protein Pc24g03020 "
FT                   /protein_id="CAP87210.1"
FT                   /db_xref="UniParc:UPI0001832F5C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX64"
FT                   /transl_table=1
FT                   /translation="MAPCETDVAEIQYTRHGNSAFRSDFKVCWSTVMASSQIFGALASI
FT                   GLSRQAILAVPNGKLDFEAGRSNEISRPERHDKEVPKSAHESYGFMRDRQIHHEMTPIL
FT                   GQGIRLVQTKFYVGCRSGLARTADRPLDVTPEIQCLLYFRPPSPSWTGDLVQATPHRWK
FT                   HVMSMAE"
FT   CDS_pept        662155..662892
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   gap             663070..663169
FT                   /estimated_length="unknown"
FT   CDS_pept        join(664446..664621,664668..664956,665036..665039,
FT                   665137..665369,665453..665962)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944731"
FT                   /orf_name="Pc24g03040"
FT                   /product="Pc24g03040 protein"
FT                   /protein_id="CAP87212.1"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR019589"
FT                   /db_xref="UniParc:UPI0001832F5D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX65"
FT                   /transl_table=1
FT                   /translation="MSSLQERPAPGESKLFNIGYLLVKKRDASKNLTNNPRSEISIQSD
FT                   KAHPQPHMTLNRYCILSRQEASQKDLLGTKRFQPILEKLADLERDDPKLAFQAARPYRR
FT                   IWASCVPRHLDEEKLGQISKASKGASINPSEGKDGFPLRHEQLYRLHLFGQKALFKRSA
FT                   NLLTEYLMRISYKAFCDYLWVVMRTSRPVEIFPLVYFTFPGPTCYDYTKFHAPLLNSLP
FT                   GHLQKNKHLQSSILDEDPSLHFSLLRLQLVELIRTCMDTPGSDITPALDFATAQLAPRA
FT                   PTNPQFLADLERTLALLIFPSDKLDSSLASLLDPALRKEIATRVNEAILQNQGARKEAR
FT                   LRNLVKTRAYAEQKAREAKKDIPDTLDIGLVGDSHDNSNSNDLATNIRDTLMSNNSDVD
FT                   PMIS"
FT   CDS_pept        join(complement(667593..>667955),
FT                   complement(667383..667533),complement(666513..667321))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944732"
FT                   /orf_name="Pc24g03050"
FT                   /product="Pc24g03050 protein"
FT                   /function="calcium ion binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP87213.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0001832F5E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX66"
FT                   /transl_table=1
FT                   /translation="YGHFYVPGCVTNPHGVKGLENCNFLKTIDEARQIKNKNLDNMELA
FT                   GLPTTSDEERRRLLSFVVCGGGPTGVEFAAELFDLLNEELLHSFPRIVRNEISVHIIQS
FT                   RTHILNTNDEALSKYAERRSTRDGVEVWTNARVKEVRGDRVPPTQVEDGKTVVKEIPTG
FT                   SGWWSTGVSRAPICETLSGRLECQNNKHALETDSHLRVIGAPLGDVYAIGDCATVQNNI
FT                   ADNIVRFLRTVAWEKGRDPEKVHLTFSEWTEFATRVRKRFPQATNHLRRLDRLFEQYDK
FT                   DHSGTLDYGELSELLHQIDTKLTSLPATAQRANQQGVYLGRKLTKIAAALPGLKANEID
FT                   YGDLDEAVYKAFKYKHLGSLAYISNAAVFDFGGMSFSGGVIAMYLWRSIYFAESVSFRT
FT                   RCMLAMDWGKRALFGRGMSFVFLLFLYQCLCFANTFNLQIS"
FT   gap             667958..668057
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(<668072..668566)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670877"
FT                   /orf_name="Pc24g03060"
FT                   /product="Pc24g03060 protein"
FT                   /protein_id="CAP87214.1"
FT                   /db_xref="UniParc:UPI0001832F5F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX67"
FT                   /transl_table=1
FT                   /translation="MLNAMLRRTRADGVALKSMGSLPGRIHTPKAFFTFRQPLSRSLHT
FT                   PCRRPALQWRALEPVSMPIRFKSETAAKAESWKQSRTITAIRKVFTFCGFFIITTGAVV
FT                   VAFFIYDASTYRKGVSAMDIPVSELALNPRLGGPKNLPIADVLVGDHDSEAMLLQKDKP
FT                   RL"
FT   CDS_pept        join(669866..670396,670456..670620)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976817"
FT                   /orf_name="Pc24g03070"
FT                   /product="Putative uncharacterized protein Pc24g03070 "
FT                   /protein_id="CAP87215.1"
FT                   /db_xref="UniParc:UPI0001832F60"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX68"
FT                   /transl_table=1
FT                   /translation="MSQITDGYGYASSSFEGLPLDALQYLTPDDTLSQRKSQFDSVLDL
FT                   PDLLDNQVRSRVGPRALDTLTRIKPDSINEYIVFTTDMSAEFVNWWLQTDFGKKKRLNW
FT                   EVSRRADCWTGFQQVAHTKDGKPGVMCNRCRTVLTHPATNHTGNSSMQKHLDGPRCRQR
FT                   ITKKGNIQQLLSDAAERRPAPFFTQQTWEQKILNLITVSHLPFLFVEHQEFHDLISYAR
FT                   LAPTSPSVF"
FT   CDS_pept        join(complement(671700..671761),complement(671299..671641))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076513" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127942"
FT                   /orf_name="Pc24g03080"
FT                   /product="Putative uncharacterized protein Pc24g03080 "
FT                   /protein_id="CAP87216.1"
FT                   /db_xref="UniParc:UPI0001832F61"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX69"
FT                   /transl_table=1
FT                   /translation="MSTKVPTTTVTPETVPHVQNHTESFARDIISTHPTVGPGVGDEMA
FT                   STRSMKTTQTPSWNNAAMPLALIIPTFTLPTGGAVEAITTAHIPAPTRIGPTIPAEGSG
FT                   NVVWSSTTRWLTLCYLLLLVVTIIDERRSI"
FT   CDS_pept        complement(672866..674335)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127943"
FT                   /orf_name="Pc24g03090"
FT                   /product="Putative uncharacterized protein Pc24g03090 "
FT                   /protein_id="CAP87217.1"
FT                   /db_xref="UniParc:UPI0001832F62"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX70"
FT                   /transl_table=1
FT                   /translation="MASKSGVNKSSPPKERNLSQLVDFEEGANNNSISSKKVASAAAQA
FT                   SVSQGRHPANDSPEAHDDGQGNRSGPTDLASFSPPSDGSVVPSIERDATPPDRGDTQMP
FT                   DAGLANQTEAGPRSSGHQRPSTASHSQNQSGLSPNSRGDNEPEDPELLASLDPSDDGEE
FT                   TDVIVDGWGTLRRSTFVILQYGPRHGARYKAKYRNGYTNDGMNNISDPTLRISQLKTGP
FT                   GNRSWRYTKHNVVGIYGVASEQRDPNKSYKSDPCTWLKIKWRDLRVEDTEKMQNSCSWI
FT                   PRSDFIRFCNGKRAADAKIEEVWNKQEERYLRILESDTGGTGGRTEDRSPTPCPLGSAA
FT                   RQSPGRQSDSRLSTPARQTPPRGQHGSLPSNAHSHPEQGSQSNPINIDRDETHYTPASF
FT                   DATSKSNVNPQAEPKLSIGGSAILNQVEFIAEKAEEEAWDNMDEHQRKTRETMAKALYH
FT                   VYVDTVAKAARAQDPVVGSAIPGVGAAVAAH"
FT   CDS_pept        complement(675998..680330)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(680626..681039),complement(680522..680584))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823666"
FT                   /orf_name="Pc24g03110"
FT                   /product="Pc24g03110 protein"
FT                   /protein_id="CAP87219.1"
FT                   /db_xref="UniParc:UPI0001832FE4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX71"
FT                   /transl_table=1
FT                   /translation="MAFGVDDHTSTPAKTGSEKTPLREIDPLLVLSCSAADVAPALCRV
FT                   NQIHHADETSYVRMLREEAEMDMRFSITVGAANWALLAGYLVIPGTFTSLQTSNQVEKT
FT                   LQANEAGRTVLHMIQNPPLLAIACLLFVSGTAALIRNQAAPSELAPKCLYRRPS"
FT   CDS_pept        join(681511..682501,682560..683087,683149..683554,
FT                   683700..684612)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127944"
FT                   /orf_name="Pc24g03120"
FT                   /product="Pc24g03120 protein"
FT                   /function="hydrolase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP87220.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI0001832FE5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX72"
FT                   /transl_table=1
FT                   /translation="MAAWLDLVKENEAWDLVDTNRLEQLVQGLPNPKYQYPSLLYFYGN
FT                   SNRKKALRALFPHNNITRKGPAGLIRLHLSTKTAHTQNPILFAESGICPEQSLGDSKWI
FT                   KNSTTKHQTFSLGGADGTLAPARLQQEVKRQLVLPWTQILCLFLDSVLDIQAATNLLQR
FT                   PRRQLTIGDEVVPAPLQVVIVLTNSQHVTEAFAQECAQLQKLDTGTVTILDLRPRHGLS
FT                   DSVVFQPLQTLIVKQLSIVQAERISNCRRFSASHLIAFWSNGVQSHERLLHAAPFDLLA
FT                   RARRDYVRNKSMDDCLREVTQTSIGYSKEDFDDLVASAFLMDAYPPQMHGFSPTVVFAT
FT                   LYEKRCLSIWDNEFKYHIAGVSSRFVHHFAQLSAVKTSAAIRKETLCRLYRQWGGLRST
FT                   TTCLVCLCRPPEHMLPCKHAICDTCVVIFGKPSRLGEYHFEISQCPICEEKSDVTVRQL
FT                   PPTKPPVILSLDGGGVRGLIQLGLLRALESRIGIPIASLPDLCIGTSVGALTAIDVFLN
FT                   QSSVTQCFDAFPHLARNIFCHSSETPIPRCIRWFASAFNLTTDGFYNSEGLSKILKAPV
FT                   NPSRRMFDVATANPAGCRIAIVASRTSDGKACVLANYRGASPRSTNTAYEFLTPHNDRQ
FT                   NPSLLDAYFQPKELPGLCLQDGGVRANNPLAIALRESSIIWPMAKRHDLLLSVGTGFST
FT                   SPPSRPTGILGRIWEGPLPRLLRAMMSSPSMDGKQGFLEALNYLPHLSTPDIFRLDQAI
FT                   DGTLPELDDVCSLEAMSNMDFAVPAELVRTILASAMFFFELDETPIQRKASFHCRGSVL
FT                   CSRPNPAEILQRVLVEFPGAIFKSGQDLDLGSIDLVDICQFCGYFRKRVDFRVTSLDEM
FT                   VTIEIANDTFRERIGGFPKSAQEFLDEQKAYAQFGRADHQDQEWPPQRSCYCYRGSKRL
FT                   VHFLEPALGQKRRRL"
FT   CDS_pept        685396..685785
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234786" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127945"
FT                   /orf_name="Pc24g03130"
FT                   /product="Pc24g03130 protein"
FT                   /protein_id="CAP87221.1"
FT                   /db_xref="UniParc:UPI0001832FE6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX73"
FT                   /transl_table=1
FT                   /translation="MASGSTMALESTRPRLRKSKTLPEMSVSEMKAERMQQHRQQGLEN
FT                   DFYCKCFESFHQLVSTTMDATQSLALQYHFNPASSPSGDPRLIRAIVSLRVALDKSRAE
FT                   ETSAEQEWKQQWKVSPVRQSSLRWL"
FT   CDS_pept        join(complement(686742..686769),complement(686042..686679))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076500" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976818"
FT                   /orf_name="Pc24g03140"
FT                   /product="Pc24g03140 protein"
FT                   /protein_id="CAP87222.1"
FT                   /db_xref="UniParc:UPI0001832FE7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX74"
FT                   /transl_table=1
FT                   /translation="MVPKDLLHEGVMESIISLPGFSARYFPFCAQHQILQVIQLQLETH
FT                   AFCFLQRWLPSESLAAGWTCPEALELHKFFRLLEVHQGKVKDECFQLTWSTLTGWRRVI
FT                   NSIRHAAVHRIPRDRKTFLKMVRAAIKFSKCIAGFKSSKSLCRIQKFVKTSASEFDQLR
FT                   AQLKHNARLQISLGEAHPGHLARRLVLLPEAVRRVLQSVEDDFVSKVKQFLHAEFKST"
FT   CDS_pept        join(complement(688468..688656),complement(688245..688415))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670878"
FT                   /orf_name="Pc24g03150"
FT                   /product="Pc24g03150 protein"
FT                   /protein_id="CAP87223.1"
FT                   /db_xref="UniParc:UPI0001832FE8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX75"
FT                   /transl_table=1
FT                   /translation="MAPPLSRVKREQLRKRRNNLLRRHNEFWLLYGMKSWLIMELPDGQ
FT                   IFTYHSHPDTPPPSREDMNTRPKPTIVRTPRDYISATSAQSVGRDIPVFCAPVHQTQKW
FT                   EVLANHLNNNRRIVS"
FT   CDS_pept        join(689045..689104,689210..690205)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944733"
FT                   /orf_name="Pc24g03160"
FT                   /product="Putative uncharacterized protein Pc24g03160 "
FT                   /protein_id="CAP87224.1"
FT                   /db_xref="UniParc:UPI0001832FE9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX76"
FT                   /transl_table=1
FT                   /translation="MYIQSVKKLAMESHSYRSAVPTLASLKPTYTQTIGFRTSQALHDD
FT                   GSMLDVTPVSKQFPLSALNRPSYCDLLLHSSSPVSAPGDEPRTEFKHNGAITEKDSITG
FT                   AIRGPYTSTGSDDHSLFPIENSKNNTTDLLQNVTTRATFSPFAFNRTSQVWASLETPHY
FT                   EDSSGPFVESLYHSTSQIHTEASEIRGTGQSRGFQSDGASGTEWSGTAGRITGTAGHHL
FT                   SLTPNDGSQILSRTLTGTAAISQTISRISGPTSATKTSDREWHDTAIYGSNLSIRLSKQ
FT                   GTVLILSSVFEGSVALIGVFIIHCFILRYLHRHAVGSTSLLPSQRVVDSPEKRAKVIPR
FT                   TAEFSHFSNDT"
FT   CDS_pept        join(690672..690887,690927..691760)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076507" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944734"
FT                   /orf_name="Pc24g03170"
FT                   /product="Putative uncharacterized protein Pc24g03170 "
FT                   /protein_id="CAP87225.1"
FT                   /db_xref="UniParc:UPI0001832FEA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX77"
FT                   /transl_table=1
FT                   /translation="MYATPSNAESTWYGHGHSHNEASPSPASNSASCQHNPYPVDADSD
FT                   TNGLASKIDNGDRGRIMVYWKTRSAVPSRAVSPGQLPYVMLDFSFNTPTAQVGAYSIRT
FT                   GQVMTSGHQLISQNPGKALETKVSPDGRDRISDECCISCMILLVLLFSNTSPTHRITAV
FT                   ENEVERPVGTLMATIPNIHRPSLDPTTMLSHLLTQLQSKQALQRKRDDYKIMIPAKQSR
FT                   VPLVNLLGTGQILTKIETLKRRGWPKLKRLSRAVYRNSKRISRLRADLSFLQAELEELT
FT                   SRNSSSKAVVCKQEMAQNELSPRRICLIGSLLVQHYLEKCSEGPVDGNRVNIPGLTALL
FT                   IDRFPSLRA"
FT   CDS_pept        join(complement(693031..693087),complement(692922..692972),
FT                   complement(692811..692867),complement(692598..692762),
FT                   complement(692470..692568))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076508" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944735"
FT                   /orf_name="Pc24g03180"
FT                   /product="Pc24g03180 protein"
FT                   /protein_id="CAP87226.1"
FT                   /db_xref="UniParc:UPI0001832FEB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX78"
FT                   /transl_table=1
FT                   /translation="MRAGIDSASILLLLLAVLVVARPHDDPIHTATSTHPYHSSPTFPL
FT                   PKLPYEMIIEQTPACVYSHGIAYMDATTENIDHLSKVSETSCNVDAGNCHRLSYVNLSG
FT                   IFLCNYGSVLTALRASSASQQTVEALCPWRQRFNKHAR"
FT   mat_peptide     join(complement(692922..692960),complement(692811..692867),
FT                   complement(692598..692762),complement(692473..692568))
FT                   /db_xref="UniProtKB/TrEMBL:B6HX78 "
FT   sig_peptide     join(complement(693031..693087),complement(692961..692972))
FT                   /db_xref="UniProtKB/TrEMBL:B6HX78 "
FT   CDS_pept        join(693612..693714,693764..694148,694203..694257,
FT                   694422..694490)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076486" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944736"
FT                   /orf_name="Pc24g03190"
FT                   /product="Putative uncharacterized protein Pc24g03190 "
FT                   /protein_id="CAP87227.1"
FT                   /db_xref="UniParc:UPI0001832FEC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX79"
FT                   /transl_table=1
FT                   /translation="MGGSLNATLSTSGHTQSVSLSPDCEAEMESALSRCVDGPSIDCRS
FT                   IAVSLDGQLPLMASVRQHAERAAGDEVPSQQQGNCSCQLPPLNKETTRPESTQQQTSTN
FT                   TESTGSATHTASSSCELPNTSSFASISASPSAPSETHGPTTIPSPKGSGELDLNTCLIK
FT                   EADHREGGLCHCASGSAKLKSSRFLGLWNLLSNCQAIKYK"
FT   CDS_pept        join(complement(696707..697124),complement(696309..696655),
FT                   complement(694626..696248))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076485" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127946"
FT                   /orf_name="Pc24g03200"
FT                   /product="Pc24g03200 protein"
FT                   /protein_id="CAP87228.1"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI0001832FED"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX80"
FT                   /transl_table=1
FT                   /translation="MSFSRQSEVEHWERKLYDYRESHFELSARVHISHLVFESGFRRRM
FT                   DGRQNIRRLTQLMKMQGCQRLMRDNHVPVIVPRAHWQDRVRPRSGGGIIPSLDMELDYR
FT                   LCAYDHENLITAARNFLGHDDQWWIVDVYLTDNEGVSPDDHRNEAESIRHKFIQSLKER
FT                   YPNDNRPPDGLIYERINRYEGYLDTPRDPLAANNWWAVLEALAGSKKGKYLKQFFKHET
FT                   LHQKLNSLLVIPGLWGGMRIGLLHKLTAMHCDEPVACYWELVFTTFSRLVGGRDELLLL
FT                   IDGVTVELLQSRVPKFSSKDLNSLQVELEEGRLFPNFSEEARHDIWARLKEIDYPIPTL
FT                   KTFFKDRLYLEVAQSVMKRLFVQPRREKITIDQGVYGKYDTPVPVSMALRQEWLGSDLL
FT                   EFWRFSFQYGFEMTDHQRLKWPTDADPEDMLDRQSSGSSFLPKQEIWRHFFTLVRARGF
FT                   QAPVTDDTSFGTGELPSPRVCEYPEDLAEEIEVAKRCGKPYSNTVEADRFALSAETLRQ
FT                   SQASVRVTAGFLRQSVFKAFFGYLWNSNSQMAGGDPPDDNIEVQHRDERPTSANVGQAM
FT                   MATDGMDVDTGSLRPNPLVTSAAGTHNAAATASPADILPPFGVMTITVGGTTRILDLPI
FT                   HDSFMKDFSTGLFNNNFNVQTDERDKRSISPYTCYSHYLHNPSSVLHAEFKQMSILPTP
FT                   LHPRKSALGARERCLMKTSRWLERKYGYRSKLRGFRIRVTATKTFDGKGGTKFGFHQGL
FT                   EEAHGIEEAWYGRDGMSEACKNSYVNDLSYLGDVHLNGNVLA"
FT   CDS_pept        join(697626..697769,697822..698337,698386..698592)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076484" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127947"
FT                   /orf_name="Pc24g03210"
FT                   /product="Pc24g03210 protein"
FT                   /protein_id="CAP87229.1"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI0001832FEE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX81"
FT                   /transl_table=1
FT                   /translation="MKLSTKSRLNSLVSTTALSFTVAVLVCLSFVFVGCSSSSSPKGLH
FT                   FLKVDLKEFPKLRDLQIRDPFNVDTARIESRGRNAVEGVASSIHTSANEAIHEATSAAS
FT                   SMVEAQVHEFKSHLPQYYLVGLWSYCKAKDGSEMVCSDPRTSFTFDLSAVLDSTPINLS
FT                   NILPDIDLSLVSGYRRFSQSVVCLYIAGFVVTTLSGVLACRKVFFSKGSRPLAIFCTLS
FT                   SMLVTTATIVVTVMYGVFASKVKNTLQPYGVEVTLGAKMFTTAWLAVFFSIGGSTIWLV
FT                   HLFCCCI"
FT   sig_peptide     697626..697736
FT                   /db_xref="UniProtKB/TrEMBL:B6HX81 "
FT   mat_peptide     join(697737..697769,697822..698337,698386..698589)
FT                   /db_xref="UniProtKB/TrEMBL:B6HX81 "
FT   CDS_pept        complement(698937..699455)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076506" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823667"
FT                   /orf_name="Pc24g03220"
FT                   /product="Putative uncharacterized protein Pc24g03220 "
FT                   /protein_id="CAP87230.1"
FT                   /db_xref="UniParc:UPI0001832FEF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX82"
FT                   /transl_table=1
FT                   /translation="MSAFILSCQQLLFCLIDIQPDRPTDRPPWLCNWCLSLCKCRTCES
FT                   IVILPLFRGAIMEDIVQIVRQIGQQQAHNAYYRDCYSLFKLLQELTEHTFTELQRLYKF
FT                   GTGRSANSVHQLLRNFQNTICNLVERACEAQAECEEFCSVNESHSARVVFEPIRRMYTN
FT                   PQASLQGTR"
FT   mat_peptide     complement(698940..699395)
FT                   /db_xref="UniProtKB/TrEMBL:B6HX82 "
FT   sig_peptide     complement(699396..699455)
FT                   /db_xref="UniProtKB/TrEMBL:B6HX82 "
FT   CDS_pept        join(699682..700253,700631..700703)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127948"
FT                   /orf_name="Pc24g03230"
FT                   /product="Putative uncharacterized protein Pc24g03230 "
FT                   /protein_id="CAP87231.1"
FT                   /db_xref="UniParc:UPI0001832FF0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX83"
FT                   /transl_table=1
FT                   /translation="MDTLDYQNLRSCAIGAIIGTLGFSYFVIYLLMFLIFHFPSSQQSI
FT                   PYALAVMAFGGGSAIWYLCVIFQNGLSAFQREKMTKEQDSVWFGALFLVWTAALPTIAF
FT                   LFPAQPLLQLGYASAFTMIAVGSLPDSYLKDMDMGAFSARLSLQFATVVLLALVPSIHA
FT                   LAEPLHAPSPLATAFGRLVLLNLCGYALWESLRVFFRGARRNVTDLESPTF"
FT   CDS_pept        join(704050..704403,704448..704816)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944737"
FT                   /orf_name="Pc24g03240"
FT                   /product="Pc24g03240 protein"
FT                   /protein_id="CAP87232.1"
FT                   /db_xref="UniParc:UPI0001832FF1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX84"
FT                   /transl_table=1
FT                   /translation="MPKRSNEKRLKLNQQCREALAANICICGPLLTITQLILLDDRLRI
FT                   VVAPEKVRLQPRPEDGYAWSVTSANASVLKSSLSSGKIHLYRKICNEIGHSIEAVPPHA
FT                   LGHSQSNTSCISRESLEAESFGDGMDGSFTAEISKLKAANSSIEIELERIRARLNDCLD
FT                   ESHTVRAEANELRHDLQILRSHNKKLHDELTEAKAGIAGARRILNSLQTEGIGIELGTC
FT                   DIQSSANGIHEVASEALD"
FT   CDS_pept        join(705764..705922,706020..>706220)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200310" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944738"
FT                   /orf_name="Pc24g03250"
FT                   /product="Putative uncharacterized protein Pc24g03250 "
FT                   /protein_id="CAP87233.1"
FT                   /db_xref="UniParc:UPI0001832FF2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX85"
FT                   /transl_table=1
FT                   /translation="MAKNHKAFREQADYCSEVQLRAASSCYPLRSTRSRSKDDRNPLKP
FT                   ATGLHKHTASSITRLRKPRLKHDKASHRKCLHMMSIVEEEIQKAQEEREEERHKHCQLL
FT                   EQLEAEKAEETSKLQL"
FT   gap             706229..706328
FT                   /estimated_length="unknown"
FT   CDS_pept        <706330..706704
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076510" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944739"
FT                   /orf_name="Pc24g03260"
FT                   /product="Putative uncharacterized protein Pc24g03260 "
FT                   /protein_id="CAP87234.1"
FT                   /db_xref="UniParc:UPI0001832FF3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX86"
FT                   /transl_table=1
FT                   /translation="AARDVALADNQRVGHEICELQQQLESTNAALQDQVPWNDIQLVLD
FT                   QAHGDMVSTTTRFWNTIDALQNRRLASYLPGSGVIHADWAEQSGPVTQGHDALLSLSES
FT                   NVPLPSQQEPSATNQFGSLV"
FT   CDS_pept        join(complement(708190..708518),complement(708117..708134),
FT                   complement(707883..708063))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076481" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127949"
FT                   /orf_name="Pc24g03270"
FT                   /product="Putative uncharacterized protein Pc24g03270 "
FT                   /protein_id="CAP87235.1"
FT                   /db_xref="UniParc:UPI0001832FF4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX87"
FT                   /transl_table=1
FT                   /translation="MGGIRKASRPLRRPDFRGRLQRALSLSSLESEDTGSVSSSATEDT
FT                   TGDESPSQEENDSGNQQNSDAADESEQEAARQRRTVFEHETDLEIRGQTQLSGDSNTVA
FT                   LERLTELDNRMGSIERSSHDQATWNETIRNDLVDILGRLAIVETEVQKVNRQGTNKSTE
FT                   GQKTGRSLRRQQ"
XX
SQ   Sequence 709213 BP; 184064 A; 169780 C; 170134 G; 183156 T; 2079 other;
     tcttaaccac tcttcttaac cactcttctt aaccactctt cttaaccact cttcttaacc        60
     actcttctta accactcttc ttaaccactc ttcttaacca ctcttcttaa ccactcttct       120
     taaccactct tcttaaccac tcttcttaac cactaacacc cccaccctct acttgccact       180
     agatatctct gaatattatt tgcgacgatg ctcagtaggt tgcttgttga cgcaaacaga       240
     tgtgctgatc tcaagaattc atttattagg tacgttagcc agatttcaat tttaagaatt       300
     agagaaagcc aaattaacat ttcgcaaaat acattgttta cttttatttc tcccccagca       360
     ggagattgga ctcatacggt atcaggttgt gcatctggtc ctgaaaattt gcccacttta       420
     cgattacact gacttggtct ggaggtccat ccagcctcac atagatagtc tttgctccta       480
     agccagagta gcgtcattga gtgtcattta gccgaccttc aatctactga ccatcgaggg       540
     cttctgtacg aaaatctatt tcacgattga ttggacatgc tatttttctg ggtttggatc       600
     aatgttatta gtcgatacag acacgtgatg aataatgatt ggggattgga aaactgaaca       660
     agaagtgatg ttatacaaca taatgaagga gagaaatatc gggaagtact caaagatata       720
     cgtacacatt cagactcttt gtgagatttc acgcctaaac tcaacaggta aagacttcca       780
     caggggtaga atctaataga agaaaagatg ggaaagacca gtaccaatgc aaccgtgatg       840
     cttcagatca cacgcccttc tcctgtcaaa aaaatctttt atcatgtatc aggagctatg       900
     gaggctcgat aacgccgaat atcttcatct tcttttctga cccgctccag cttgaagaag       960
     ttgtaaagcg caagaagtgc tgaacagatg agaagagtta ctccagtaat aacggttgtt      1020
     ataatagcca ttaccgacca atccccacct tgagatgtac agacattgat gacagtggtc      1080
     agcagcccgg cagcagcatg taggcatagg ggtctagtcc agaattagag ttggatctgg      1140
     cttttcatac ctctttcagt taggatttgc tcacttacac aaacactttg ttgatcagca      1200
     aggggtagtt tcccctaagc tttgggaaat gcatctgcca catgagagcc gcaattccac      1260
     taacaaaaag caagcacgca atggcgagta gtggggggtt ctgaatcata tgtagaactt      1320
     cacggccggt cctgctggtt tgtaacgtct tttcaacctg gtttgaggtc tgcaatgaag      1380
     tgaacgtgcc gggaatgacc agatagccgg ccagcagtgc ccagttagcc gcaccaaccg      1440
     tgatactgaa acgcatgtcc atttgtgctt cttccctaag aattttggca taggtagttt      1500
     cgttggcgtg atgttcctgg taggctctac acagccccgg ggtcacatcc gcagctgagc      1560
     aaggcggaac aagcacaggg tttattccag gaagtgggga cttttccgat cctatcttca      1620
     ctggcatact tatatggttg ttcacaacga aggctatgac caaggaaatt tcagggttac      1680
     cattggaaga caaatcaaca aagaactttg tcagttcttt aaatagtccg tagggaaaag      1740
     gccgctaccg tacttagtca aactaggtct agcttctact ataggtgaag cctcattttt      1800
     gccttgcgat aagccttgca tggtctggtt tccgaagtca gaaacgaatg gcttctgata      1860
     aaaaaaatgc ggaagttgtt gcatacttga tttaagcggt cgtcatctgc gaatgcactg      1920
     gcggaaggaa tcagctgtgt gcggcggttg ctgatatagc ggtaacatca ttatattacc      1980
     ttcagtggcc attatgtcta ggttcaggta tttgtgacaa catgggaatc acgctacgtt      2040
     ttcttcggcg gccaacatag atctttctca aacaggccca ctgatgagaa gccagatccc      2100
     cactgtcaat tttgcttgta tatacataga tatcttgaaa catgcaaggt ggatagcatc      2160
     atgtccattg atttgtgggc agaagggatt gaacattgag gatcataagc tcgctacatt      2220
     ccgtgacgct ctcgcggcag ctgccatacg atgtacaaat ttccagcaat atgaaacatg      2280
     tcgcgagggt tcggatctca gagtgtgtgc cagtcggatc gtaaacccta tcgaatcatt      2340
     agcccacctg gaccaccgcc aaggctaccg ttatatctta cctggtagtc tctcgtttgc      2400
     tctatccgag tcattcgtca agggacggca taccgaaacg gccagctgct cgatcgcatg      2460
     aatcaaatgg cgaatctttg tgcgggagcc tttaggtatg aagattggaa gagatggtaa      2520
     gcaagatatc cgagcttctt cgtgtcggac aaaagccgaa ggttgaaatg atcccaaaaa      2580
     tgtacattga cgacaggcct atcattagga tcccgtatgc aattcgtctc ttgacaccag      2640
     aggccacctt tcttccttag cattgcgtac gatactagat ttgtatggaa tccaggtgag      2700
     tatagagtat agagtatcac tcaatgtgat ctccttcctt cctttcgctg ggtgtcttcc      2760
     tactaggcga gctgtacccc tgccgagtat ctttgtggtg ctgtctccag ttgaaacttc      2820
     tatatcatcc ggggtgaagt caacaaataa gctcctatca ttacagatat gcgtactcga      2880
     tccggtatcg agaatccatc ggtcatgtag agagggctca tcactttttg ctacagatag      2940
     cacatgctcg ctgatctgta cggcttcatg cttttggtag gtggtggcaa agctaacctg      3000
     gttagcatat tcagcctttg gctgagcttc agcaaccacc ttttccaccc attgcttcca      3060
     ggcgaggtcc tttgctaact tctttttcgc tttctctagc gtacgctcat tgagagtgta      3120
     tccctccggt cgaattgctt cattcatgat atagcaagta gcaaccttat gcttcgggtg      3180
     agagctgcca cagggacagc gtctcttttc aaatgggagc ttctcttgct tcacttccgg      3240
     tttcgcttct tggtgtcctt gccaggttga aaatgcacct tttggagcat tagttgaggt      3300
     cacagtttga acacctatct cacgattcat agcgcggaat gattcgagaa gatctcgagt      3360
     atcgtacagt acaccttctt gtccatgaca atctcctggt atttcccttg ccaccagata      3420
     gggagcgcct ctttcacagt gtgtaggaaa tccctatttg catctccatc attgatgcca      3480
     aggctgacgg cttgctctct tagtgagttc cactgctgaa gccattcctc gatatctcct      3540
     gtcggcttct gcattgcaaa gaccttccac ttcatacgga tttcttcttc gtacgcagtc      3600
     gatcgggcaa agcgagactt cagatacaca agcctatcat acggagtacg atatgcaact      3660
     agagagagac ggtggattgg atcaaggtat gtgaggatat attcatttac atcgctcagt      3720
     ccctttgtct gcttctccca ccttgtgtac ttcactttgt acacatccat acggtctcgc      3780
     cagatccttc gttccttctc atcgccttcc tcggggtatt ggggttccac cggttcttgg      3840
     agaggctcgg gccgtttatt agcgggatcg gttgtcgacg aggtgaggtc tggattacag      3900
     agatcccaca cattcttttg tacggcatat agctgcacct ttgcaaacca ggtgagccac      3960
     tgcggcgagt ccttcagttt ttcgcccttt gtggcggaga ggaatgatgc tgcctccatt      4020
     actggattca ggggtagctt tgcacagctt cagaatagct tcgggggttg cgagacactt      4080
     ctagcagcgg gctagatact gtattccaac tacagtagtc tcattcagtg cgaaccgggc      4140
     tcataactgt cggcgtgggc cgtattgtaa aaatgtaggg tccaatcaat ggtgttcaac      4200
     tctctgtatt gctgtatcga cttccctaac aatttatacg ggccgtcgat tactaatcta      4260
     aaattacaaa atgcatagga tcaatggatc ctccggtatg ccggtatgcc aatgcatcta      4320
     ctccgacata ttctgtcaac cttaggattc ggccccaaaa gatttgatct cataatttgg      4380
     ctttttgatc gtcagggttc cgctcggtat tgagaaagtg aaacggcctt gtgggcttac      4440
     tagtctcact ctctaacaaa gccatgcaaa ctcaatatta ttcttaaatc cgatcatctt      4500
     ccagaactgg ggatggttgg aaacctacaa acatagttat ctccactaag ggcgggccta      4560
     ctatttttgc acgttacatg cgtgcagctc ttagtactat gtaagacatc cagtttcagg      4620
     ttgaagctct cattttgacg cagctactgt ttcatgcaga gaactcggta tcacggtcac      4680
     acctatagaa gagctctaaa tttaatataa atagctgacc tagaatctta aacctgtttg      4740
     tttttcctag gcccctaaag tttttggtcc tgcttcctgg ctctcatttc ttgtcattca      4800
     ccatgcttct cactaaattc tcatctcttc tattgctggc cactcaagct gccgcacatg      4860
     gcctaatcac ccgtatcatg ggtgcgaacg gtgttgagat gccgggacta acaggtaacg      4920
     ggttatcgtt gagccctccg tattttcaac attggttaat gattgactct agttgttgat      4980
     ggaacgccac gcgactgccc ctctgcggtg tgcggtgggc agaaagatac cgcagtgata      5040
     cgagatcagg aaatgggaag tatcaaggct tcggctttgg gccgcactct aatttctggt      5100
     cctgtagacc caaagagagt aatcatgaat ttcatgacac ctaataccga cacgcgggtt      5160
     cacacccgcc attttcatca aggtcttcca tattctcgca atattaaatc ctactccggg      5220
     tactaatgtc ttttatagcc cgccaactga tcaacgacgc ggctagtgtc gtcactaatg      5280
     ccggcggagc tattctgaat ggttagtatg agcgttaaat tttctttatt ctgcacaaaa      5340
     aaaaagaaga aaaaaaaact aagctatcta aaggcgccca ggatgttgca gacaaaacgc      5400
     cttttggtgg tgctatcaag ggtaaaccct ccctccttaa ccaccaagat ttggtgctca      5460
     tgacatcaaa caggtgcgca atcagctgtt gatgatgtgg cgggtactct accacggaca      5520
     gaatctggcg cagttacgcc cagtggcact gtagagaaag gggtcgaggg ttatgctggc      5580
     aaaggttctg tcaatggatt gccctctgtt tccgacgcgg gggtcatcac gatgacttat      5640
     catcaggttc gtcacaggcc gcggctctac tttactcacc ccatgcttac ttttccgaca      5700
     taaaggtaaa ccaagacggt gcaggtcctt tgtcggcgga catcgacgca acgagtggag      5760
     gtacggacat taaagcgttc aaaccagcca aagttatcca aaacattcca ggggtcgcgg      5820
     gattttcaac ctccagcacc atggattatg aggtcaaggt tcaactgccc tcagggatga      5880
     agtgcagcgg cgttgttggt aacaccaaaa atgtttgcat catgcgggtc agaaacaatg      5940
     ccatttcagg cccatttggg ggttcggctg ctttcacaaa ctgatgtgtt ggatcatccc      6000
     agaagctggt agatgcttac agactgagcg ctttgcctgt ctgtctttgc ctgtctgtct      6060
     ttgcctgaca gcttggtttg ccagtttctc ggggtataaa taccctgctt tttccataga      6120
     tctaggaatc aagattattt ctttcttctc tctcattcca tcttcataga aatcttccag      6180
     ctaccggatc tgtagctgcg tcataatgta atatggaaat cactacaatt ttgaacacgt      6240
     tgatagccta ctacatggtg cttgaaacct tcttaatcgc acgggctaga aaatatttgc      6300
     atctagctat tgtcatgaac ggcctgtgat gtaagtggct cttgtctagt gaagggagat      6360
     gaaggcaacg gcttactatc tgactccctg ctgtcccctc agatccaaaa tgagcttcac      6420
     tttcgcggaa attgtagagc gatttaatct tcctttaaat tccgtttctg caccaactac      6480
     gatttcctat cggagtgggt cctcgaggaa tcgatcacca ttccctgtgt gatgccccgg      6540
     aaatcgacga cctttttgcg gcgagactat tatgaccggc ctaaagtcat tcccgacggt      6600
     atgaggaaca tggccatggt gggcagttcg tcgttattcc ttgtgaaatg tctgttagta      6660
     tggactattg cgtgcgtcgg gcagacaata gatcatccca tgggattagg ctagagcttc      6720
     aacgggtttg agcgagcgca ttgcaatata tttgccggaa atatgcccct gaagcgcctt      6780
     aaaaagtgac aaccttgaat ggggctcttt tcttgtcagt gtcgttaaat tcgaagtgcg      6840
     caggctgctt ataggataat tcgtccaatt tccaaagccg ctgtggcaat gctgcaattt      6900
     actgtactac ttaagacgtg atatatgtcc ctcctcgtta tcgtagaagt attaaagtgg      6960
     taggactcta tgcaagagca aaaagcaaca tagaaggaat tacatccccc agtggctctc      7020
     ggaaaatttg acaccagtcc cctatttaga tcattcccgg cggagggctg caaagagttc      7080
     aagggctcat tggcttccgg ggttgaaatt aggatcttcg tcgcctgagg tctgcgtcac      7140
     cgttaggagg cttgggattc tttgcatgtg cgatattttc cctcccagac tgagcggtgg      7200
     agtaacgagg gtctgtgtga ggagtgtcgg agctgaataa tccggagtct aggatgccga      7260
     attcgctgaa gttgaaatta ttgaatccgg aatcaagaag attgcttttc tggatgtcat      7320
     ccgaaggacc atcgtctgaa tcggcaggag agacataatc tgaaggaagc aagtctgccc      7380
     acttgtcgcc cacaaagtta atctgctccc cgattagata aaggagtttg gctggccaga      7440
     tgcaccatca aagatatcga gtatcatccc agtatggcat ttgaagacct gcgaatgaag      7500
     gccgtcgtgg agcagtaaag ggaaaatgtg ttgcttattc ggggataatt gttgtcattt      7560
     ttgtgaccga ggaccttgct ggcttttttg gatatgctgc atgcgctcca cggagggatg      7620
     gacaggtgtt attggcgacc tagtattctt cccttcattg aggcttggag aaatcgaggg      7680
     cagcgacaac caattatgac aggagtgttg atcaggaggt gatgtcgacg aggagtcggg      7740
     cttgtggtgg gggggggcaa ctcgaaatca aaggttggac tcttgaaaag acggccgggg      7800
     tcatcatgtg gagtgattgc atgattctcc ttctcatcgt cccgcttgtc gtgaggcact      7860
     gcgagcgctg cattggggag aacagcttct cacaaataag acaccaatca acggcccctt      7920
     ttgagcgttt ggggaaagcg accttcgcac atgctttggg gcgaggcctt tgttatctgt      7980
     tctcgagata agtcgcactt ccatattcct cgccatatta gattagaagg cgcgctgcag      8040
     gtcctccatc ggatgctgct catgtcgacg atgttcggcc gtataagtaa gccggcgcgt      8100
     ctcggcgcta atttctcggt gttggttgtc tgcctctacg tcgtcgccat tgtcatgggt      8160
     actgctcata ctaggagtta ctcctttggt tagaatgaaa gacaactcag tgggctccgg      8220
     agatgatgcc aaaggcttgt tggaggcagc ctacctccga gttctgaaag cagggcggga      8280
     actgaacggg ccagtctttc ggttcctcaa tggacgtttt tctttttctc tagtagcttc      8340
     ttgttccacc tgtttcctgg gcgcatgttc ttgaacctat agagccgggc cacacggatt      8400
     gcagaagagc atttggaccc actcatcgac ggtcttccca ggagctttcc tatagatctt      8460
     gaatttttgc atctcatcct gggcgttgtg ttccaaggcc aaccagaaaa gcctgctaga      8520
     gtccacctct ttttgtctct tttgtcgggc ttatgtttac cagccagcgt aggatgcgtc      8580
     tccaagtcat aagaaaaccg tcactgttcg gtaaaccaac gcgaccgatt gggaaacaag      8640
     tctgcactgg caaaagccaa gcactgctat ccacaaggga gccaacgtgg ctcagatgaa      8700
     tatcttctat ggaagaaaat catatgctgc tggtgtttgg tgtgttttgt gttcaagttt      8760
     gttgtcaact tcctgacacc attcaccatc cgtccatcgc caaaggtgct ggaacgagaa      8820
     cactccggct gaaccacggc catctaacaa ccccaaaagc gccagagatg caatcccttc      8880
     ctcacgttcc tattcatgac caaatatgat ctggcagcca cgttgctcct ggagatatgc      8940
     ttcaaaccaa ttggtggccc gggcttcatg tggatacggt aactaaattg aaacatccgc      9000
     gattcggtcg ttggtatatg taccgctatt gaggcaaaat attggcatct ttagtccttc      9060
     tagaagccgt cgttgacaat ggtagcccgc aaaactttga ctgtgtatat atccctcacg      9120
     gtggacctga ccgcttcagc cccaaacaat taaaaggttc tgattgtcca catgatcgat      9180
     gccctcgttg ctccaataac ttcatagtac aacacatcac tagcaaggcc aagcgatcat      9240
     ggatcgcaaa cacagtggac gtacatggca aactggcatc gctactttag atccccttct      9300
     cgaggaatcc atgggctaac aaatttactt catgaagaca atgaatcggc tgaaaacttc      9360
     catcgggtcg ctggccaatt catccatgga aatagcggcc acacaagcca ggttttacaa      9420
     ccgcctgttg accagtccac tggctctgta gctacagggg tacttacttc cgttggtacc      9480
     tctcttgcta gctcaggggc ctctacgttg cctccaatcg tcataaaggc tgaaagccaa      9540
     gacttggctc tctgaatgcg aaaaagagag cagccgaatc ctcaaccctc ccacgaaagc      9600
     gacgctgaca ttcattccac ctctcaaata tcgagccgct gtcaacgggt gtatcgaaag      9660
     agtctcccaa tccttatcaa aattagtagc aaaacggtta acgatacaat tcaatacccc      9720
     caacgctatc cgaccgtatc ctctgtttcc cggataccat gcattgtgca tgttatgtag      9780
     cttagcctaa ttaaatacct acctgaagag atcaaaatga acaatattgc aggggcggtc      9840
     agagtggtct gacgaaggaa cgaagtcgct acagtccgct ccaggtcact attatttcag      9900
     aaatatcgtg gctacattaa aaaagccgaa tgagtcatat tatattctag tttcatacat      9960
     actacaaaat tttagattcg agaactcgct gtattggtta acgccaatca ccagcgcaga     10020
     aaggctttcc gggcgctttg aacgacaggg ctaaagattc tatctatcca agatattccc     10080
     acacactgga atgctacatt cctaacgctc gaacgtgcga agaagctcca acgagagttc     10140
     aatcactcct gtcagctcga tcaagaggaa tggtgctaag tgcttttgat cacaatgtct     10200
     ttttccgtta cactaagacc ttatcagact caagatgtta ctcttcattc cgtctgtatc     10260
     atctataatg agctcttctg ctaccttgat aatgcagatg agttattagg acacaaggct     10320
     gttccctgac aaaggagaat tctccaggcg cctcggggga cgagaatgga gctctcaaaa     10380
     tactgcaaag tttctgacac tgaacagttt ggtacaatct atgctattgc aacaattata     10440
     tgtccatcaa aaaatcttca gttcttcggg ggcgacaatt ggaaagtgaa aaatgagaag     10500
     ggaggacata ttccttggtg tcgatctttc gggttataat tcagaaggaa ctcgaccagt     10560
     gccaaaaacg tattaccccc caaaagaagc ccttaaaagc ccaagtctca agaggtcaag     10620
     gaacaggagc ttaatcttat gatggactcg cacgctgcat gcaaggagaa gttgaccaaa     10680
     cagaggatga aattacacgg tatatagcaa aggatctgta tacctccctg ctttcattgt     10740
     atgttttttc agctaagtag tctaatagtt cttaccaaat gcaaaccaaa agttttatgg     10800
     aagatgcata agcttgagta tccagtgctt gcagcgatgt gcgtgttcac cgtccgaccc     10860
     agacccatta ctgtgtcgta cggaagacca tttagaactg accgatcact tcttggtggc     10920
     tcccagtggt agcaagaacg gtatgtggac gcagtccacc gatcttccat tccccgccag     10980
     tcaacacata gcacagctca agataggcac tggaatccca ttcggctgtc ttgccgtcgg     11040
     ggaacttcct gacatgccga gctcggacct gccaatttcc tatcgcttcg gtatcattga     11100
     cacgtgtgaa ggctacactc ccgagaaaat gttgggtttg cacttccaag tacattagta     11160
     aaaacaagga atttccacga ggtgataact tacatcttgg gtcaccgagc cggtcctctc     11220
     ggaacgcgaa attaacaaaa tcgtcgggag ggcagtgttt aaccacccca acagctgggt     11280
     aatcggtata gtcggctatt atccgcgatg tagcgatgga aataaaagca tctttatcct     11340
     gtcatggcat caattgagaa ttgtagaggt aaacgtggga tactaatgta attaccctac     11400
     ctttttgtcc caggccatgg cccatttata tgccagttca cgaaattttc gctcatctgc     11460
     gatggtgtaa tccattattg atgggtggta ctgtgccctg cgtgacgatg tccaagtcca     11520
     aaacaaaatt gctgcctcta tttatgttaa ggttagtgcg ttttcaaaat ccgtaggagt     11580
     cttctgcagc ttacaccgac gccgtaggtt gttcatttaa gggcccataa taggggtcat     11640
     gcttccaaat gatgtgaatg ataatgcaca tggcaaactt cacctgccga aaaacacggc     11700
     tattcggcat ccctcgggtt tatcggttgg atttcggaga taagcatagc gtctgctgtt     11760
     cttcctgact tggttagaca attgtagtcg gttcagtggc acatttaagg ttttagtatc     11820
     cagttttaga taatgataga caacgggttt tggtgttggt cagacgccga gatggcacgc     11880
     taaatgctgc atctgcaact cgagccctgc catgaaactt gatctcgcta ccctccggtt     11940
     actcctagct aggttttata gccgagatgc cgtaacgaag acctacactg cccagctccg     12000
     tgttcagtta tctgtgcttg agtttctatt gttcttgggc gttcactatc agaggagtta     12060
     gtaagcggaa gtacggagct ttcccatttt gccgagcaga tttcacggac atggatgctg     12120
     tatgtgggtc cgccacattt tttcctaact agactgaaag tctgcatcgc ctctttgtag     12180
     ccccattgag ctcgcactgg gcagcagtcc ttgccaggcc gttgagacta tggattaata     12240
     ccttctcgtg gtgtccggtg ttaatccctg ttggggagac cgatgtaatc tgccaaggtt     12300
     gtgcggttgc ggcccgtcgc ggggtaaccc gaccgcacaa tcactccaaa atcaggggat     12360
     acggataata aaaaccatcc gacttatttt tatccgactc acactcgagc ccagaagctg     12420
     gtcttgcgtt accagtagaa gtggtgtcgc cctacaaata aggcaggaca ccccggagct     12480
     tgcgtacggt ctggggtcgc atagtgcgag atgcggcgag gcggtagtaa accgatgaca     12540
     caggcagtca agctgacttt ggacagacct cgctcaaggc ccgggggcct tgttagaagt     12600
     cgaactcgtt aagacgatga cattctgcac ttcacacctc gttaaggctc agccacgggc     12660
     agccttgggt gcagctgttc ttcgagacac aggcacaccg agacacgggc atcctcctgg     12720
     gagatacacg ggctatctgg aagagggtgg taattggctg gaggccaccg acgggcctcg     12780
     tcaaggcttt gccacgggca aaccgtcgat cctgtttaga catcggggac caagcttggt     12840
     tagtggagag caaccgacat acaccgccgg atggggtgta attgagggct tcctgtaagt     12900
     cacggtcggc ctggcggagg gaggcttcct caggtaacgc gaaacaaggg tgcgaggtct     12960
     tgcggggcgt ggtatacaat ggcagccact gcgacctggg tcgcgatcgt tgggaaagat     13020
     cgtcatcatc acgggacgat tgaatcgacg tgcccaggca catggcgaga gtcctgaatt     13080
     atcctgtaga tcagggtcgc tgccaccaga aagtagcgaa tgcacggacc catttctgcc     13140
     tgcgaagacc gctaggtgga gcgccgttcg gccatgtttg tgcctgacgt ccactctaag     13200
     gcagggctgt tctagtagtt acgctcttgc cagctgatta tctcagctgc ctcaggaatg     13260
     ctcggcagca agatatcttc ccttttcttg ccatgtatca cttctagcat gtcctcggta     13320
     caatacaagg tagcaagcag aaagagagtt tcgtgcctca tgactgatca tgtccatgga     13380
     tagttccgat tattgttctt tgtggtctta tgcatccatt gcgagttgtc gctgggaggt     13440
     ccggccttct ttcccggtgt tgtatccgcg actgtgcaaa tggaaacaac acgttcgttt     13500
     atatcaaaaa gttgcccaga ttcgacgccc aaccgaattc gaacatcatt gcagaccaca     13560
     ttgtatcctg accacgggta tgatacccaa tgcgcaatgc ttctttattt ctcacgccat     13620
     cactatagcc agtgacaccc gattaaagta gtctgaaaag gccgaacaca accaacaatc     13680
     cgggaaagtc gcgttagaac acgtaatcag atcccaactg cgcttcacag acagtattga     13740
     ttttgacgat taataatagc tatgccatgc gaaatgatgt tactcagctg ttgtgcagtc     13800
     ggtttctcaa tcaagttgag gtccatgtcg ttctgtatat cagattgatg agtttactgt     13860
     tcccgagaag caggactctc atctgccgtt cacgcaatcc atcattgttc aagtttggta     13920
     attttcatcg caaatgtaga cattgagaca tgactaaatg ttgtggctgc tgtcttgcct     13980
     tcttggagcg gattaagcca acatggtacg ccctgtctaa aaagcccagg attacaaaat     14040
     gaagaagatg ccgcaagagg ttacgtgtac agtgagagtc tttatcgaat gccatttcta     14100
     tcctgatctc gacagtctgt ccgggttcaa gtggacaggt ccagaccctc tgtccaactc     14160
     tactcgggct agcgacattt ccctccacat gtcagcgctc cttttcccta aagaggtgca     14220
     atggatagaa tttcgatttg tgcgatttga gcgggtgtct ggtgagacta taggagagga     14280
     tatgttcttc ctgccgcggg ttgaaacggc catggggaat ctctatcgga tacgcagaca     14340
     gctactagac acaatcacct ggcatgctgt tggtgcaaca ggcactagct tccgactgtc     14400
     cctttagcct ggtacggaat ccctaccgta ttcgagtctc tcgacgcatt ctctgttgac     14460
     tagccttccc cccaacgcta tccctggacg cacggttttt tgtacataat atatcgagta     14520
     attacgagtg agattgatct gaattaagcg ggcttgtttg tatactcatt tcagtaaaga     14580
     ccacgataat gaataatgac tatttgatgc ccttcttgtt aaaagcctcg ggaatatata     14640
     acctgctttg catgcagcgt gattcccctt gcaatacgtc gccgcttgtc gtatttatat     14700
     atttccaata taggacgggg caacccgaaa taggcaattc cttactcttc tcttgcgacg     14760
     tccgtcaacc ctgccaaatt gggactgtag gggtagttcc agtcatcgag taggctaatc     14820
     agtcgttccc gagatgattc cagtgcttgt tcgaaaaagc gcagtcgagc tacctgcttc     14880
     ttgtggtgaa gctgaagacc gtccctctct tttctcaggt gtgtaccagc ctccttcaag     14940
     atctcattgc tctgctcaat cttttggaca tcgatgtgct tggaaacgca tgactcccat     15000
     aggcgtcggt agagtccaac gagtcgggct gctgggaatg caaacttggg atcgtcacgt     15060
     tcaaggtctg ctagcacctt caagatgggt tgaaatggct cggtcgccaa agtatgtctt     15120
     gttactactt cgtgttgcga atgggagggc tacgatggtc agccgaagaa ttcgaagccg     15180
     aatggtttca cttaccaatg gagggacatg atcagaagga tccacattat tgcccttatc     15240
     attaaggatt ggcaattcat tgggctgctg ttctccttgc ttttcctggt ctgacgagct     15300
     gtttggggag tccatttagt ccacagaaga aagtcaagga tctggatagt actgtttccg     15360
     acaagccttg gtatctctta tagactatgc agacgcaggt ggctacggac tgaattttac     15420
     gatccccaca tcagtcaatc aacgcagtca gtttctgaat agaatttgct tttattttca     15480
     gcgggcgctt ggtagtgtat ttgagaggag gaatgtcaac gagttggccg ggaaaactga     15540
     tcaagcctga cgatgttgag ggccagatat gaacgcccat tggcgtgaga gatatctcaa     15600
     ctagacgcct cttccacttt cgttggaagc ctcagaaacc cggcaaacag cattgcagaa     15660
     tgggtagttc ggatagtaac gaagagcaaa atagaacaaa aaaaaaaaaa aaaaaacaca     15720
     atttatcttc gaagtttggt ggtcatcact caaattgagc gttgacaacg tttggccaag     15780
     cttcaacggg ttgacgggtc atcctaccgt gacctcgctt tctgcagtct aggcagacag     15840
     acccacagct caccacagac caacacaaca ctaaagcgag gccagaaaca aaggtccatg     15900
     attcatagtg atggaattgt aggagctttt cggtgatcca acgttgagtc gccaacatat     15960
     gaggtgacta ggacaataaa tatgtgaata tgtgcctgtc attgcggatt gaatatctcc     16020
     cacaaagcct caatttaaga gggacgtgaa ggattcaaca gtcagccaac attgcttgac     16080
     cgactcagca tccctttctc tcagcaccac tcttactcgt ctctcgctgg gcatctaaag     16140
     gcatcaagaa tgtcgctgca aatagttgcg gtaaaagaag acgtgggttt caacaggcct     16200
     caattgagaa atgtgtcctt caacacttcc aaccaggtcg gtgagtgaca gaagtcgaaa     16260
     agcctatata tacgtcctct acccctgcaa ttgctctact atttattcac ttgattctgc     16320
     aaagtaggct tgttgtgtct gacgcactcg ataagttccc ccctttgatc gagtactgga     16380
     gtttataccg tactgacatt tatagtatac atcgtggacc agcaaaccag acagttcctg     16440
     tactttaaga gacgtggttc caagcagatt cactgcccca tttacgccag ccgatcggag     16500
     atacgagatt tggattagct agtcaaggcg tctatgcgaa gacgtctctg ctatagcaag     16560
     ctgatctact gtcgcggctc tggttgacca cagatttgaa gtgcaactgc tcacactgta     16620
     ggtatatggg cccacagatc cttgaaacta cactgacccg aaagacgcgg gacagccaga     16680
     tccgtagacg ttcgaacaca atgcaccaga gcaagggcca ctcttcatcc ctggtcttga     16740
     ccatcagaaa atgtgagtta tggaattcca cgctggtcta ctggctaata attgatagtg     16800
     aacctttggg agctcaacca gagtggacct gataaccctg caccaccgtc agtgcaaagc     16860
     catggcttac acactattcc tagccctatc gcttcgaaca atgcagcatg tcctaggtgg     16920
     aagatcgcaa accaagatag cgattcaaca acagggtgcg gagattcaag tgcaaactta     16980
     gtcgcatcga agcttgaggc gtccgtcctt cctgatagtg agttatcgcg tcttctgctg     17040
     cgccggtccg attaaatata ccaagccttg tgcccaaaat cacgacacca ctgacacctt     17100
     cacgctatta taggagcacc cctcatcgac ggtgaaatat actgtggcga gtggcctatt     17160
     ccgccagatc gaggataaga ccaaggtggc gggcgaacag cgtgctccat cgcatcgcgt     17220
     cttccgcctt cgtccccacc gccttcgcac tgttgaggag tcctgaacct ctggcatcgc     17280
     gacgcgttca tccgccatgg aagtgcaatg tttatcgcgg gtgggttcgt aacgcgcgtt     17340
     tactgtctca acaaattgcc ttgggcaccc cagcgcggct tttttgaaat gagtgcagat     17400
     tgcgatgagc ttgaatgcga cgtggcatgg ctggtgactg cattgcagag agttgtaagt     17460
     gatctagttg tgaagccgat atgaccattg tgcaaactga tcgtcacgtc tcaagcgcac     17520
     tttgggattc ccatgaacag gtacgctacg acagctcgtc caagatcaat ccttgctgac     17580
     tcgaatcgta caacaggagg acaccctcat ttctgtcact cgagtcgaat gccacgcgaa     17640
     caaatatttt gtctgctcca gctcccctat acaattacga ttgcatgctc tctgtccctt     17700
     ccacatgaat actatcgacg atgagtcacc agaaagttcg tatcgcgtac ctcggcctct     17760
     gtctccctat tgattctgtg tatcaggtca ttgttcgagt tcgatttgtc tacatgagac     17820
     aactcctgaa ctccgaccag cctatacctc tacccgaatc atacatgtgg ccaagcatgc     17880
     aacctttcaa atcttcaagt ggcgtaggct gctagtatcg aatgcgtgat cctggttgtc     17940
     ttgggatgac atttagtgtc tttccagaac tggaaaaaaa gcacaggaat gctgatgttt     18000
     tgtcttgctt cctggcagat gagcgtacct ccgcagacaa tcaggctgtt agcacaagtc     18060
     cacctgcaag gagaaggaga cgcaaaggct tcccattttt aacctacaat ttgacattgg     18120
     tcatctcagg tacaaatcga gagggtaaga tcggggcaca ggcaagccaa tgagagctca     18180
     ctgcccaaga atcacctcga gcatacagga agctgcatca tgagggctgt caaaagtgct     18240
     gtggtgtgcc cagtaggttc ttatgcaccc atttcctatc caagccgaag cactatctgc     18300
     aaagaccatt taccctgggt gtcactgcag ctgcaggtta gtcaagtcga ctgcgcgtat     18360
     cctttatccg ttcatatcgt ctcctaacat atcacgcact tgtcaggaaa tccggattcc     18420
     ctacatccct atttcgacgg tttttttgag aataaatcat atatccgtcg agcccaccgt     18480
     gccgcggagg acacgcgggc atgttactgt tcggccaggc agccactgta aagactttgg     18540
     tgtccgaaat aatatcgaat cagaatgttt ataggacctc ttggactatc ccctagatcc     18600
     tcgagcaaac tttccaccgt caatcaacgc tcatgtgatg gttgcttttg gaaggctggc     18660
     cggactgact actacgacta cgagcggact agcactcctg cggggatatc acccaacgga     18720
     aattcgtttc agacggcact gctagaaccc aatcgggttt caatcgggtt tcaaccgtgt     18780
     tctcttatca gcagaacatg gttgattgca ttaacttggg acaccacttc ccaaaaggca     18840
     attgccgtca cttcgatccg ggattggttg aaatatgatc cgtcgttgcc gaggcatagt     18900
     aggagccaac cgggtattct tgattgcttg cttgtccaaa tctctcagca acatggttgt     18960
     ctctgcggta aaattacttt gattcttgcg ctctccggga tatagcagct gaaatagggt     19020
     aaggtcgagt gactcaatcg ccgcctcaag tgatggcttt gacttcgcaa ggcacaaagc     19080
     ctaccgcatg gctaatttta ctcaagccat tcgttcggca cctcatcaca tgcttctaca     19140
     cgtgggtctt gggcgtattg cttggtcata gttgaaccag tggatctact atcactatcg     19200
     gattgaggct gtatgccaac ttcaccgagt gatcagaatg ggactagaat tttcgcttac     19260
     gaaacagaat ctatagtgat tgatacattt atccatgtgg gtgagatgac atgaaaatct     19320
     ccgtactacg tccgtgagac attgatagac ctcgccgcgg gccatgaggc ccatggattc     19380
     gcactgaact acttccccct gcctatgggc gggcgggcgg ttgaccgtag tcccgtgtca     19440
     tttaatgggc ccatgtctcg cttactaata agcacttcag tcacatgaaa ttttataatt     19500
     ttataatgtt tagccacgca cgcatatgtc ctatagtact acgtattcag gttatttgag     19560
     tagaaagtat acaatgggtg tgttcagcta taaccaaacc tagtaaaatc aatggactat     19620
     cgagtctaag tgaaattgaa agtgtggtcc gaaatgcaaa gaaattgtga tgcgtctgca     19680
     ttgcgtgtaa atatatatat tactacaaaa tatgctgaac ctacaaaacc actcacaata     19740
     taatgcctac cagttgcatc agtaaattta ttataaacac gacatattag ttatactaca     19800
     tactaggatt cacctttatt atgatcaatt atctgctata ctagtggtta ttgggggaag     19860
     gtgacaagtg atagatttcc aaaagttgaa ccccctattc aggaaactta cataatctga     19920
     gggtggcatg gaccgatggc aaggtctaga cgttgaccac cttgttcacc gcccgaccat     19980
     tcaccaccac gctcacaacc acgctcatca acactcacca tcaacactca ccatcaacac     20040
     tcaccatcaa cactcaccat caacactcac catcaacact caccatcaac actcaccatc     20100
     aacactcacc atcaacactc accatcaaca ctcaccatca acactcacca tcaacactca     20160
     catcaacgct aacggttcaa cgcaacaagc attcctagac aacacccatc tctgtttgcc     20220
     tacatctgaa tgaaagatgc caatttctat tgtagcgagg aagctattgc atcacaagct     20280
     accaagggaa aggaatgtga aatacgtcat ttggtactga agaagcttca gttgtttatg     20340
     attttggcta ttgaattggc aaagatctaa ctagggcccc ttctatgtat ccaatgatga     20400
     cccttcggaa caatgaacag acgatgaaga tgttgcgcag gtctttgctt ctccgaatac     20460
     tcttggaaca ctcgaatact ggtccctagc accacgaaga ggtgcctgca cgggctagag     20520
     gcgcttgttg tcgcagatgc ccctgcgagg cgctttgttg acgcagggcc taggctgcgg     20580
     agaacttggt aatgcagcgg tctcctgcag agaacttgtt aacgcagcgg tctcctgcgg     20640
     agttcacttg gtaacgcagc gcccccctgc gaggattgtt gttgacgcag acctatcctg     20700
     cggggtagtc ttgttttcgc agcacccccc tgcgaggcgt attgatgacg cagacctatc     20760
     ccgcgagaca cagttgataa cgcagagcct atcctgcgag acacagttgc tgacgcagag     20820
     cctatcctgc gagacacagt tgttgacgca gagcctatcc tgcgagacac agttgctgac     20880
     gcagagccta tcctgcgaga cacagttgat aacgcagagc ctatcctgca agacacagtt     20940
     gataacgcag agcctatcct gcgagacaca gttgttgacg cagagcctat cctgcgagac     21000
     acagttgttg acgcagagcc tatcctgcga gacacagttg ctgacgcaga gcctatcctg     21060
     cgaggtagtc ttgttttcgc agcacccccc tgcgaggcat attgataacg cagacctatc     21120
     ctgcggggta gtcttgtttt cgcagcaccc ccctgcgagg attgttgttc acgcagacct     21180
     atcctgcgag acacagttgt tgacgcagag cctaggctgc ggagaacttg gtaatgcagc     21240
     ggtctcctgc agagaacttg ttaacgcagc ggtctcctgc gggtctcact tgtcatcaca     21300
     gcgtccccct gcggagttca cttggtaacg cagcgccccc ctgcgaggat tgttgttcac     21360
     gcagacctat cctgcgaagc acctttttac actcgcgggg ctcgtggcag cgagggagcg     21420
     caagtcttac atcactgggc tcgtggcagc gacagccgtg gtcacggaga ctctcaagcc     21480
     cgcaggcaag agagggacac catgacacac cggagtgtga ggaccgaagt cctgattttt     21540
     tttgggctgg gaatcgggct ccttttatat tttttcggct acgtctctac caaggaacca     21600
     gttgcgcaga tggtagcgag agtcacggtc tcgttaataa gcgttgaagc gatttcaacg     21660
     acgttgaagg ggtgtttgga gactttgtgg cctacagagc caagtctcga cctggcctac     21720
     ttcctctcaa aattgtgcgt tgagtgtggt gaaccacttt catcaactgt tgaaaaagaa     21780
     agcaacgccg caaaagtatg gttcgtacat atcatcgaat ttgcaattaa atcgctcaac     21840
     gcgcttgcat tctacatgtc cccattttaa ccacggttac catttcttaa tgagggttga     21900
     agtgcttcga cagatgccga aataatgggc tgcagacttt gtggtcgacg gaaacgctga     21960
     gctgtacctg gggttggccg gatgacattt tggtctcact agantcaacc cttcatctct     22020
     aggctcgcgc cgctgacttt catttctact cgcagctgac ttatgntgtc tttactaaat     22080
     ctctactccc tgggcgcgta ggccttggca tacttgcaat ctcaggatga agattgtctt     22140
     tctttggcat gatagccaaa aagggcccag acctttgaaa agctcagaca agaaactggg     22200
     tctagttncc aggacaacca tgtgaactga tgcaaccaag gcccacgagc taggttctcg     22260
     tgatcgccac cccctcgcaa gattgnaacg ctactattac actgatgaga ccctggagac     22320
     gaaaagcacc cgaccggcca atcaaacacc acgcntgaat tnagacagac gcaggtaggg     22380
     ttctgcgatg cagatctcag cgacgaccca ggggacagta gatcagggag gctctatttg     22440
     tggagagaaa atggaaacaa ttgcaaaggt ccagacacga tccacaagcc caaagttggc     22500
     cgctgtcagg gtccgatgga acggggggtt gttgcctagg cggtactgct ggggcaggtg     22560
     agtatttgga ataacacgca gactttggcg acacaatgat aggctacaac ccgatccgtg     22620
     gttgtgttct tggtcgcagt catgagaagg taagttcccc tgtcaagtgg caagctgaac     22680
     tttgccgatc tggtctgtag aacgttctag aagctacgta tcttctcctg caataagcct     22740
     ttctccgatg attattgctc tctttggacc gtaacaacac ttcctctcca tctcttcaaa     22800
     tctaccgcta tttcaataac tctagcacac ggcttgtaaa gaactatgcc aattatggac     22860
     aaaccacatg agcttaaata aaatgcctcc gttttactaa aaccgattgg tcccggacaa     22920
     tatttcgatg tgggccggcc ctcctgcggc cctaaacctt atttcaatcg atctgcacat     22980
     cttgatcaag atgctgaatt taaagaaact ttctaataaa atgttggcct tgccgcagta     23040
     aatttatcct acataccgcc cggcggagat tgtagtgttt ctgttctagt tctcattttt     23100
     gggctgcaag gtttagtcac gaacagacca gaaagtgggc agaaacccag gcttgaattc     23160
     ttcattaaaa ccgcattctc tcaccgagcg agcatttcca tggttcatta caacaaactc     23220
     tcgaaatgat ttgcagttcc gctactgatc ggcagtcccg ctcgtggttc cgcagtctgt     23280
     gtcaaactta atttccttgt gactcgggcg tgggtcgaaa gcagatcgga cgcttcgctc     23340
     cacagatcac actgttttcg accaccgatt caatcaaacc ccgccaggta tattttactg     23400
     ggctaacaag atttcagtgc cagagcccct tcctaccctg tcctatctct ctatgggaac     23460
     gcgcatagta ccgtaaatcc ttatacactg tccgcagtat tttgcaggcc acatgggcca     23520
     tgcccctggt ttagaatgac aaggacgtgt agctgggcct gctcagaggc accacgacca     23580
     tgctcgaatg ttcacctttg actttggaac tttctcacta ctgttgtaat tccaaacaag     23640
     ggtgattgct ccttcctata cgaaatccat ggagtgattc atatctctca tgctagtgtt     23700
     cattgtcgag taagcacagc ctttatggta ataacataca cctggactat ttcatcgaaa     23760
     tagttggcca ctgttccttc gacatagcaa tgtagcgctc cgtcgatgac atgctgctag     23820
     tgtggacgtt ctgttcgccg gtatctcagt ttcctggcgg cacagacacg atgtacatag     23880
     tcccacatcc aggacgacga tcgtgttctt tgaggcgagt acggaagcgg tgctggcgtc     23940
     acgcagcctg tggcaaaagg tcagcctctt atataggaag aataaaagta tttcatacgt     24000
     attttcgagc gtgatgtttg agctggttta tcgctgtcgc cagactggct agggtcggcc     24060
     gctagaattg tttgaaaccg tttgtcaatg ttcctttggg cagaggtatt ttctggcaga     24120
     gttgaccgtg aaccgctatc gaccagcgag cgccgcacgt cgcctgggcg cttttgtctg     24180
     cctgaatgtc cgggaacttt ggcgccagtg cgacgctgct tccgcagaat atggtacttt     24240
     ttccctcgta aagactcaac gcttcgatac acctgatatt cttcataata tgcgtcggag     24300
     agggctttcc acggcaggcc ccgatgggaa tccagccaag agagaaggtt tttctcttcc     24360
     cattctggcc agccgcatgc gctacgtggg gacatggtga tgctcgggca agtcacaaaa     24420
     gtgggaagaa cggttgaata aagcagcaga aagtgaattc gaagaggaag ggttgttgag     24480
     tttaaaagat catagtgttg cacataaata tggcgattgc gtttatgagc catggctcag     24540
     cttggtgaac tggtaccaga ctctcacgac tcgccccagc taaagcttct gaaggccaaa     24600
     agccttcaac ttttgatgta ctgtgtttcg ttgagaatca acaacgttga acggccaccg     24660
     tgcacctgtt gacaatatga catggttcca ccagttcgtt gaaacatgtc cgactcttag     24720
     tgagccatgc agaaatagaa tagatatcta cgtgcagaat cagaatgcat gggtgaaaaa     24780
     tgcgtgcgct tgcaattccc gttatagtga gcaagcacaa cacttaattc tagtcccgcg     24840
     atacaacttg ctataaagcc ggagtgcttt cttctatcac actcaaccag aagtgggaac     24900
     actcgtcacc tcagcgtaac tcagacgcag acatgggcgg aattcgaaaa gcctcgcgcc     24960
     ctcttcgacg accagacttt cggagcagat tgcaacgtgc attgtctttg tcgtccttag     25020
     agtctgagga taccggcagt gtgtccagca ccgctacagg ggatacaaca agtgacgagt     25080
     caccttctca ggaggaatac gactccggcg accaggaaaa tagtgacgca gctgatgaga     25140
     gtgagcaaga agctacacga cagcagagaa ctgtgtttgg acatgaaacg gacttgggaa     25200
     tacgtgggca aactcagcta tccggagaca gcaatacggt tgctcttgaa cgcctgacag     25260
     agtaagtata atcccacacg gacataatta agaattggcc tgctaacaat atccagacta     25320
     gataaccgaa tggggtgagc tgctgtcgat actgagtgag agtgtaaagc actaaccgtc     25380
     tccgcaggtc tattgagcgc tcatcgcatg accaagccac ctggaatgaa accattcgca     25440
     acgatctggt cgacatcttg ggccgattgg caatcgtcga gactgaggtg cagaagttga     25500
     atagacaagg tacaaacaaa tctacagagg gccagaagac cgggcgatcc ctgcgtcggc     25560
     agcagtgatg tgacccaaac tgtgttttga tatccgacca gatattccag agcaaggcat     25620
     gaatccgtgt tggtcttgag ttgtggatac gattgtttca ccgactgaaa atattactga     25680
     atatggacac tctcatcatg gacgctgagt tggagggtca ctggaaaagg tctgattgac     25740
     ccaatgcgag ctggtaccag acgagccatg tatagtttgt cgttgtattt gggtcttcga     25800
     attttatcaa tgcttgccta ggttgtgcac accaaagcta tctcgcccga gccgagtggc     25860
     tatagtcgcg acccactata tgtaaacgag tactttaagc ctttcattag ttccaccatt     25920
     gcagatgatt tgtactgtct agtccagtat gattgtgcac ggtttgtaca actgaagaca     25980
     tgccccaaag gctaaagcca cagtagtaca taagaattat acgccatgta aagatgattg     26040
     catattggtt gcgactatta aggtgcaatc cttcgcgatt gatactagta gagtagttca     26100
     atgtgcctgg tagttgagca attgctattt gtgattgagt tagatcagga catactacgg     26160
     caagctttgg attgaggaac gagaagagat aacaactgta gtgcgcaaga gaagcgggga     26220
     tttctccatt agacccatag ccacaaggcc tagcattgtc ctgatcggac tatcaagatg     26280
     cattcccttt acatggacta caataaatat caactccaca gaccagcgtg ccaaggtctt     26340
     tcccatttct gaagggtatc taagcggtgt gatactgaat ccaccaggac tgcgtctcca     26400
     caagtatcag tcacacctac tcattacatt tcttaatgta taaaaaacaa ccaaggagta     26460
     gagagtggtg aacccgccgt taacctgcgc cgaacaatgt atcgagacgc ctgtgcttac     26520
     ttgtactggt ggttcttgga ccaaggcgcc cagcgatatt cttcggagca agaaattggc     26580
     aatacacatg attcgtaatc actaccctta gaatggtttg gtgataatgt tgcaggaagc     26640
     ctgttcatga gctatctgcg cgttgactcc atttaaaaag gcaattctat ccacaggaaa     26700
     ttaaggccca gcaagtccaa cgcagatatt cgttcaaacg agagatccga attggttgcg     26760
     cgcagacggt tcctgctgac taggaagtgg gacattcgat tcagagatgc tgaggtgggc     26820
     atcgtggccc tgagtagccg ggccgctttg ctcggccggg tccgcgtgag tcaccccgga     26880
     gcctggcaaa taggatgcca gtcgtctgtt ctggagggca tcgattgtgt tccaaaatcg     26940
     agtggtcatc gataccatgt ccccgtgtgc ctgatccaga accagctgaa tatcattcca     27000
     cggcacctga tcctgcagag cggcattcgt ggactctagc tgctgctgca actcacagat     27060
     ctcgtgcccg acccgctgac tgtcagctaa tgccgcatct cttgctgcta tagccagctg     27120
     caatttcgaa gtttcttcgg ttttctcggc ttcaagttgt tccagcaact ggcaatgttt     27180
     gtgtctctcc tcttctctct cctcctgtgc tttttggatc tcttccctca acgatgctca     27240
     tcatatgaag acatttccta tgggacactt tatcatgttt ccgcctaggg tttcgtgttt     27300
     tcgtgatgga ggatgcctac catagtcagt tgggagtacg tcaaggtagt caccagggca     27360
     atgggggcaa tgttggccaa ggaaaatcca gaaaatattg tggaaggtag agattggtac     27420
     cgtatgcttg tgcaacccag tcgccggttt gagagggttc cgatcgtgtt tcgatctaga     27480
     ccgagtagac cgaaggggat aacaggaagg cgcagcacgc agctgtactt tgctacagtg     27540
     gtctgcctgt tcccagaaag ccttgtgatt ctttgccatg ctaggtgtgc tcgatcgtga     27600
     gattaacaac gactcgaaga gatgtagaaa gcttgaaaga aatacaagca gtgagtttcg     27660
     agaagctcaa ttatatagga gtatgcggag gcccaagcgc aggacttgaa cccgaatgaa     27720
     gccgctcttg ctcctgccca ggaggtatgc caaacaaggg tcataatcct aagaaaaatg     27780
     agcactgggc gttaatgcga acgcacaaaa cacctaccgc tcgattatgg agggtgcgag     27840
     caacaggtcc gcacaaatat gtacgttggt gcatacaacc ctgtttcatg atagcaagga     27900
     ccaatcggcc acatcccgcc caaagtttag tgtttagaca acaatgtcat ctttcaaatg     27960
     ctttgtgaaa tttgccgact cccacgactc tgcattggtc ggccctaaaa aatagcggcc     28020
     ttgtttttcc gaattaagag ttctcacttt cctgtccgca tacgtctgga ttccccaaca     28080
     agccgttact tgagtcacgg gggaaaggca tttcttgcgg ccaagactca gtagtaaggg     28140
     tatccatcta gtgtccacca tatcatagac atgcttgggg gcataggaac ctccagtgct     28200
     acgaatcaag cggcagtcat agcaggtacc cgagcatgtt ataattgtca atttaagcta     28260
     cggcatgggc ctcggccttc accagttgag gttctgctat caagcaccca acttgagact     28320
     cctacagctc acttccctgg taggccacga tcacagtcta tgtatactat acatcacgac     28380
     accggcgatt atttgagttt agatgaattt ggtaccgaat tgtaaggcgt attattggag     28440
     tgtaacatta acgctgtctt tgacgcatga caactagggt actcagtagg ctgttagcgc     28500
     atatgggatc tctgtcgcgt gctccggtca atccaagacc tcgctcacta ccttatggat     28560
     gccattgact gacgattgga aatcgcgggt gccaagttcg atcccaattc cctccgtttg     28620
     caatgagttt aatatccgcc ttgctccagc aattcccgct ttcgcctctg ttaactcatc     28680
     atgcagtttc ttattgtgcg accgaagaat ttgcatatcg tggcggagtt cattggcctc     28740
     agcccggacc gtgtgacttt cgtcaagaca gtcattcaat cgggcatgag tgcgttccaa     28800
     ctcgatttct atgctgttat tagcagcctt aagcttggaa atctctgctg tgaaagaacc     28860
     atccattccg tcaccaaaac tctccgcctc caggctctgt cagcaatgct gtatcaataa     28920
     ggatgtctag taatgctcac ctcccttgga atacagcttg tatttgactg tgagtgtccc     28980
     aacgcgtgcg gggaaacagc ctcgattgaa tggccgatct cattgcaaat tttccggtaa     29040
     agatgaatct taccgctact caagctagat ttgagcacac tagcatttgc gctcgtgacg     29100
     gaccaagcgt atccatcttc aggtcgcggt tggagacgga ctttttcagg agcgactacg     29160
     atgccaagtc ggtcatctag gagtattagc tgagttattg tcggtagggg gccacgggta     29220
     catatattgg ccgctagggc ttctcgacat tgctgattca gttttaagcg cttctcgttg     29280
     ctacgcttag gcatcgtagg gtaccttcag cactcaaaga atatcaaggg aatggggacg     29340
     cgggtattta aaatatgatt cggaactgac ccttccgcca aaacaccggc tcaatgtagg     29400
     atcgatgatt cgttctttct caggtcgaaa gtggtatccg tgggtggggc ccaccagtat     29460
     ccattaaaat tgggtaaata aagtttcagc tgaaaacttg gattagttga gatttggttg     29520
     aaagtcgggt acaagtttta ttgagacctc atcaagtaaa ctgggctact gaagaaaaca     29580
     caggaaaaag taacctcaat ttctgttcaa atacatcctc aatcactaag ttttggtcgg     29640
     caaacgctgg aattaatttg gttggggcgt cttcacgctg ccaaagattt ctgccttcca     29700
     aggtgccggc ggaaccgata gtgacttaac ggagggtcga aagctgatgc gactgagcag     29760
     actgtcgggt tcgctaacaa cattcccaaa gacccagcga acattggaat atatatattg     29820
     agcaaggttg ggtcgactcc atgtactttg cgccacctat ctgttaaaat tgcaatgact     29880
     ccaacagctc gccggcccca ctgccaaaga ccagcgagcg accactatct gacgccatta     29940
     ccgtgtgact cctcaaagct tctgccatca aagatgatca ctcgccatgc cggtcgtaac     30000
     attcgaactg actcatcgag cccaccttcg cagcgagcca agaaggtcct tgaaatgagg     30060
     attcatcatc gatttcatgg ctcgcacgtt acgttccgaa aaccaggcag accccaaagg     30120
     aagggtgcca aagaaagccc gcgccggaag ggagcgattt cggagcgaga ggctattcga     30180
     ttggattgga tggggcgact tcgtcccaag ccccatagac gttgttaggt cggacaagga     30240
     tagggcaaac atgaagcccc aggggttggc atgccgcatt tactaatttt gttcatatat     30300
     cgttgaatag atgaaattga cttgcaagac aatgagtatg ataatgcagt gcgtgatgag     30360
     gtagcccgta aacatggact ctatgtaggg gattgctcag ctaggcctcc tatcgattga     30420
     tataggcaaa atcgccagta tacccatgct ttcataattg ctgtgtatta ccaagttgtt     30480
     ctgagaagag atcatgctac tctacatgca ctgaagcaag gagaacgcag tttacggtgt     30540
     agatagagtc catggggcgt catgttctat ttttctatac ctaatttaga cttgaaaacg     30600
     atccgttgcg tgattcttgt gaacatttta tcttttagag acagcacgat tactgtaaca     30660
     aactcctggt ttcaatggtc ttgtctgagc cacccgtcca cataccacaa gctagttgga     30720
     gataaccaag gatccaccta tttggctcac gggattgact gcaaggatga cgcccagatg     30780
     gcgatgatga ccagttcgac ctgttgagtg tcagcattat tggtataacg gtataacgtg     30840
     ggaatctgca attacctcca atgcaatcat ccacgatctc tccaacatac caatgacggc     30900
     aatcacaagc aaaagaagtg ccattgcaga gagatgacac gagatacacc gcagcttagc     30960
     tcgaccggca gttgactgtt gaaacaacca ccaataccat gcaactacac aaaggtagtc     31020
     cgcgaagaga atatagaggc tacccagatg agcagatttc aaaaggaagg ttccaacgag     31080
     ggagactgct attttcgcca aagttgaagc cacagagaaa gaagggcata tgaaacgtag     31140
     taatcgaggc gtgagcgggt tttcgcgctg ctggaagatt atgcggatgt actgcagcat     31200
     tgttagttgg aactaaaaca ctgtatgtga ccgagttcgg tgtgctgtga gcttaccgct     31260
     tgtagtggtg ggaatattgg ggtaatccaa aagagtactt gactccatgc tggaaacctg     31320
     ttgctccaga acaacccagc aagaatagca aaggaactac aagacaaggc acacagcgct     31380
     aaatcgactt tataccaccg ccagtgtggt tggatgcaat acaaaagaaa tagtctccca     31440
     aagttgagaa gtagaagaat agtcaccaag acggatctga tgatgttttg tgaaaccaca     31500
     accatactgg actgccagct aatgttcttg tttgaacgag gccttgagat ttatataccg     31560
     aaacagagac atattggcca ggtaatagtg gataaattcc caggatgtct ttatttgact     31620
     ctaggatttt cttatactga gtttcctgcc tataaaaaag cagatgccct caatcttatg     31680
     acacagaagg ttaactgagg attctcagtt gcggcttcgg ggcaacactt ttgctctttt     31740
     tctgcgcaga cccgagaata gacaccacat ttaaagcttg cagtatagtt tctgatttag     31800
     cttgcatcat gtaagaccac atttacaagg gccaatcaca gttgcagtat cctgctttca     31860
     catagacatc gaggatatgc agaggtggtg catacattta taaatgccta actcaatttc     31920
     tggagagcac tgccattctc tcaggactca gtcttcggac ccgtagaaaa agtaaagtgt     31980
     gtgctcgcta caatatgcct ggaagtcaca caatgttttg ataaaacagc attcaccttt     32040
     aaaatggctg gaattagcca tagagtacac agtgtcttga atgagtacat cccaagggca     32100
     gttttcatgc accgcggatt ctccgtgtca gtttcagcag cccatggttg tctgccctgg     32160
     acggactcat tagcttatcg tgattactcg ttcggccgaa accgtaactc gaacctttgc     32220
     tcaaggctca taatttgatg atgttttatc atcggcaaaa atgatacgtg tctcctttcc     32280
     aaagggtgct gggatcagaa aatgcggaga ccggggttac aatatccgtt caccgtcatg     32340
     atagtatctt gctattcgtc ggcacactat ggaacggagc aaaatggata gctacatcac     32400
     taaaacatca aagtaagtga gatatgctct attcatgggt tttaatcgct tataattttc     32460
     actggcggtc tgaagtgcct atatattgtg ttggccgatg agtagttgtt ccaatgaagt     32520
     taccaaattg gcaatgatat atagattgtg tttccctttt ctcactcgtg tcagaaggtt     32580
     ccagacaaca ggttatacag gatatagtta attggttcct gtaatctaca gcatgcgatg     32640
     tgcaaatgaa cgtcgataga cgtgacagaa atacttctgc tattttaggt aaagtcaatc     32700
     cgctcggaat gtgggacttt tcaaattgat cacgtttctc cttgctcctc gaaaaaatac     32760
     acggaggctt tcccaactaa gaaacaaaag ttaatgacat aaataagaga taataatgaa     32820
     atcgaaaaca gcatctggat caccgcgacg cagacatttc atatggtgaa taagtcacgc     32880
     acttgaatgt taacggctca tctagacagt agaccgagat aaaccgaatg atggacaaca     32940
     ggacatgacg tttcatgcgt gcgagacttt gtagtccact attgcccata tttccacaca     33000
     ctagtctata tcacgacatg taaggaattg ccacctgcaa caccgctttg gaatactcca     33060
     cgaggccgta tgtcaagacc aagtacatac catggagact gggctgccag aactggacca     33120
     ttccaattct ctcaagaggg cgcaaagcgt acagagcaca accgcagagg ttgagaagca     33180
     ctaatctgcc gaatgcagtg gccagtggag agggagtgtg gagcggctcg gcgaatgcgt     33240
     gaatggatgg taccaaggcc aacaggacca cagtggcaaa ttgaagagac aatcgggcgg     33300
     aaaatgcccc catgtccatg tccttgaggt agccgtccga gaggcttcca accgcgacca     33360
     ttgtgaaagc cgatgcatac ccaagttgta gcaatggttg ggctggaaag agaaaagcga     33420
     tcgtgggaag agctgcggtc caaaccagga ataaaccacc aaaccacaca gaatcttgct     33480
     ctttcgtcat tttctccttt tggaatgcac taaggccatt ctgaaagata acacacagat     33540
     accatatggc gcttcctcca ccaaacgcca tcactgctag agcgtatggg attgactgtt     33600
     gagatgaggg gaaatggaag atcaagaaca tcagtagata aatgacaaag tatgagaatc     33660
     caagcgtgcc tatgatgaca ccgatggcgc agctgcgcag gttttggtaa tcgagagtgt     33720
     tcattgtata aagttggggt aagcaccagc cttcttgagg cagcattcct cgggcgagca     33780
     tttggcttta tagacaagag tggagctcag cttttactgc attgactgtg ggtgaggtat     33840
     tgtagaaata taagtgttga gataatgatg ggggcggcgt tgatcaccag aacggtgagg     33900
     aaccatcata tctgtaatga ccacccacct caacggccgg agcctcagaa atgagcgcgt     33960
     ttatattgag ttgccaacaa ctgctttttt gcctcatcga tattcaacca gaccgaccga     34020
     cagacagacc tccgtggcta tgtaattggt gtctctcatt atgcaaatgc aggacctgtg     34080
     agtcgattgt gattcttcct ctcttccatg atagcaccat ggaagatatt gtaccgattg     34140
     tacgccagat cggtcaacaa caagctcata atgcttatta tcgcgattgc tattccccct     34200
     tcaagctact ccaagagctc acagaacata cgttcaccga actacaaaga ctttacaaat     34260
     ccggcaccga gcgctcgacc aattctgtcc atcaacttct ccgaaatttt cagaacacaa     34320
     tctgtaatct ggttgaaaga gcatgcgaag cccaagcgga atgcgagaag ttctgctcag     34380
     tgaatgaatc acactcagcg cgcgttgtct tcgagcccat caggagaatg tacaccaacc     34440
     cacaagcctc attgcagggt acaagatgat ggtggaacta ctagcctggc atcgtcgcct     34500
     gggaagacgg acgcgcacga ctggtaactc tactatggtg atattttcaa aggcgggatt     34560
     tctgtaaatt ctatagagcc gcgtgaaaat cataatgtac tttgtgtacc acagtatttc     34620
     tctccaaaag ctcatacacc atgtaggagc ccaccaacac aaagctctca tgaatcagac     34680
     acagctatca agaagttccg attaccacag aatgtgcacc ataaaggcga gcaatgttta     34740
     gccccaccat ctgccaccgt ccttacatat catttcccac actcccagcc gaatgaccat     34800
     ctacgggctt ggcaattaga tgcaacagca gaaaagatgg accaaccata tggttgaacc     34860
     accaatagaa aagaaatctg ccaaccatgc tgtggtaaac atcttagctc caagggtaac     34920
     ttcaacgccg taaggctgca gggtgttctt gaccttggaa gcaaaaaccc catacatcac     34980
     cgtgaccgca attgtggcag tcgtaatcag catcgaggaa agcttaattt atcagcatgt     35040
     ctcttcaata tttgtccaag tatcacatac cgtgtaaaat atggcaagtg atctgctgcc     35100
     ttttgaaaag aaaactttgc gacaagccaa aactccggat aatgtggtta ccacaaaccc     35160
     agcaatatac aaacagacca cactctggga aaaccgtcgg tagccggaaa ccaagcttag     35220
     gtcaatatct ggaagtatgt tgctgagatt tatggatgtg gaatcaagca cggcggatag     35280
     gtcaaaagta aaagaggtgc tggggtcgga acaaaccatc tccgagccat ccttggcttt     35340
     acagtagctc cagaggccaa ctaaatagta ttgaggcaga tgtgacttga attcgtgtac     35400
     ctgggcttcg accatgctgc tggcagctga cgttgcctca tggattgctt catttgcact     35460
     ggtatggatg ctagatgcca cgccttcgac ggcatttctt cccccgttct caatacgcgc     35520
     agtatcaaca ttgaatgggt cccgaatttg caaatcacgc agctttggaa attctttcag     35580
     gtctacctgc cgattgctta gcattgatta gcatggaagt ttttcgggcg tatcttactt     35640
     ttagaaaatg tagacccttc ggcgaggaag acgacgaaca tccgacaaag acaagagata     35700
     gacagactag aatggcgacg gtaaatgaca atgctgtggt tgaaactagc gaatccaatc     35760
     tgctcttggt ggaaagcttc atggcttcag aagggagaag atagaggagt gtctcttgac     35820
     cgaataatag actttgggat cgagagaaca attgagaact atgctgtatc gcaattcagg     35880
     gaagcatata tataagcttt ccagatatgg tcaacttaac ccgtgtgggc agtgttctgc     35940
     aaatttaact gaggccgtcg caattttccg cctcattcta tgggcagtag tagataaatg     36000
     tgtcaggtaa actaccagtg aatggggatc cataatacat aggtgttgtg agggcaggca     36060
     gataattgac agcattaacc accggaatat gagggcatgc aattacaagt gatcaggctg     36120
     gcgagttaga tcttcggccc cacaattatt ctcagataga ttcaataatt aaggtggtat     36180
     aaatactact gcacggagtg accctcgaca tctaagttgt ctttctcgtt attccataca     36240
     cctcctcacc tgtaaatcac aggtgacttg tactagaccc cgtcatgtca ttttctaggc     36300
     agtcagaagt tgaacattgg gagcggaaat tatatgacta tcgagaaagn catttcgagc     36360
     tatctgccag agtgcacatc tctcacctcg tcttcgagag tgggttcaga agacggatgg     36420
     acggccggca gaatatccgt cgattgacac aaatgatgaa gatgcaaggc tgtcaacgct     36480
     tgatgaggga caaccacgtg ccggtgatag tccccagggc tcattggcaa gatcgcgtgc     36540
     ggccccgatc tggcggtgga atcattccta gcttggatat ggagctggac tataggttgt     36600
     gcgcatacga ccacgagaac ctnataacag ctgcaaggaa tttccttgac cacgacaatc     36660
     agtggtggat cgtagatgtc tatctaacag ataatgagta aggtgcgttt gctcagtttc     36720
     agctctcaga gatcgtcgtt gataagttta tagtgtcgcc agacgaccan agaaatgaag     36780
     cggagtctat tcgtcacaaa ttcatccaat cgctgaagga gcggtatcca aacgacaatc     36840
     gcccacctga tggactgatc tacgagcgga ttaaccggta cgaaggctac cttgatacgc     36900
     ccagggatcc gctcgctgcg aataactggt gggctgtact ggaggccctc gcgggaagca     36960
     agaaaggaaa gtatttgaag caatttttca aacacgagac cttacaccaa aagctaaatt     37020
     ctttgctcat tattccgggt ctctggggag ggatgcggat tgggctactt cataaactga     37080
     cagccatgca ttgcgacgag gtaaatttac tctgaaccac aaagccagtt ccatctcagc     37140
     taacttgatt gcaaatctag ccagtagcat gctactggga attgatcttc tccacttttt     37200
     cgagactggt tggaggaagg gaagagcttt tattgctgat tgatggagtt acggtcgagc     37260
     tgcttcaatc tcgcgtccct aaaatctccc gtaaagattt gcaatccttg caggtcgagt     37320
     tggaggaggg ccggcttttc ccgaacttct cggaagaggc tcggcaggac atatgggcgc     37380
     gtttgaaaga gatcgattat ccaattccaa ccttgaaaac atttttcaaa gatcggctct     37440
     atcttgaggt ggctcaaagt gtcatgaaga gactgttcgt ccagccgcga ggggataaga     37500
     ttaccattga ccagggtgtg tatgggaagt atgacactcc ggttcccgtc tcgatggcgc     37560
     tgagacagga atggttagga tccgacctgc tcgaattttg gcgcttcagc ttccagtatg     37620
     gatttgaaat gaccgatcac caacgcctta aatggccgac agacgctgat cccgaggata     37680
     tgcttgatcg gcgaagctcc ggatcgtcct ttcttcccaa gcaggaaata tggcgccatt     37740
     tctttacact ggtgagagcg agaggtttcc aagcacccgt cacagacgac acgtcatttg     37800
     caacagggga gctaccttcc cctagagtgt gcgaatttcc agaagactta gccgaagaaa     37860
     tagaagttgc caaaagatgt gggaagccgt actcgaacac tgtcgaggca gatcgattcg     37920
     ctttgtccgc agagacgctg cggcaaagtc aagcctcggt tcgagtgacg gcggggtttc     37980
     tccgacagtc tgttttcaag gcgttctttg gctatctgtg gaatagcaat agtcaaatgg     38040
     ccggtggtga tcctcctgac gacaacattg aagttcacca tcgcggcgaa aggccgacta     38100
     ccgcaaatgt tggtcgggcc atgatggcca cagacggcat ggacgtggat cctgggagcc     38160
     tcaggccaaa ccctctcgtc acctcagcag cgcggacgca taatgccgcg gctactgctt     38220
     caccagctga catactgccg ccgttcggtg tcatgaccat cacggttgga cgaactacac     38280
     gaatattaga cctaccaatc cacgactcat ttatgaaaga cttttcgact ggtctattca     38340
     acaacaactt taacgtccag accgatgaga gggaaaagcg atccatttcc ccatatacgt     38400
     gctactctca ttatctgcac aatccgtcgt cggtgctaca cgccgaattc agacaaaatg     38460
     agcatactac ctacgctatt gcaccctcgc aaatcggcgc tgggagcaag agaaggatgc     38520
     ttgatgaaga cgagcagatg gctagagcgg aaatatggtt acaggagcaa attgcgttgc     38580
     tttcggatcg gcgtaacggc gacgaagacc tttgacggga aaggaggtat caaattcggg     38640
     tttcaccaag gccttgaaga ggctcacggt atagaggagg cctggtatgg tagagatggt     38700
     atgagtgaga catgtaaaaa ttcatatgtt atgatctatc atatctcaga gcatgttcct     38760
     gtaaacggca acgttttagc ttgaagcgag caagcctatg gtatctatct tatatagtgc     38820
     gaaggaatag atgataatgt acttcttgat ttattgggat gcatcgtggt tcgatcaatt     38880
     atatttatta gacatgcgct tggtgtccgg cactgatcgt tatttatatt ttacagctga     38940
     caattagatg taagttccat agcccgagga atctcaatgg cttcaactat tctctgattt     39000
     atatactctt cttccattca acacatagcg tcatacttgt agttcactct ctggccacca     39060
     tcaagggttc tacaccacat ggcgtcgctt caagtttaac aagtgaggtg ctgcctcttt     39120
     tatctcaatg gactatggta cactccgccg actcaaatac ctttgctgac ccagaggcgc     39180
     aatgacaaag accaccctca cgatggtccg cctccctaaa tatataatta gacaacacaa     39240
     cttgaattcc atatcaaaga gtggcttact tgatgaggca ggtattcagg tcgagttccc     39300
     cagaaccctt cggcgagggt attgtggtgg ggccatgtgt ctcgctaggt gcgcttgggg     39360
     atgccgagat gctcgcaaag cttgatgtat tcgggagctc gcagctagag ctcgcagtat     39420
     gggtagcaga cccggtactc tcggtactgg tgcttgtctg ttgttgagtg ctttcgcgtc     39480
     ttgtagtctc tttattcagt ggtggcgatt ggcatgaaca attgccctgc tgttgcgagg     39540
     gaacctcatc accagctgcc ctttctgcat gttgcctcac cgaagccatc aggggaagtt     39600
     gaccgtccag ggagactgca ataccacgac aatcgatgga aggaccatca acacctgtaa     39660
     aggttagcag tcaggtataa tgcgagggta gtatgatacc tacatctact gagtgcgctt     39720
     tccatctcag cctcgcagtc aggcgacaag gaaactgatt gcgtgtgtcc agaagttgaa     39780
     agcgtggcat tcaagcttcc tcccatagct tggtgccatg tgctgactnn nnnnnnnnnn     39840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     39900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnat cgcaacagca aactccggct tgtgtatatt     39960
     cgcacggaat tgcttacatg gacgctacga cggagaacat tgaccacttg agcaaagtca     40020
     gcgaaacctc gtgcaacgtt gatgctggaa attgtcatcg tctgtcatat gccaacctat     40080
     ctggtatatt cctttgcaac tatgtaagtg ctccaaactt caaggcaaat agggctccgt     40140
     gctgacggca ctaagagcca cgagcgcatc tcaacaaact gtggaagcct tgtgccactg     40200
     gcgacaaagg ttcaagaaac atgtcaggtc gacaactttt atacgtttgg aataatcggt     40260
     ggctcttctc aaaacgcgag tgactcgatt gactttcact tggtagttgc gggcgaatcc     40320
     atggggtaac ctatagagta gttcagacct ctcggccttg ccactgagtc ggattggtat     40380
     tcgaggtgga ccaattaagg tgctgccgga gcgtagcacg gatgtgattc acatttccgt     40440
     atgtatattc ttttagaact ctcaaattag ggagctgttt ttcctatgca cgcgctcgaa     40500
     atgagtttca ccaatttgtt ctctttgatt gcttctccac ctctaatttt attgacgcta     40560
     ggcctaatgt agctagtgaa tatttattgc cctttttcct attcgatatc tattgatggg     40620
     gctagaccag atgtaggccg aggtgatctg accaagactt aggaaagaac caaagagaat     40680
     aaaatgggga aggaatttcc agcggacctg gaaagctcgt gcgttggtag tgccctttct     40740
     tcaaagtatc caaggctatc gctactcaag aagcttttta taatgcttgg aatagcatac     40800
     gccgcgttgc attgtaaaat cgttgaaaac cagtaccagc cttaactcaa tcattgtgct     40860
     catgcttact gcatgaccga tgagataata cttcgacagt acttccgccc aaaatagcca     40920
     aaaagcacaa atcaaataat gtcacgcgcg tagggaagga aatcggtcag ttaccagagc     40980
     ggtcaacccc ggaatattca ccctatctcc atcaactggc ccctcactgc atttctcgag     41040
     ataatgctga accaacaaag atccaatcaa acatatccgc ctcggggata gctcattttt     41100
     agtcatctcc tgcttgcaca caactgcctt tgatgaactg tttcgagatg tcagttcttc     41160
     gagctctgct tgtaagaatg acaagtgcgc acgaagacgc gaaatccgtt ttgaatttcg     41220
     ataaacagcc cgactcagtc gtttcaattt gggccagcct cgtctcttca gagtttcaat     41280
     tttggccagg atttggcctg tacccaatag atttactaat ggtacccgag attgcttggc     41340
     agggaatata gtcttataat tatccctctt tcgctgaagc gcctgtttag actgcaattg     41400
     agccaacaga tgcgataaca tggccgtagg atccaggctg ggacggtgaa tatttggtat     41460
     tgttgccatc aatgttccca ccggccgctc cacttcattc tcgacggcag tgatacgatg     41520
     agttggggag gtgttcgaaa agagtaaaac caacaggatc atgcaactga tacagcattc     41580
     atcggagatt tggtctcgcc catctggcga cacttttgtt tctatagctt tgccgggatt     41640
     ttggctaatc aattgatgcc cagaagtcat gacctggccg gtacggatgc tatacgcacc     41700
     acccacttgc gccgtgggtg tgttgaagct aaagtccaac atgacgtacg gtagctgtcc     41760
     tggacttact gcgcgggact agcaatatta aatagagatc aagtattcta taataactgg     41820
     aacggcgcta cgagttttcc agtacaccat aatgcgaccg cggtcaccgt tgtcgatctt     41880
     tgaggctagg ccatttgtat cgctctcggc atcaacggga taaggattat gctggcagga     41940
     agcagaattg gaggcagcag acggtgaagc ctcattatga gaatggccat gtccgtacca     42000
     ggtcgactcc gaattagaag gcgtagcgta catgttcaaa gcacgactgt gctgatgttg     42060
     attcaccgtg atcattttta ccaccttacc accttaccac cttcaccacc ttcaccacct     42120
     tcactgtcgc tgagtcctga atgggaacca ctcttaggca tagattggct tccatctcat     42180
     atacactgaa cctagaattt taacattaaa atgtgtccca gagtctagtt ggagaaatag     42240
     gtggtcttga aatggagcat cggcctgatc tagcaagatt aatcccagat aaatattgcg     42300
     aggtatttta ttaatgagtt gtcaactcaa gtatcatttg aaaaatgcga gaattcagct     42360
     gtcctaggta cgagcttcgc tcttttttcc ggggaatcta ccactcgttg cgagggaaga     42420
     gtggtcgaac ccacggcatg cctatggaga taacggagga taaagcagtg tataataaag     42480
     accccaatca aagcaacact gcctccaaaa acgctgctga gtataagtac tgtgccctgc     42540
     tttgaaagcc ttgccgatag attactacca tagagtgctg tatcatgcca ttcatgatct     42600
     gaggtttttg tggctgatgt tggtccagaa atcgacgaat tagtttgaga ggtagccgcc     42660
     gttcctgtca acgtcctcga caaggtttgg cttccatcgt taggagtcag agataagtga     42720
     tgcccagtcg tcccagtgat acgactagca gcgtcagacc actctgtgcc agaagctccg     42780
     tcgcttttgg acatcctgct ctgtccggtt tctctgatct cggaagcttc ggtatgtatt     42840
     tggctagtcg aatgatacag ggactccacg aaaggtcccg acgagtcctc agagtgcggt     42900
     gtttccaaac tagcccatac ttgagaggta cgattgaatg caaacggcga aaaggtggct     42960
     cttgtggtca cgttctgaag caagtcggta gttttattct ttgaattctt aatcggaaag     43020
     agactatggt catcagaccc ggtgctggta tatgatcctc ttatggcacc gcttatggaa     43080
     tctttttcgg taattgctcc attgtgcttg ggttccgtcg taggctcatc accagggacg     43140
     ctgactggag aactggagtg taatagcaaa tcacagtatg atggtcgatt caaggccgac     43200
     aaagggaatt gcttcgagac tggtgtaacg tgaagccttg atccctcatc atgtagtgcc     43260
     tggcttgtcc gtaaaccaat agtttgagtg tacgttggct ttagtgaagc caacgtcggc     43320
     tgtaagtcaa tcattgtcag ctatggtgtt caaaggcaat atatcgtctc tgaaggctgg     43380
     gaaagtatga gaaaaacctg gaaagaggca tgtatgatac atacgactgc tgagcgatag     43440
     ctatgacttt ccatggcaag ctgctttaca gactgattat gcattgatca agcacgggaa     43500
     gaccagaccg tgccaataag ataaggtgga ctgttcaata tattgggtct ctggcaatcg     43560
     ccgatataat tccaagtttc gaaggctagg gattgtggca atataaaagg cacatagact     43620
     attataagag ttagttatgt ctggtgctgg ccttggaaaa tgtcaattct gcatgtcaat     43680
     acccagccgc atatttctat tcgctagacc gcaatataag tcgtagcagt aaacatcgtt     43740
     caaagttcct gcaaatggtg accatcgttg aagtaataga ttggacgatt aagccatcgc     43800
     agttgtccga cataaataag tgcatccacc ggccaaggca aactactagt tccattgcag     43860
     caaattagtg gacaatggcg cctcccctaa gccgtgtcaa gcgagagcaa ctccgtaagc     43920
     gtcgcaacaa tctactacga cgccacaatg aattttggct tctgtatggg atgaaaagct     43980
     ggctcatcat ggaactgcct gatggtcaga tttttacata ccactcccat ccagataccc     44040
     ctccgccctc aagggaagat atggtaagac aaagattaat atgagtattc agtgatttgg     44100
     tgctgattgg tgaaagaaaa cacggcccaa gcccactatt gttcgaacgc ctcgcgacta     44160
     tatttctgcg acctctgctc agtcagttgg cagagacatc ccggtcttct gtgccccagt     44220
     tcgtcaaacc cagaaatggg aagctctggc gaatcatttg aacaataatc gtcgcatggt     44280
     ctcgtagtaa tacaaaccgt ttcgtgttta gttagttcac cttggtgcac agtgggatcc     44340
     gtggcgcacg tcaagaaata ccgatctcaa tacggtggtt aaagcaatgg aacctgttca     44400
     atataaaagc cggactatga catttcacta catacaacag ggagaatcga gaccaatgtc     44460
     accattttat ttctttgatt gtttctcaaa ctctaagtct agtcacgcca ggcctaatgt     44520
     agttagtcga acataatctg gtcatcgccc ttttcctatt cgacagcccg aattggttta     44580
     ggccagaagt agattggaat gggtctggcc aatacttggc gacgacccaa agaggacagt     44640
     aggaaggcta gttaggagcg gacaagtaaa tttcagttgg ttgtagtact tgtcttgttt     44700
     cctacggcca tattgagagc agatcataat tctagtaaac ttgagaagtt tcagtattga     44760
     gaggctctat tcggtatatg caaaggccta acctatctat gggctgtgat cggctggtta     44820
     tggccaccga ttgatattga cctcaacttg cgctcttctt attgagtctg ccaaccaggg     44880
     gatcgagcga gggataatgg ctcatcttct acgccacatt gcaaccgtca ccctgtgtcc     44940
     agttccccga tgctatctcc gcctaacgtg catccggcga tgtcggtgga gtcgaccgtg     45000
     tttcgcgctt ggatcaagag aaactgtaac atgacataag tactgtaaac ggaacgcttc     45060
     aaaaggggtt ataatactta ctgattgggt cactagaaag gcgatggctt cgcctcacgc     45120
     tgtgagtggg tagcgagcca ggtgtctgtg ttgcagagaa ttgtcagcgc aagtcttcgt     45180
     gatatcgtaa tatatgggca gtgtgtacta ccggctctgg tgggaacatg attgccttta     45240
     atggcctgga agcctggtgg attattagca tatctcggac tcggacgtcg aaagaaagag     45300
     tcataccact ggaatggtaa ccagtaggac gcccagaatg aagaccccga gtgcgatcat     45360
     ctgtaatatt ttttagaaac gctatatgca tcgcgaaggg gaatgaggga aagagttcga     45420
     tgttatatac ctgacttttg taggcagtct tgcaatacaa attgtggttt tggggatata     45480
     tataacatga gggagagagc taccgacccc tgttgaagtc acaatctaaa ctcgttggcc     45540
     cgcagcaatt tgatgctatc gcctactcag aaacatgagg aatttttgaa ttcattctac     45600
     ccacttaaac ggtaccccaa cctcagtcaa ccaggttctc acatttagca atgatatata     45660
     tttaggggaa ttcagcagct cacatgctac gtatcgcttc attagtttag atcattattt     45720
     ataaaaccac caaagggcta aaattcacaa attaatcacc tctatggtcc cgaaagtttt     45780
     gctacatgag ggtatgtttg tcaccgaatt tgacaaccgg cgtgcttact aattagctaa     45840
     ccacttcgga caggggcgat ggaaagcata atctcgctac ccggattttc ggctcgctac     45900
     tttccatttt gcgctcaaca ccagatcctg cagttcatac agcgacaact cgaaacccat     45960
     gccttctgct tccttcagcg ttggcttcca tcggagtctc tcgcagccgg atggacttgc     46020
     ccagaggcct taagagttgc acaaattctt tcgtctcttg gaagtccatg aaggaaaagt     46080
     caaggacgaa tgttttcagt tgacctggag cacgttgaca ggatggcgtc gcgtgattag     46140
     tagcattcgc cacgcagctg tgcaccgcat tccacacgat cggaaaacat tccttaagat     46200
     ggttcgcgcg gccatcaaat tttcgaaatg catcgctggc ttcgaaagct ccaaaagact     46260
     ttgtcgcatt caaaagttcg tgaagacatc gctttcaggg ttcgaccagc tgacagccca     46320
     gctaaaacac aatgcccgct tacaaatttc tttgggtgaa gcccaccgcg atcatttagc     46380
     ccggcggttg gttttgcttc cggaagctgt caggagagtg cttcagagca ttgaagacgg     46440
     cttcgtctct aaagtgaaac agtttttaca cgcggagttc aaaagtactt agggggtcgt     46500
     ccgcgtatcc tacctacaac gccaagcgca tggcgaactg caccgtctcg taaaaagagt     46560
     agggatataa agaatgaatt ctgaaattgc tcctatactt tcaagttccg tgaaaatgct     46620
     caagccacag atctaattct gtctaggtgt caggtcactc cgtccacttt cattccgaac     46680
     ccacctcatc cgcttgtctt cagtcatctg tcttgacagg agtcaaagca acacaaagct     46740
     ctggaagtgt caaagccatc gaagcgaaga ctgcctaaca ggagagacct tccactgctg     46800
     cttccactcc tgttctgcac tggtttcctc ggctcgcgat ttgtcaagag ccactcttaa     46860
     tgaaacgata gctcgaatca agcgcgggtc cccagaaggg ctgtttgccc ggttgaaatg     46920
     atactgcaaa gccagacttt gagttgcgtc cattgtggtg ctgacaagtt ggtggaagct     46980
     ctcaaaacac ttgcaataaa agtcgttctc aagtccctgt tgacggtgct gctgtatcct     47040
     ttcggtcttc aattcggcca ttgacatttc gggttgtgtt ttggatttcc tcagtcgtgg     47100
     ccgggtggtt tccaaggcca tggtagatcc gctcgccata gagatttggt ggtccagtaa     47160
     atttatctca ggaagagatg gcttgatttg tagggtagtt ggtatggtag taatagggat     47220
     agcatctttg gctgtgtccg tggatcgact gtagatgctt gaagtgttgt cgcgagagta     47280
     accgggagtt cgatgttgga aagggttcat atcggtcatg gactgtccac gtctcggctc     47340
     tctgaaaccg acgtacatag ggaacgggag ttactagcgt tttaagaacg gaaagtccat     47400
     ttcatggacg aaacagtcaa tttgtgctct aagattgttt ctgaacggct tccctcacat     47460
     tctcaccacc gttgacgaac cgcgcactct tagccgtaga ccagcaccgg catagtgcca     47520
     agctagtctg taggaatttc accaatgttc ccaggcgcca agtgtattgc catactaagg     47580
     ggtggtatta tagagacgtt gtatggttct ttgacagcga gcgaactttt gtcttcgccc     47640
     cgccacctac tcgcgctttc agatttcaac taacgagggc gaccataaca cgtgtccacg     47700
     ggttacaagg tatagacaga tcatatcccg cagttcgaat tcagactcct atctagaata     47760
     attgtatgat tctaattgtt gctattattg ccagagtaaa cctagtctcc gtgcgtcttg     47820
     catttcatcg gggtgacccg tcgagaccta attacatttt gtattctact tattaaccgg     47880
     cttgaacgcc aaactacagt ttcacccagc tcataaccgc cgccgtttct gccccaaagc     47940
     aggctccagg aagtgaacta gtcgctttga cccgcgatag cagtaacagg atctctgcgg     48000
     cggccattct tgatctcgat gatctgcgcg accgaactgg gcgtaaacct tttgctcatc     48060
     gaggaattcc tgcgccgatt tggggaaacc accaatcctt tcgcgaaagg tatcattggc     48120
     aatttcaatt gtgaccattt cgtcaaggct ggtgacccga aaatcaacac gcttcctgaa     48180
     gtatccacaa aaccggcaaa tgtcgactag atctatgctt cctaaatcaa gatcctgacc     48240
     agacttaaat ctggcgccgg ggaactcgac aagcacccgc tgcaagatct cggcaggatt     48300
     tggtcttgaa caaagaacag atccccgaca atgaaatgaa gccttaccct ggatgggagt     48360
     ttcatccaac tcaaagaaaa acattgccga cgcgagaatg gtcctcacaa gctcagctgg     48420
     aactgcaaaa tccatatccg acatcgcttc cagcgagcac acatcgtcta atccagggag     48480
     cgtcccatcg attgcctggt ctagtcggaa aatatcaggc gtcaacagat ggggtaggta     48540
     attcagagct tccaaaaacc cttgctttcc atccatagat ggagagcaca tcatggcccg     48600
     gaacagtcgg ggaagaggcc cctcccagat tcgacccagt atgcccgttg gacgactggg     48660
     gggagatgtg gagaagcctg ttccgacaga gaggagaagg tcgtgtcgtt tcgccatggg     48720
     ccagatgatg ctcgactctc gcaaagcaat ggcgagtggg ttgttcgcac ggaccccacc     48780
     gtcttgcaga caaaggcctg gcaactcttt tggttggaag tagctagaaa atgtcagcgt     48840
     gttgaaatgt ctcatggtgc ttggactcac atgggcgctg caccactgca tatcgatctg     48900
     tcaaaagcta actgttagca aggtcgacta ccactgtcca aatcaactgg ctgcaaacgg     48960
     tcacttacgc gtcaagtaag gaagggtctt gtcggtcgtt gtgtggagtt agaaactcgt     49020
     aggcggtatt ggtggaacgt ggacttgttc ctcggtaagt ggctagcacg caggctttac     49080
     catcagatgt gcggcttgct acaatggcga tccggcaacc cgcaggattg gcggtggcga     49140
     catcgaacat gcgacgagat gggttaacgg ctgctttcaa aatcttcgac agaccttcgg     49200
     aattataaaa accatctgtg gtcaagttga acgccgaggc aaaccaccgg atacagcgag     49260
     gaattggggt ttcggacgaa tgacaaaaaa tgttacgcgc caggtgcggg aacgcatcga     49320
     aacattgcgt gaccgaagat tgattgagaa aaacgtcaat tgccgtcaat gcgcctagag     49380
     gaggtttctt agtatatcaa ccacaataaa agactcggcc actcggcgta cgtacctaca     49440
     ctggttccaa tgcacaggtc cggcaaagat gcgatcggaa tgccaatgcg actttctaaa     49500
     gcccgtagaa ggcccagttg gatcaggccg cgcactccac caccatctaa agtgagaatc     49560
     acagggggct tcgttggagg cagttggcga acggtgacgt cngacctctc ttcgcagatg     49620
     ggacattgag caacctcgaa atggtactcc ccaagacgac ttggctttcc gaagatcacg     49680
     acacaagtgt cacatattgc atgtttacac gggagcatat gctccggggg tcgactcaga     49740
     cagaccaaac aagtagtggt ggagcgaagc ccaccccacc ggcgatacaa gcgacacaac     49800
     gtctcttttc gaatggctgc cgatgtcttt actgcgctca attgcacaaa gtggtgcacg     49860
     aagcgggatg aaacgccagc aatatggtat ttgaactcat tgtcccaaat acttaggcat     49920
     cgcttctcat aaagtgcagc gaacaccacg gtaggcgaga atcctggaca ggttagcttc     49980
     ttaattgggt tcaggagagt atgagtcaag aaatatggtc ataccatgca tttgaggggg     50040
     ataggcgtcc atcaagaagg ccgaggctac aaggtcatca aagtcctcct ttgagtagcc     50100
     aatggatgtt tgcgtaacct ctcgaaggca atcgtccatt gatttgtttt tcacatagtt     50160
     cccttcgggc tcttgccaaa agatcaaatg gtgctgcatg caggagcctt tcgtggcttt     50220
     gtacgccagt gctccagaaa gcgctcagat gagacgccga gaagcgtcga caattggaaa     50280
     ttcgctcggc ctggactata ttgagctgct taacgatcaa tgtttgcagt ggctggaaaa     50340
     cgacgctatc tgaaagcccg tgacgtggac gcaggtccag aatcgtgact gtcccagtat     50400
     cgagcttttg gagctgagcg cattcctgtg cgaaggcttc tgttacatgt tgactgttgg     50460
     tcaagacgat gactacctgc aggggagcgg gaacaacctc atcgccaatt gtaagctgtc     50520
     gacgtggtct ctgtaataag tttgttgcgg cttggatgtc agggacggaa tcgaggaata     50580
     aacacaggat ctgggtccat ggtaaaacga gttgcctctt gacctcttgc tgtagccttg     50640
     caggggtcaa cgtcccgtct gcgcccccta gtgagaaggt ttgatgcttt gtcgttgaat     50700
     tctttagcca cttggaatcc cccaaccttt gttcgagaca tagaccgctt tcagcaaaca     50760
     atataggatt ctgtgtatgg gcggtcttgg tgctgagatg gagacggatc aagcctgcgg     50820
     ggcctttccg tgtaatgttg ttgtagggga acagagcccg caaggcttta ttgcggtttg     50880
     aatttccgta aaagtagagc agggatggat attgatattt tggattgggt aattcctgca     50940
     ctagttgttc taggcggttg gtatcaacta aatcccaagc ttcattctct ttgacgaggt     51000
     caagccaggc agccattaga gagattgaga gattgagaga ttgagagatt ggcaaaagaa     51060
     tgggcctatt gggaacctta tatacgggct ctcatctgaa agggacaggc agtggcttaa     51120
     tggtggtcga cgctcaggtt gaagttggca taatcttgtc tcgcctcaaa atcccctctg     51180
     aaccaaaaat atgtcaagca ccagaccagt gcattcgcag acgacgctcg cttaaaccaa     51240
     ttatgcagca actttcacgg tttgtcagac ggcattcttt tttgacatcg gaaaccagac     51300
     cacataagtc tcaccgcaag ataaaaatgc gtcttcccct atactaggac ccctagacct     51360
     agttagagca cgtatcatag tggcctttca tatggactat ttaaagagct ggcacggttc     51420
     tttgttgatt tgcctcctta cggtaacctt aaaacttttt ggtcatggcc ttcggtgtgg     51480
     acgatcatac aagtacgcca gcgaaaacgg gattggaaaa gactccactt cgcgaaattg     51540
     accctgtgct tgttctgtct tgctcagctg cggatgtggc cccggcgctg tgtagagtca     51600
     accagatgca ccacgccgat gaaacttcct atgtcagaat gcttagagaa gaagcagaaa     51660
     tggatatgcg tttcagtatc acagttggcg cggctaactg ggcactgctg gccggctatc     51720
     tagtcattcc cggcacattc acttcgctgc agacctcaaa ccaggttgaa aagacgttgc     51780
     aagccaacga ggccggtcgt acagttctac atatgatcca gaaccccccg ttactcgcta     51840
     ttgcgtgctt gctttttgct agtggaattg cggctctcat gtggctgatg catttcccaa     51900
     atctcagggg gaactacccc tggctaatca acaaagtttt tttgtaagtg aacaagtccc     51960
     aactgaaaga ggtatgaaaa gccagatcca actctaatcc tggactagac ccctatgcct     52020
     acatgctgct gctgggctgc tgaccactgt catcaatgtt tgtacatctc aaggtgggga     52080
     ttggtcggtg atggctatta taacaactgc tgttactgga gcaactcttc tgagctgttc     52140
     agcacttctt gcgctttaca agttctacaa gctggagcga atcagaaaag aagatgagga     52200
     tattcgacgt tctcgagcat ccaccactct taataggtga tatcagagtt ttcagaccgg     52260
     agaagagcct ggtcagaagt atcaccgttg catcgagact ggtatttccc atcttttcct     52320
     ttttgattct acccctcatt ctggtactgc ggaagccttt ttgcttctag agtttagttg     52380
     tgagctctca caaggggcct aaatgtggat cttggcgcgc gcccgatagt gctctcgtcc     52440
     atccccgtct cacagcatca cttcttgttc agttttccga tttccatcca atattcatca     52500
     tgtataccta ttatctaatg aaattggtcc tagcccagaa aaatagcatg ttcaatcgta     52560
     aaagagattt tcgtacggaa gccctcggcg gtcagtagat tgaagatcgc ctaaatggcg     52620
     ctctaaatcg atagaatggt tagactgatt gctgataggc cgatagatag catgctttta     52680
     tttaaattga cacttctcat tctgccaaat atacttcatc tttccaaata aaagaaattg     52740
     aacgattacc ctgtagatag taaatatata ctgtttgttt atgtacatcg aaagaacctt     52800
     tcctttggtt tttgctggca tgttgattgt taaatcctac tcttatttcc tgcgagtcta     52860
     tctcatcttc tagtaaaaat catcaaattt tggaaatggc tatctttccc acctgatgtt     52920
     ggatgttgtt agcaaacaag cttatagaca gggtaagttt cgagaaattt aatatctcaa     52980
     gttttggtct atcgatttcc cagatcaata tgctgtgatt ccccgaaatg tcaaagaaac     53040
     tgttcaacat gacagccnta gggagctacg tacgcacatg acatacggtg atggaagttg     53100
     tgctaacaga ccnagcnctt aagtcatgcc gttaattgag ggcaacaaga tttagttcaa     53160
     ttagccatgt tgagaaaggt tggctagtca aacctgctac gtaaccattc atactgttgc     53220
     gcatgatccg gataccgttg aagctattta ttaagtaacg ttgatgtttc gggtagttgg     53280
     tgatcctagt gccagcatga tttatttaaa ggctaaggtg taagtgaaat atgagagagc     53340
     ataaatatta ggccaaccgc ctttgtgagc ccccctttct actnaaatac ctgagtccta     53400
     tcctcagaca gatnacccaa aacgcgctac tcttgggaat tagcctgttt tgccagtgcg     53460
     tacggtagga agcccccact ccgcaaaccc cattccctgg caatatctct aatagaccga     53520
     gctggacata gccaggagcc aagtntcttc cgatagcggg atcaaatcta acctgggcca     53580
     aatgacatgt ctaccaaagt cctaacgact accgtgacgc cggaaacagt gcctcacgca     53640
     caaaaccagt acgtagatca accaacatta ccgacattgc tatgtttatg ggttgacatt     53700
     ttcaagtacc gagagttttt catgtgatat aattacgagc caccctactg tcgncccatg     53760
     tgtcggagac gaaatggcgt ccactcaaan catgaagaca acccaaacgc cctcctgcaa     53820
     cgccgccttg cccttagctt tgataattcc aacattcacc gctgccannn nnnnnnnnnn     53880
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     53940
     nnnnnnnnnn nnnnnnnnnn nnnnnnnagc tcacttgaat gtagtgtagc ttgtactccg     54000
     cgaggagtag taagacgttc aggattacaa cgaggatgtt gatgcaaaat agatggataa     54060
     tggcgttgcg gccgtcgcga ccgcggattg taatggcact cttgaaatga tgcaccgctt     54120
     tatatatata tatatgccac agatgacgaa gtcttgtatg caaaaaaccg tcgattggat     54180
     ccggtcaaat atcgcggcag gacgagcaaa gcgtgcatcg ccgcggttga ggccgaagaa     54240
     aaaaacggtc attggtatat gtaggatgca agcgtttgta atgatcatcc atagaaccca     54300
     ccgcaccttt ctcatgtcgg agaaaacgag gtgcagacgc gagtagagga cgacagcttg     54360
     gccggtaacc atggcgtacc atcctatcat gaaggggatg gacgtcggga ggttggacgc     54420
     ctgagaaata aagcgagcca tagcaggaat ggcatgcacg agaattcccc aggatgcaaa     54480
     ttgcatgctc tagaaataga ggccccggta gcgcttgaat gagtcgaacg tgacaatcgc     54540
     tgtttctagg gcattgtacg cgccgataga gaacatggac acgatctgga tgatggagat     54600
     gttctccatg agaatggccc caacatttgg tggcaggctg gtcatgagtg tatccatggt     54660
     ctaataaggc ttaacgggta caaagagggc tagaagtata gaggataaac gatcaacagc     54720
     ttggtttata aaagcctctc gaaccgaaaa ctgccctcgc aatgagatca tgacatcgta     54780
     gctagggggc tccttggaag ctctaaaaac gtctggactc ttatcggctt ggggggaata     54840
     tgcttggttg gattgccagt ggtctgaatg ggtctaacgg gtaagttagc tatgtcgaaa     54900
     ccagagtaat ttgtagttga gactgaggca tacaattgat tttcaatcca tgccacagtt     54960
     atttttgacg tgaaggaaag ctttcccact attcccaagt catagggcta gtttcacgac     55020
     gactgcaaaa ccgagggcgg gatcgtcggc ccatggctaa tcgcctcatc ttgaatcttg     55080
     acaaatgatt tccgatgaac catggaaacg ctggttcggg gagaaaatgg gattatccgt     55140
     ggataaatag gatttagttt cgatgtcatc ggaaacctta ccaataaact ttctgctcca     55200
     cctgctttct aggtcggccg tggttgaagt tgtccctaca gtcataggag aatccagaag     55260
     aatcgggtat gctcaccacg ggcgtagtct tttgaaatat tatgaggtag cactactgta     55320
     ttcaaaatat tctcgatctc cagagtctga ggacgggtag aatgagccgg atgctggaaa     55380
     aggagtggga ccgcagatgg tcggcccaca ccgccgactc tttgccattt ccgtcagcca     55440
     atcggtttct cggcttttca ggcaaaaccc aaaaaaatat gcttatgtaa tcccagctga     55500
     tccgttcaaa tccgttgaat gtttataagc tgtctgctag ggttataaga actggcgatc     55560
     gaatctgagc agatagaaag cgcagatttc agttttaaag ggagtatact cattagggaa     55620
     gctagtacag gagaagatac ataccttctt gaacatcctt caaaggacga gactaacgag     55680
     aaccaacagg tcggcactcg acgaggacca agttattttc ttgtgagagc aggtaggaga     55740
     acccgaccat ggattgcttt cagcgtacca ttcttttgct gggcacctgc gtgatattcc     55800
     aaatacctca actgccgtac ctgtgagggt ggtcccttca gcaggaccaa gcaacaaagg     55860
     tatgttgcat aattactggc ctgtcgagac taggcttgtg gatcgtgtct ggactttttt     55920
     gaaaaacttt gctatttctt ctctcgacta caaatagaac ctgcttgatc tattgtcccg     55980
     tgggtcatcg acgagttttc tatcacagga ccgtaccagc gtcggtccat attcacacgc     56040
     ggtgtttgat tggccctaca agtgcttcct ttcagctaat gagccttgat agctgaaatg     56100
     cctcaaatgg ttgccctgga aactaagccc aggttcctgt tatggctttt tcgacacgat     56160
     ctaaagtctc atagtcagtt atggaaccat ggtgagcttt gaggaatgta gcacgagtgg     56220
     caacggttgg tgcaacttgg atcccaaatc ctagttccat aaaacaaagc cctatacatg     56280
     tccttagttg atttctggat tgttttcttc tccgaatgaa atggatgtct ttatggccca     56340
     actttcggaa actgttgtaa tagtgggacc gtgtaaatag tggaagttac atctaggaca     56400
     atagtacaac tacaccacac atggctgagg ccagagagcc cttcttgttt ccaagagcgg     56460
     ctcggatggt tcggctctgg tcgatactga ggcacaaccg tatacctcaa catagatccc     56520
     ggtgcgcggc ggtcgatcac tttctccaca ataaaaccgc agatcttgtg cttttgcgct     56580
     agcgcaccgt ggggcccctg tgtgtcaatg ggtacttgac tttcaggctc atgatgctga     56640
     tgccgacaca gctgcttggc aggggggagg tcacgcgttc acnnnnnnnn nnnnnnnnnn     56700
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     56760
     nnnnnnnnnn nnnnnnnnnn nngttaccat catgatgctt ctgcacattg atttgggaac     56820
     caacggaagt gtcagtcagc cacattctag cctccagctg ctcgatcacc accgatgaac     56880
     tcgttggaat tgtcaagccg gtgagccaat aaaatctctt gcaggtgcat tcgaaattaa     56940
     cttggaatag gtattagaag gaatccaata tctgcgcggg ctcgggcgag cactcgctac     57000
     cctaggcccg gaaacaatcc tgcttacgca gtctggtgat gtcaagatta gtgaggtatc     57060
     cgcggatatt gcgaaaattg ataaaaactg actttcaata gtgggcgtcg agaatagctg     57120
     cgaaattaaa gaatcggaaa tgaatcctgc gacgatgaaa ttatgcgctc tagccgatgt     57180
     tgtcacgaaa ttgatgttga aaaatcgtac atacgagtgg gaagcggaga ttcagaactt     57240
     accttgccag ctggaaagta tctccgtcga agaaatcttg caggtaagtt catgctgtct     57300
     catcatgttc tcggctaatg tgacagaacg agatgtttac ccgagattca tgcgaggaag     57360
     agttgaaatt gttggtcagt gtagccaaca agactgccta tcacggtatc aaatcttact     57420
     atgctcgttg ctgaaggaca aactcattgg cttttgctcg gctgtttttt gaggcctacc     57480
     aaatcgagaa ggaacccgcg atcctatttt ccatctgtgc tgttcggaca atatattatt     57540
     ggtgcataag gaaagctagg tacggcagat tggtagatgg agcatggttc cgacggtggt     57600
     agtttgcaaa cgctcttcaa gcgaacaaat atagtaggtt caggatagcc ccgactacac     57660
     tcaatttgcg acctgttgtt ataatcagtt cttacttata tgacccatcg gtattgtcaa     57720
     tttatttgca tatttttgca ttcgtttatc gcctacttaa ctagggtcta tgtaacacaa     57780
     ggagtgcgtt gcttctgttt ggatttgaga cataatcata cccgctgggc aaaatattat     57840
     cattatctcg cagatgtgct ccccgctgga actataatac tgaaaccagg tttgtaatca     57900
     acaaagagag gtgaatatta ttagactgga attttccact tcacagacga tctggattga     57960
     gctagatggg tctgaacgct cccgtctata tatctcagcg atgcaggacc cattgctcat     58020
     caggatcttt atacaagttt agctaccctg gcagccacac gaacaaggca tcgagttggc     58080
     attttcagtg gtggaattag cctcgccggt gtcggctgta tcggtgatgg gaattgggcc     58140
     aaatgtagga tttccggtgc ataccggttc gccttcttgc ggtcgatatt tgctgtcgcc     58200
     attatattca acaatacttc caggccaagg gaagtgaatg tctacatttt ctctggtaat     58260
     gcagccattc acgctgcctc ccatcaagat ttccgggtcc ttttgcaggg catccccctt     58320
     cgtaggactt gatgactttc cattccgaat tctttgtcgg ctcgcgatca ctggtgaggc     58380
     tcacctggca ggacccaccg ccatgggtgg cactgcccag aagcttgatg gaattattgc     58440
     tcccagtccg ataagtcgcc tcttcagtcg gaacgacaaa gtcacctggg gatatcttgc     58500
     aaggaaagtc actaccatct gcagcaagtg gcgagttgtc aagtgtcttt ctactagatc     58560
     cgtagggttc gggagaggtc attctcaggt gcgcataggt cggcgaaaat gcaactgcct     58620
     gcaaaagtag acaccatgtc acgagtatca tagtaaaagg ggagatggcc tcctgtgatc     58680
     aaataccggt tagttatcat gtagctgaag gttatactag gtttcgctgc cgcttatata     58740
     tctccgaagt gcacatgaat gcaaggacgc ttgaactgtt gaggctgccg cggttatatg     58800
     agtccatcac gaaaccacag tgcagcctag ttgtgctgtt cttttggctt aaagtgcgcc     58860
     gcagcaggta gaaatttggc tttcgagacg agaccaatgt gattctaccg attgaccgga     58920
     acaagtggtg annnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     58980
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nacatcatat     59040
     ttcgatccag atcactgctg cgaccgaagg gttcgcctag ttgcattatc ctctgtagta     59100
     ctgttcttcc cctctttggc catcatctcc atagctgtct ccacgaccgc caaccgactg     59160
     cggatgtcct ccaagtcact gcgaatagtt gcaatccagc tgttagagtt atccaatgct     59220
     ttttgcatga gcctgggaaa agtcagcctt tgttcgttct ctgatgtgtc gcataactaa     59280
     cttcgttcgg atatctaggc tgattgttgt aagcagacgc atcacaaaac attattatag     59340
     gggggcaaat tcgcactcac tctgcggcac attgtaaggc gatcatattg cagtcctccg     59400
     cgagattagc ctgtccgggt tgttccagtt cttcttctgg tcgcgggccc atactccagg     59460
     tgtgtggagg actttcctgg ccatcctcca ctacgatgtc gttgtggtgg ttgccaaaga     59520
     agccattctc ctgcaaagaa gactcttcct cagtggtatc accttccgct gaccctggcg     59580
     gactccagat attctcggac ccggaggatg acagggacag tgcacgttgt aatcggctcc     59640
     gaaagctttg tcgttgatca gtgaacggaa tctttcgaat tcttcccata gttggatctg     59700
     tgtcaaggta agataatgag ttctcccagc cagatgttac aggagaagtc gcacaagctg     59760
     atatgaagag ttagttctcc aaaccggaac ttgtgatcgg ggtgtgctag gccactatgt     59820
     tacatccgta cttacagcaa atttcgcttg gtttggaata cattcagcca atcagtcacg     59880
     attttcatta aactttaggg gaatgaactt tgtaggaagg caagttttgc ctctaaagtc     59940
     tgtttgaggt tacattattc agtacccggt ggggcttggt ctgggaactc attgctgtgt     60000
     tcttttgacg tacagtaatt gcattcaaga acaatttcta ggagtacgaa attgacagtt     60060
     aggcgttctt atagctaggg attgtttcaa cacagatggc ttgggggagc ctgaaatacg     60120
     aagtcaataa ttcggaattc agactcaccg aaccgattcc ccagaatgat ccatgggtca     60180
     tgttattgag actttagaag aattttcgtg aaccaggggt actatcttaa ctttttactc     60240
     ggacctggag aggatttatg ctcacttttc ccctctatca ggagctcaag tcgtgctatt     60300
     gtccgaaagg gtcgttctgg ttactgtcag ttcatgcgat atgtcccctc gaagcgaggt     60360
     ggcctgggcg gaatgggagg aaaagaacct tctcccctgg ctggacgctc atcgggcgct     60420
     gccgtggaaa gcccgctccc acgcatattc tgaacaatat cagatggacc gaagcgctga     60480
     gtctctgcga ggaaaaaagt accatattct gcgcaagcaa cgtcgcattg gtgcagaccg     60540
     cttgagcatc caggccatcc aagccatcca agccgagcag gagctcatcg ctcggccggc     60600
     cataaggctt cattagcgaa tctcacaagc agaaggcctg cgcaaagtaa tattgaaaaa     60660
     tggtttcaaa caatcctaac cactgagact agccagatcg acagcattga atcaacaaag     60720
     aggaaaggtt cgagaccagg tacgaactaa tgtttaccac cctttgacca caagctaatc     60780
     acacatcaca ggccgcgcga tgccattact ccgcccttta cggcgtgaag aaacacgatc     60840
     gtcgacgcag atttggaact atgtacatcg tgtctgtgca gccaggaagc tgagataccg     60900
     atgagcggaa catccacgct accagcagtt cgttggtatc tgcgctacat cgcgatctcg     60960
     aagcagcaat agcaaatatc tcgatgaatt agtgctgttg gatgttgcta cgaacgggga     61020
     aaatggcaaa catggcagct gagcaatcaa gctactgcat gattgttgta tgtacgaata     61080
     cacatattat caaaatataa acaagcacca ttccttggaa ttacgacaat agcgagggag     61140
     taccaaggtt atagtttgac aaaagttagt tccccagaga tcgtagaaca tggccgggat     61200
     cgtcgatcga tcgccgaacc cggaaaataa agttcgataa gccatggaaa tgctccctcg     61260
     gtgagaggat gcgggaggat gcggctgtcc cgaatgatcc tcatggaaag cttatctaaa     61320
     cagcctctgc tacacttgct ttgtagattg ctagcccaaa aaaaaagaga tccggagcag     61380
     gaccaacaaa ttctcatgct gctcatatat aggatattgg gaaaggaata ttttattaga     61440
     agatactgca ttcagcgtca ttctcgagat gggcagggtg cttggaatac aggttaggtg     61500
     ccgcaggtgg gccggcccac agaacccact cccgggagcc actcggtttt cgggtttagt     61560
     tcaaaaaccg gagatattta cgtaagctca tgtgatccac tggcattctt tctagttaca     61620
     agccatctgc tagagttacc agactggcga tagaattgag catatggaga ggaattgtct     61680
     ggctcgaaga gagtatagta taatcatcag gggaaagctt ggtgcaggag aagatacata     61740
     gcttctagaa cgttctacag accagatagg caaagttctg cttcccactt gacaggggta     61800
     cttactttct aatgactgcg accaagagaa cacaaaagaa cacaaccacg ggtcgggttg     61860
     tagcctacca ttctgtcgcc aaagtctgtg tgttcttcca aatactcacc tgccccagca     61920
     gtacttccta ggcaataatc ccccgtacca tcggacactg acggccgaaa gctttgggct     61980
     tgtggatcgt gtctggacct ctgcaattcg ttccagtttc tctgcgggcg acaaatagaa     62040
     cctccctgaa tctactgtcc cgtgggtcgt cgctgagatc tgcatcgcag aaccctacct     62100
     gcgtctgtct aaattcacgc gtggtgtttg attggccggt cgggtgcttt tcgcctccag     62160
     ggtctcatca gtgtaatagt agcgttgcaa tcttgcgagg ggtggcgatc acgagaacct     62220
     agttcgtggg cttggttgca tcagttcaca tggttgtcct ggaaactaga cccagtttct     62280
     tgtctgagct tttcaaaggt ctagaccctt tttggctatc atgccaaaga aagacaatct     62340
     tcatcctgag tttgaaagta tgccagtgcc tatgcgccca gggagtagac attttagtaa     62400
     aggcaacaca agttaactgc gattagaaag gaaagaaata acattcagcg gcgcgagcct     62460
     agagatggca gtattgattc tagtgagacc gaaaggtcct ccggccaacc gcaggtacag     62520
     cacagcgttt ccgtggccat ctccagccca ttatttcggc atctgtcgaa gcacttcaat     62580
     cctcatgaaa gagacggtga ccgtggttaa aacggggaga tatagaatgc aagcgcgttg     62640
     agcgatttaa ttgcaaattc ggtgatgggt acgaatctta ctttcgcggc attactttct     62700
     cctcaacagt cgatgaaagt gggccatcag acccaacgca caattttgag aggaatacca     62760
     ggtcgagact tggctctgta ggccacaaag tctccaaaca ccccttcaac gtcgttgaaa     62820
     tcgcttcagc gcttattaac gagaccgtga ctctcgctac caactgcgcg actggttcct     62880
     tggtagagac gtagccgaaa aaatataaaa ggagcccgat tcccagccca aaaaaaatca     62940
     ggacttcggt cctcacactc cggtgtgtca tggtgtccct ctcttgcctg cgggcttgag     63000
     agtctccgtg accacggctg tcgctgccac gagcccagtg atgtaagact tgcgctccct     63060
     cgctgccacg agccccgcga gtgtaaaaag gtgcttcgca ggataggtct gcgtgaacaa     63120
     caatcctcgc aggggggcgc tgcattacca agttctccgc agcctaggcc ctgcgtcaac     63180
     aaagggcctc gcaggggcat ctgcgaaacc aagagtctcc gcagggacat ctgcgacaaa     63240
     aagtccctct agcccgtgca ggcacctctt cgtggtgcta gggaccagta ttagagtatt     63300
     caagagtacc cgaagaagca aagacctgcg caacatcttc atcgtctgtt cattgttccg     63360
     aagggtcatc attggataca tagaaggagc cctagttaga tcttcgtcga ttcaacagcc     63420
     aaaatcataa actaacaaat tgaagcgtct tcagtatcaa atgacgtatt tcacattttt     63480
     ttcccttggt agcttgtgat ccaataactt cctcgctaca atagaaattg gcatctttca     63540
     ttcagatgta ggcaaacaga gatgagtgtt gtctaggaac gcttgttgcg ttgaaccgtt     63600
     agcgttgatg tgagtgttga tgtgagtgtt gatggtgagt gttgatgtgt gtggtgattg     63660
     agcgcagaaa gcgaggtgac ggtaggatga cccgtcaacc cgttgaagct tggccaaacg     63720
     ttgtcaacgc tcaatttgag tgatgaccac caaacttcga agataaattg tgtttttttt     63780
     tttttttttt gttctatttt gctcttcgtt actatccgaa ctacccattc tgcaatgctg     63840
     tttgccgggt ttctgaggct tccaacgaaa gtggaagagg cgtctagttg agatatctct     63900
     cacgccaatg ggcgttcata tctggccctc aacatcgtca ggcttgatca gttttcccgg     63960
     ccaactcgtt gacattcctc ctctcaaata cactaccaag cgcccgctga aaataaaagc     64020
     aaattctatt cagaagctga ctgcgttgat tgactgatgt ggggatcgta aaactcagtc     64080
     tatagccgcc tgcgcctaca tattctataa gagataccaa ggctagttgg aaacagtact     64140
     gtccagatcc ttgagtttct cctgtggaca aaatggactc cccaaacagc tcgccagacc     64200
     aggaaaagca aggaaaacag cagcccaatg aattgccaat ccataatgat aaggaccata     64260
     aactggaatc ttcagatcat gtccctccat tggtaagtaa aatccgtcag cttcgaattc     64320
     tttggctgac catcgtagcc ctccccttcg caacacgaag aagcaacaag acataccttg     64380
     gcgaccgagc cgtttcaacc cacgttgaag gtgctagcag acctcgaacg caacgatccc     64440
     aagtttgcct ttccagctgc tcgacttgtt ggactctacc gacgcctatg ggagtcatgc     64500
     gtttccaagc acatcgatgt ccaaaagatt gaccagagca atgggatctt gaaggaggga     64560
     cggaaagctg gagactgagc attttttatt cctctcttat gaggacaaac taggggaatt     64620
     tataaccaca tgctacagta agttatcgaa tgcgttgaat gtatcaacag cgtgcaccgt     64680
     tggcacccgt caccaacaca acgaaagttc accggcagta taagccttat ctctccttag     64740
     ggaagacaga aatagatagc ggaaaaacaa atgtcattat tcccccccat agacgctcta     64800
     ccacatggac actttaccaa ggctcaggct catcgacagg gtaggcttga agatcgctcg     64860
     cttcaaaggc tgaaacaaca tcattacaaa gagcctgaac cgctcgcttg cgctccgaca     64920
     atactgaagc ttgcacattg cagagctgta gaaggatatc gctatcgctt gctaacaagt     64980
     catttgacgc ttgaagctgt cgctgctcct cctcgagtcg tattttctgg gccgatttga     65040
     cgacgtagca ttcccataag caaaagtaca agtcgagcaa tttgagggct ggtgtagcga     65100
     gggagtcatt gaggcttact acttttatga actccgccgt aagggtacct cgtgttctca     65160
     ctggaaccta ttcagtatta gtgggttttt tttatttcct tcccagaggg ggattgacct     65220
     accttgggtt caatagttgt gccgtttgaa gcttgttgtg gttggttttc caacttgggt     65280
     tcatcttctg gagcgtgaga tactcggcac tgtctcttgg ccggccgatc aatgggggaa     65340
     ggcgaagtgg gatggtccat tttggtgaat tggatcagaa attatgctcg aggggcattt     65400
     atagctgaca attcacgtga ggctgctgtt atttctacca gtgcttcctc acctagggtc     65460
     gactgcaatt ttgaagccag tgaacagtta gctcaaccgc tgacgctcga tctcaccacc     65520
     tgctgagagc aaactgctca ggaataagcg ggattaaatc gcatctacag cattgacaca     65580
     aactaatgca aagtctgtct cataatggta gtctacgagt gtacttccga tgcgtggatg     65640
     ctataaatta ctttcaaatc attgaagctt tgccgtgact gcaaaccatt cgaagtgcgg     65700
     aagtgaagat aatttgattc ccaatcttga tgtcaacagg cgctgggaac agccatctcg     65760
     caccacatca ccagagctac ctgaaataga tgtcgctagc ccttacaaac gatcaaatat     65820
     tctcctcgga gaccgtttca acaatttttt agtcgtgttg tcgtcataaa ttctgctccg     65880
     gatggccctc tggatgcgat agtcctttgc tagatccagg gatctcctca aactgaagtg     65940
     tgtcagtctg ggattggcca caagtgcatc aacaatcgag aaatgtccac ccctgaccgc     66000
     caacatcaat ggatcctcga accattgatt cctcaggttg acatcaattc ggccatggcg     66060
     tagtatttcc cggaccacct ctaggtcacc gccacgggca gcaatgcaga gagcagtgtc     66120
     atgggttgcg acagtgcttt cattaacatt cagacgtgcg ccttgctgta ctaagagcct     66180
     taccacatcg agatgaccat gtgaaaccgc tcgacaaatg ggcggatcta ttaaacccct     66240
     tccattgatc tccacgccct ccatactcag taaacaagca actgtcttca cgtgtccgtg     66300
     atatgcagca acggaaattg gagagtggcc tgcaacgcag agattcagag caatccctgg     66360
     cactgcaagc agccgtcgta gaagtatagt atccaatctc attgcggcat ggtgtaaaga     66420
     tgtagacggg gactcaagtc tcccacggcc tccaacgaaa ttaatgtcga tgtctttctc     66480
     cgccaagagc ctttcggtta tctcgtcgca tgacgagtaa gtagacagcc aaagtggcgt     66540
     attgccatct ttgtctttgc agttcacgtt ggcaaggggg tggcccagga tcaaattgtc     66600
     catttctaag cgtttggttt gaacggcgag atggggcggc gtatagccat tccggttctg     66660
     gatgttcgaa ttcaggccct tttgcctgag aagtcttttg acagcctcta ctgacccata     66720
     ggccactgct tggtgaacag gtagctcagc ctcttgtgat gatttggtac caagaaacac     66780
     tttggtcatc ggatcgtttg aaaaaatcat ttccatcacg ggtctattga aacgacatgc     66840
     ccaagaccac gccgactggc ctgaatcatc ttccaagtta gggtcgctgc cacttaaaag     66900
     tagcagttgc acgaatccta ttcttcctgc gaagactgct aggtgaagcg ccgttcgccc     66960
     gtatttgtgt ttaatgtcca cactggcggc gcggtgctct agcacgctct tgacgatgga     67020
     gaaacccccg tagtggatag catatgacag ggggctgtcg cgcgcttgat tttggatgtt     67080
     gatatctaga tctcgatggc tgagcagcag ttcacgcaca gcagcggaag tgtatttcaa     67140
     cgcccgcatc aaaggagttt tgcctcggta aaatgcattg atgttggcgt tatgccggag     67200
     caaagcctcc ccaagaccaa cgttgtcgta tttgacggcc aggtgcagca ggttgctgtt     67260
     ctgaaatttg atattgtatc tccagatgct gggctgcagt ttaaaatcga agtctttgca     67320
     tgatttttcg agggtaaata atgcactgcc gtccaaatgt gacacaatcc acaacaaaag     67380
     ctcgttgggc agctctgtaa ggttttgctg caatgtatta gctcatcggt aaaatcagca     67440
     agaaatcaaa acagaccatg accggatagg attggagcta ggaagcaaat gaaatgtaaa     67500
     tgtggctgag gtctgaaagt tggacgcctt agatatctcc ctcagctaaa ttctgtggtc     67560
     agctagaagt gtagcccgtc actccgctga ggcgcgtagc aaccacacgg cagcatcaaa     67620
     gccttgacaa gaatgtttgg gcggcgttga aggatctctg gcgtctagct cccgggaacg     67680
     ccaaatcagt tcctggttat gccgatagcc tggagaccga atctaccttg gtacccactt     67740
     ctcacatcta gcgccataag agtaaatcat agcacataac gcgcatcaaa gttccatagg     67800
     caacccagaa tttcacccag catttgtcga ctttgcggct aaccgcagta gatagtctgt     67860
     tcgccaatac atggctatcg cgatggacag tcacaagtgc agctgattgc agcagtggtc     67920
     tggaatgata tcccttctcg caggccactg attggccgta tagtggcgca tactgcgtgc     67980
     gaatgcattc tcggacgtac cgactgtttc aaggaagtgt tccatgccag ccacgtagcc     68040
     atataggtaa ggagccacgg cgatggcata taaagctggc gagggaacgc tgcaagatag     68100
     tccaacacca attcccatcc gaagcatttt ctgcctttgt ccaccacctc aatgtccgcc     68160
     atgctgcctt ggaattcgct tcttgtttgt gagatggaag tcagccccaa tggtggtcct     68220
     ggcttctgtt gcaggatgac gaaaaaaagg ggctccaacc aaaaactcgg tcaaacgtga     68280
     agacaccaag ataggccata aaaagctgaa cactgtggcc agagagctgt ttgacctgtc     68340
     aaacttgcaa tcgaagctct gtgcttttgt caaagaatct ctctgtgcaa ggtggcatag     68400
     gcaacgacag gccgatgggg ttggccagca gtggtatgaa gcagctgtcc gcaaccaggc     68460
     gcgagtgtca catgactcta gagttgcatc tccatccatt gtgcatccga gccagcgtca     68520
     gacatcgcca gcctccaggc gacgccctgc atcagacaac actgaccggt caccacctca     68580
     cgggctcaca caagacccgc cggggcccgt ctcaaccagc tccgagctgg tgcaatcaat     68640
     caatcccgct gtcactgccg aaatgctgcg gaccaacggt gttccatggc acgtttcgcc     68700
     agctcgacca gctatcctga cgtctgtcac taatatctgg gcgggtgtcc aagacttgac     68760
     gctccagagt ctcagcttga gtgaagagct cgaaaaagat ccactgtgtg ttttgtttgg     68820
     ccgaggacga ggaacaagca aacgaatgcg tgatcctgtg ttgcgatcag tgccgagcgc     68880
     atgcccatcc atcctgcgtg gaagagtggt tggaaaagcg acgtacaagc tttggcacgt     68940
     catgctgtgt gtggtaagta tagatggttt caattccgta atgctgggat gctgatgaat     69000
     gctgtcgaaa cgaaggaact ctagacgcat tgattcgtcc actccgagtc ctcttggcag     69060
     ataccgaaac aaactctgtc cactcggcaa gcgaatcatc aaccgatagc gagcctgtca     69120
     gcgtcaggag tccagcacga aacgacccga gtcagagtca atcgcgtcgg gggtcagtgg     69180
     aatccctagg ggtatcaatc gagcagagtg ggccccgtcg ctcagccaga ctagcagggg     69240
     ctcgcctacc gcgagattct tctacctctg catcgctttg ccggtcggca cgactgaatt     69300
     ccaatcagcg taggtgatta caatctacag aaaacgcgcc acggaaatgg gaaattagcg     69360
     aagcagctgt caatcacacg cgactccata tcctggtgat atggagtttt ggagcaagct     69420
     tagcaaccaa ataaattaaa ttccgaactt caaaccccac ggcacactac gagatcattt     69480
     catatttgca agtgctagat gtcaatgtac cttataatgt tattcgaagt ctgcttcatt     69540
     tcaaatatgt tttagctcga aacagagtgc ccgtatatac tgtaaatcat cttacatacc     69600
     ataccctaga ccctagtcac tctctagaaa cataagcaaa acattaccga ccaagcggtc     69660
     attagccgga cattgactct aatatctatc caaggcatga atggctccct ttcacgatgt     69720
     cttatctttg actggactta gaggatcgaa gccagcatgc gaacgagagc cgacaagcac     69780
     cattatgatg ataagtcctg tcgagatgga caagggatat ggacctggct cttctagaat     69840
     tggtattgac aacagccctt ggctgttagg actatttcac aagaccttac tcattcaaac     69900
     tcaaagatta ttcctgagag cccatttggc tgctttgtca taatgaggat tccatgaagt     69960
     accctgcttc gcttaatcag ttgataccat caacacaatc agccagagat aaagataaat     70020
     tataaaacaa atcaagggga aaagccatct tatgcccacc aagccctagc tatttgggac     70080
     ccattctcat aaataatccc gttttgttga gaaagttgga cttcatcagg catagcatcg     70140
     atagcgttca caggaagtcg gtctccgtcc ccgggattgg gtctttgcct gatcgtacct     70200
     gacatatttc agagggtagt ccattgaaga ccttccgagg atgttgcatt cctaaactat     70260
     gcccttcctt ttcagaaacg acgcgtctgg gtgcccgtcg tctgtcaagg tgcgccgctt     70320
     gcctttggtt cgcttcaatc atttctgata gcaaaccatt ctgcttggcc aacaccaaag     70380
     tacactgctc atcagagata tttctcggcg tagaaaaagc agtaactcta ggtaatgtcc     70440
     tactgagtca tgcaatcgaa gaatgggaac ccggtgtcaa catacaatgc agagactccc     70500
     aaagccatgc ctatgatctt ttctaacagt tgtagccgtt gaatcaagat tcgcaactct     70560
     atgtcttcga acatatcaac gtcatcacca tccagttcgt gcagggagtg gttggaggag     70620
     tgactggtcc actctttgaa gccaatctga aatcttgcac aggcatcttg gccacccaaa     70680
     ttgtcatccg aataggatgc tggacttcaa gatcaagctt gcaaagaccg cccaggtcaa     70740
     atgttgatgc aaaattccct agtgcatttt caacgaaaaa caattgtcga caaagctctt     70800
     tcaaagcctc atttgtacgc ccagtagctt tcatgtcttc caaaagcgca agaacgctgc     70860
     gctgcgcagc ttttgcggcc tgcgcagtgg aggttccggt acctgatggt tcggccattg     70920
     tgagcgaaga actagagcaa gattagttga cgcctctcaa ccggaaaaat caagggtggg     70980
     ctcattctag tacaaaagga tagtgcctat tcttggtgta gattattgat ggcctgggaa     71040
     tgatgaggat aatgtttgaa ggaggattca aatatatata ctgtctggag taacatcact     71100
     tatctcaggg cttgttagat ggttcgggtt cctgggaacc tgggtgatta tgaccgaatg     71160
     attggcctaa acaacatagc ttgcacgcat ctggaattac tctgctgggc tcttaggggt     71220
     aaagcattaa agtcttactg gttattcgtg tccttttcgt aataatctgt tcagcgcaaa     71280
     agaaagatga ttgctcatat aagccttttg atgcatgcgc ttattggcga gagaagcggt     71340
     tctttgccgc catatcctaa cgatctttct ctagtactcc ctattccagg acgtatcgta     71400
     aatttcttag tggactcatc caatttccct agtaccggta gtcatccgag gcctgattag     71460
     caaagtattc ccaggagcaa ttatcataga atggtaatgc tgattgcggt aaaaagccct     71520
     caaagccgaa ccaagtatgg agtacatgag ctaacagaaa aaaacaaaag ctgctaaata     71580
     tagacgccaa gcctgcgaaa tataccgagc agatgcatac cacacgttac tgcacttgta     71640
     tagatggacg tctgaagatc taggccaaca tagaatacca ttgaacttac taactgcgct     71700
     attacagctc tcctaagtaa aataacctga aataactgtc cgagctcttc aattgatctt     71760
     gtatcgttct gttagtgcta gcagttgctg tattaaagct acggagttga ccgatgcatc     71820
     ggagtgggtc cggggattcg ggagatcgac aagacaacaa accaaaccac aaccttacgc     71880
     atgcggagta caggatccaa aaggatccat ttacggtcat attattcgtc ggctgtgaga     71940
     accttgtaac tactatcctg ctgcctagag cgtgacctaa aaattagaat cagaggcgcc     72000
     ccctgaacgc cccttttcgc ggttcaaacc ccggttgggt tcatcacaca ggtgacttcc     72060
     ttgacttact ccctctctcc tacctattac catactctga ctgatccatc gaagaacacg     72120
     atcaccattt caaaatgcat cgcctccgtg actccctgct gagcccttcg ccaaaaggct     72180
     tccccgtcat cggcgaggca gacaccgtct cccatagtca gcaggatgtg cggcaaagtc     72240
     tcgctcgggg tgaatttagg gaggttcggg gagcagcctt cttcagccga acatggatcg     72300
     tcaccgacag gtactgcaat gttaaggatg gggtggattc cctcgaaggc tacgttcgtg     72360
     agatatggta tatgtactac catctcagcc tacatacgtc gcatgaaact ccagaacacg     72420
     atagcctggt cctcgatatc ctacgaatcc agggaaaggg accgttaacc agacctgtga     72480
     aaggaaatta cggaatcgat atcgcacgac tgaccgaagg cacgctatgg aatgacctgc     72540
     cgttcttggt taccgacatg actgacttat ggatcaacaa ctgcggacca atgtcgggca     72600
     cccagcgcct gaactttgcc tctttcttgg caaagttagc gtcaacccgc gtctgcaagg     72660
     acagaatgtg ccaggtcgcc cttgtcctct tccgctgtgc atttgaggag agacaagagc     72720
     ttcgcaccag cgaggatcag gataatgaag atcctggccg gagcatggga tccctcgagc     72780
     ttatgcactt attgccatct gtccaggcat ggttcgtcga ggcaaggtac aattttttgc     72840
     aactctcaga ggtctcatgg aatgattgcc ccagcacgat tggccagggt ggcccctgtt     72900
     tcatcgagtc tgatttcggg aagcgttgtt caccgactgg gttcacacca tggagatgga     72960
     tgtactggct caagcgactc cacgagattc aggatgcggc aaaggacgct ggtgagaaac     73020
     gtctcaagca gtgcgccgtc gaggccattt ccagaatgct catggatgtg aaggaacgaa     73080
     actctgacat cttgagggtt ttcaaagatg ctggggatct catatacgaa gataaacatt     73140
     tggtatctct taaaaggatt gtggagggcg aaggcccctt tttcccggag aacgaagatg     73200
     gcgaggagag cgaaaagaca gaggggaagg aaaagctaga ggaaagcaaa atgccagagg     73260
     ggaacaaaaa ggacaactga gtctccctct ctcccgcttt atttctcggg tttcatagtc     73320
     ctcggacaca atttgctcgc ctctacccct attacttatg aaatccagcg ccaagtcccc     73380
     tcggggtttc atattaaaag caaaagaaca gacaattaca cttccataat tatccatcaa     73440
     agcacgcatg tttaggaaat tgcatttagc attggactgt gcctataatc aaagctattg     73500
     tacctatgat gaaaccttat cagcgataga tgtataacgg gtgtactaag gaattaaatt     73560
     gcgggatttt ggcaggtata aggaataacg aagtggctgt gtgaaacatt ttgagaaccc     73620
     cagttaatcc ttaccgcata acagggaatc ggcccccagc attacccaga ccctgatttg     73680
     gcagtccggc tcgcaaacaa gtttgacccc gcacagaagc aagagtagcg ctgctgcagc     73740
     agtttgatag ttatccctct agcctatttc tgcttacaat gtacatgtgt cgtatcatag     73800
     tactccattt cacttccgac tacgatcaaa agatgctgga tatattcgat aatctacaac     73860
     catttcgttg atgagcaaca atatctagct agatatcaaa cgagtgtctt tatgaaataa     73920
     gaaacaaaat tcgccgaaaa ttgaagctgg atagatactg ggtgtatatg tatcacccac     73980
     cgagcagtcc ttggttcgag tccttgtggg tgtagggtag taagcttcga gaatcacagg     74040
     gcatctcgca tatcaccaac aagaagggaa ccaaaaacca ttaaatgccc tggtgatcgc     74100
     agagaccatc tagtcacaat cgacagcgtt gttgtaggtg tcgacggtac atttgttatt     74160
     atccttggtg cactggaaaa aagagcgaga ttagcacgaa atcgattcag atggctactt     74220
     ccgaatgatt gatattctac cttcttgtta tcaaacttgg ggcacttgat aaaagtgtcc     74280
     tttccagcat cgttcttgta tttacattcg ttcttagatt tggtgcattt ctgagttgtg     74340
     gtcccgaacc gttagtcgcg attcccaagt gagtacttaa ggtatgggat attgatgttt     74400
     actcactccg gtgtatttgg ccaggacacc ggcctcagcc ctggcatcga ggtcgtttga     74460
     tacagactca atgggggtgg ctaccccgcc cattgcagcg aagagaaaaa gggcaactgt     74520
     ggtgatttgc attatgaagg gcttgagatg atgatcctct ggagaaggtt aaagtggttg     74580
     aagatatcga aatgctgtga tgggagtgat actatatgga attgagggtc atgaagccgc     74640
     ctttataaac cagatcatga gctctgtgtg aaaggtgaca catacaatgc tcaggtccaa     74700
     tgcagtcatc ttgggggtgg cagcttatgg attgcatgac ttctccaatg acattaatgc     74760
     ctcacatact tcaggatact ggacctcttg gctggtatat tcttacgggt ggggtctctc     74820
     caaaatccct tacctgcttc agcctccggg gtaagatgca ctacttgttt accaggaaga     74880
     tatttttggg cttacctagt ggtaatcatt tcctaaaaag cagagaaaac ggctgacacg     74940
     ttgacacggt gactgggcca ctcggatctg caaaggacga tggctgcatt gcatttgata     75000
     aagttgtttc actaggaaat gatctccaaa tccaaaatgt tggtatatga gaaggtttag     75060
     catatggcgg atgcttatag gtcgaaaagg caaaggcact atactatgta tgtatctatg     75120
     tgatactgtg atacagccaa gctgtaaggc agctcccggt tgtgttacgt agggctgggg     75180
     tggattcgag ccaaagcaaa ttaggaaatg attcgcgggt agtatttcag taacataagc     75240
     tcacatggtc taggcggtca aaagttgcat acttcaaggt gggatgggtg ggcttacagc     75300
     gggatgctag cccttgaaca ggggttgtcc tcagtggcag ccccgcttct ccttttgtgt     75360
     aacaaagtac atagtccgat catactgcca aggttcgctc ggccgaaaga gcagacagta     75420
     agcgctggaa gagtaaatcc aaatctttta agatatacag gctttcctac ggttgagctt     75480
     aaaacatgaa gtatgagggg agtggaaaag gtactttcag tcagagaaga gtattgttag     75540
     tggtaaagaa atttattagc tttcagatag agtagctaac tgatttaata tcgcactgat     75600
     gaatgaacac tacggtcatt ctcgaaatcg gcttgaccat tacggagtac acaccactga     75660
     acaacccttt tctggcccca tcgccaaggc cttagtgcag atcaattatt gagcaggacc     75720
     gcattaaatt ggggttgcag caaaatgtgc tttgcatgct accataaaat gctacgtaca     75780
     ttacgcactt cgtacgaaaa gctctctgaa ttccattgac ccaacgtttg atccttgcaa     75840
     ttacgactag gggagagatg taacatgcct tgtactggga gatccgccac atatcatccg     75900
     ctctctgttt caatcgcacg ataggcacgc ctttctttac tggacaattg cacccgttat     75960
     caagcagtgc tagatcttcc ttcacctctc ctagaccacg ctaccatttt caatcaggac     76020
     caaaaaagta caaaatacaa tttcttaaat actttccaca tgatctccga tgtagagctt     76080
     catatcacaa caaagcaaag cgggcttatt agtttcatat atagctattt ttacatgtat     76140
     cgatattatg cccaatttgt ctacacccgc cacacctatg ctgccgccct cctggaaagg     76200
     tagtaaaaaa gatggtcgca catttcaatc tcgtgttctc ttcgcaggcc tgctgactag     76260
     agaaaacctc tctcgcgctc tgaagcctgc tgattgggaa gtcctgagta ggtatgacgc     76320
     gcttcacgat aacacgtctc ttgacggagt gcctcagatc gggggtcagc gctgaaaggt     76380
     ctctgtaatt aaccgcccag aaccattgat accgcgtgat gttaagtttt cggcggcgtt     76440
     ttccattttc tgtaattttt gtgaggcccg gttattacgc aagtactatg atccgcagaa     76500
     cctgagcgtt tgggtgagca gccaacgtag agatgttcat ggtcaggtga atttcactga     76560
     tgccgggacc cactagaatt ccgtcgcagc atattgatga tgctagcact ttcttcatcg     76620
     tgggtcatag ctgccggtcc actaagctgt cgccgagtta tcgctaacaa gtgacgtagc     76680
     atcgccttta tagtggggac taatttaaaa aggacaatgc tgggtcaacg tggaaaaata     76740
     ttttgactac ggatatctcc gcggcatttt agcaatgtat gttcaagccg ttcctagaga     76800
     gcagagtttt tctctcgggt ttgttgctca atgctatgca taatttctac cagtttctgt     76860
     gcgtcgtctc gagtccgttc catcagctca ttctgttcgc tgatccattg cagtcgttcc     76920
     ttccagaaat cccaccgctc cttcgagaac gatgagtctc ctttccatag attcaaatcg     76980
     ggctttttgt ttgcttcagc aagggtgagg tccttctttc ctacgaactt gaaaataatg     77040
     gaccctgcaa tctcaaaaaa aggaaccata gcatgaacat cagtctatag gccgaagtca     77100
     gtatctcaag cacagtgatc atattctttt gcgacccaca ttcagcataa ggatgtaatt     77160
     cgtagccacg cggccatcta caaggttatg gcgctgtaag agcgacggcg agggcggcgg     77220
     aagtggcacc ggcccgtgtt tccacggctc ctgttctaat gcaaagacgg ggattcgcaa     77280
     tgctatgctt agttcgcgtg aaccagggcc atgcggtgga tatgcggaaa gataatgcgc     77340
     gcaaaaagcg ctgctactgt gaaaagtgta ccacccttca aaagggtaga taccgtatcg     77400
     catttcccag taacctgtaa tattctgatc gaaatattag cccctacatt aaatcaacat     77460
     aaacgaccct ctggaaggaa ccttgggcga aagccttgtg tccaaaatat tggagagaat     77520
     caaagaatgg gatggccatt ttgcatgata ttttagggga agaagaagtc acgcacggtc     77580
     atgagtctct tcccaaatgt ccttgaatac ggccaagttc ctccagtctt ccagccgatc     77640
     ctggaagcgt gacgtgcgaa cctgttcttc ggttctatca aggtctggaa gagctcttat     77700
     tgcctctacc agcctcaaaa cagcgggttg atagttcggc atctcaatag cagcatccca     77760
     aagtagccat gaaacgcgct cccctttatc cacagcttga ctctggcgct cttgaatcag     77820
     gtcatcttcg ttacgaagtg acatgaagcg atgagcagcg tcatctactg gaactgcatt     77880
     ggcagtgccg taacgctcaa caaattcctg caatatttga atctcatccc aggttggggg     77940
     atctgggtcg ccatcctctg ggtctggata gaagaaaggt ttccattcgg ctttgtgctc     78000
     ttccattgtt gtgatggaag ttgtggtgat ttgatccggg gtcgccccag tcggttctga     78060
     caacgaaggc gtactttcaa gtgaaagtgc ttaggaacag accgcttttt cggggcagta     78120
     tggtcataca agagacaagc aaaggaggct tcgctggtgg ccagacctct ggaatcctaa     78180
     gttgctccac aatggatgct ctcagcaccc atatagtgtc ttatgtatgt atcagcgaaa     78240
     aatgctggcc aagaagcgct atagccaaag tagttagggg tggattcgaa aagagatttg     78300
     aagagtatat tcgatttcga aatcattttg cgatgtcatt attcgcattc gaaatttcta     78360
     ttcgaaaagt tatacggaag tctgccaaga aattggttac gtaaatgatt ggttaacgcc     78420
     agcaaatcca cccgtgattt agcgtcgtct tgtcgcgcac gttgtgtata ccaaatcctc     78480
     cttacatatg gatctcgtaa tttgagactc gagcctgtgg atcttctcac tatcgttgat     78540
     agcagtattt attttccgcc tacaatagat aacacctcat cttaccttcc gaggtactct     78600
     gcaacgggta catggtaagg ccgctgaaat aacgtgacaa tggctgagtc agattatctt     78660
     tggtcttaca ccaatactcc cttctctcta taggcggtgt gtcttgtcct ttcgtacgat     78720
     gtatgaagtt agctggccag ttacagtatt tgcggataat gtttcattca gcatgactca     78780
     acaacagata atggaatcac ccttagaatt agttaaggca agcacaggtc aggacaagtc     78840
     tcccaggagc aagatatctc ctagaaataa gaaccgtggg tcctgattgc gagtttcaac     78900
     cttcaacact ctcttttggc cctgattcaa taccacctgc tattcttgaa acttggattg     78960
     tccttcaaaa gcccccagat gacatttgat ctattttcta cttcatttcc acatccggcg     79020
     gaaaaaggcc gtttccaaag acggcatttc ttcaagcaca agttgaaaat ccgtatcccg     79080
     catcaggatt tccaaattcc acagtacata gtctcccacc aactttttga tgtctcccat     79140
     gccctcagtc tcctcagaat caatcttctc aaaaacaaat ttgaatagaa ttacaatatc     79200
     cccagttcgt tcctcacaaa gggcgaagtt tgctagcagc cccagaaggc ggttgagtga     79260
     tagatagcat agcgcagtcc accccgttct gaaagcgaag cgatacattt cagcatggca     79320
     aagaaatata tctgcataat gtatttaggg tcggtgctcg attcgtcgtt ggctcggtaa     79380
     gtgggattca cctgaccaat ccttcgtgta ggtcggcaca aacaataggg aacttttctg     79440
     gatgaaaaaa gttccaggta agtctggcag gatcccatcg tctcacggat tccgtcaatg     79500
     attgtatgcc gatgccgtcg tagatcggag agggggcgga gtaatcacca gtatatacaa     79560
     actcgcagca acggccaaag actacctcgt caatgtcctc gactatagga ggtcgaagaa     79620
     tctcgcttgg aaggagctat ctaactcctt atgaattaag aatcgctttc ggtccttgcc     79680
     aacaacgaac aagacaatac cagattccat gaggctatgt gaacaccagt agtaagaacc     79740
     ggtacaatgt gagagatgag gactgttaat gtacctatga tactcaagaa ccattttggt     79800
     agaagaagac gaggagtccg tttcaccagc ctggggatga aaattgtatc tttgagggtc     79860
     gtcggaaggg agctgaagta gaaattgaag gatagaattg cttactaaat atagggggct     79920
     ttatttcttg agcgagcgct tctgaaggga gaggagagat gaaaccatcc attgtggcaa     79980
     gtggtgcatt tatattaaac ttaccaagtg ctagctagcc taggcgagga aagaaagtga     80040
     tacgatacgc atggacggct gcggtactga ggagtcaaga tggagatgga ctgcagcact     80100
     aagcctgaca tggattggtg ctataacatc ttgctcaacc ccctcagcag caagcaggta     80160
     gttcagttct ctccttgccg cagcacatcc tctgatgctt cagtacattt gaatcatttt     80220
     accaaaacca taaccaatga tgtcatctgg ataatcgaag tccacacact gaaataaaaa     80280
     tgagatccag ttctctcttc tccgcagaac atcgcagaac tgcgctagga ttcgaaatga     80340
     gcatatgtgg ctagatcttc ctcctgctgt tgctgctaca gctacttcgg tacatttgaa     80400
     accggtccta tgaaagctaa tcaggccacc tagttatttg aattcaagga tctaatatat     80460
     tctatgcata acaaactagt ataacgagtc attgcttaga acctgcgcgc catagaggtc     80520
     cggtcacagt tgagtgagaa tcattagcat ggcgctgaaa gtgcatgact tctgcaaatt     80580
     ttttatcgca tacattgcaa gcaataacag tgcttgatcc aaggttctgt agatgctttc     80640
     gcttgatatg cttcgaaaca tctccatgcg atgagaatag ttgcacacgc ttcttgaggg     80700
     ctaggttttg ctgtcccaca caaataaagc aaaacaaggg tcgattgtcc tttgtgacag     80760
     atcgaatagc attttcgagt gggcttgccg atttagtctg gacctcagtc gtttcgcttt     80820
     ccggcttctg atcatcgacg taaccgctct cggccacatg actttcaacc cttttgttct     80880
     gtggcaaacg acatgtgata ccttcctcaa attgacagta agcggcaaca gcatcaatag     80940
     cttcagtgcg tcgacaccga atgctggatg aggacgacca tgaataggag gacaaaatag     81000
     tgctagtagt tgttgtagtt cagaggtatg aattgtattt tattctagag ggaaagatga     81060
     ggttatatat acaacacgga cttacaatga acttggttgt ctgtatagac atttcggagc     81120
     taattccgat ggtgcggctt gcttcctgat ctgcactagc ctcatgtcac gacagtagta     81180
     tagaaatgta ttctgatcct ttgttttgat tgccgctatg gaccgcgagg ctaaacgtaa     81240
     gattcaaagt tgtatagtct acggtatcca gcaggggaat ctctggatcg tataggatat     81300
     cgtaccatca acaattgtag gaattaacaa ggtggttgtt tttatatgtg cttcaggggc     81360
     ggactttgat gactaatcag tcctgaggtc actacctgca aacagtgcaa aatagtgttt     81420
     gtttaacgtg tcatttcccc gcgctggaca ggatttccat ccagcgtcca gagctctgtt     81480
     ttgttgccca tgacagtgat ggacaaggca taccttccgc aatggggcca gttacccgtc     81540
     gagcagtatt tgattgtgag tgttttgcgc cactgttgtt tcccctgcgt ggctaatatc     81600
     tataaagaaa cactgggatc actcctcatc tgagcctact ggagaccagc gcctccgact     81660
     gatccgtcag ttcttagatc tagatgagat tccgaaggaa gtgcacccta attgtcatgc     81720
     ctcagacact tacgaagcac tgtcacattt ccctacggcc tatggaattg atactatcct     81780
     tcgcccctgg cgctctgatg acctacggaa gatagcgtgg aggatttggg ggtgtgataa     81840
     cgatcagttg attttattgc gcacctacta taatgccgat gacaacgaac aaatcacgga     81900
     attagtaggg tctgatgagc tccacgagga gaatgtagcc tggtgggcac ttcttgataa     81960
     tcccgaactc ttcaattttg gtgaccagtg gtggcgagtc ttcgatatct tgccagagtt     82020
     agccggccct ttaaatggtt atagccgcct gccgaaccca gaaagtatct cacgggaaag     82080
     acaggatttt aaggagagac taccgaccct caaacaaagc gacgaatgga cggcgaatcg     82140
     tgataattat attgaaagag agtttgcata ccttcgccga atagcttcag agggctatct     82200
     tgctattgca gatcaggaag cttttaaaac ggatatgcta cggttaatct attatgatgg     82260
     gaagaggaat attgtccaag agacccggac agaattcgat gagcagacat ttgctgatgt     82320
     tgccgttgaa tgggaccagt tgtcgcttcc tttagaatta tggcgtgacg gaaagactgg     82380
     tgagaagtat cgagtgaatg gggagctagg aagggagtta tatcagctag atgaggctga     82440
     tctggaataa gcatggccat gtcgaatctg gtggaatcgt ggcacatgat atcgttcgtt     82500
     tgctcgttgg cgtcatgtat ttaggcgccg cctcttcaac agagggactc ttcatcatct     82560
     ttatcgtcaa ttcaatcgtt tatcgtcgtt ccaactgctt aaacatgtga gcgttactag     82620
     cgccaatatg atagcaggtt ggaatcaacg tacagattct cccggacccc ggctaggatg     82680
     cgtattgacg ggtcataata catctggtaa atgcgtgcat aagaaccaac cgggtacacc     82740
     acaacacttt tgacagccct catgatgcag cttcctgtat gcccgaggtg cttcttgcgt     82800
     agtgagctct cattggcttg cctgcgcccc gatcttaccc tctcggtttg tacgtgagat     82860
     gaccaatgtc aaattgtagg ctaagaatga gaagactttg cgtctccttc cccttgcagg     82920
     tggacttgtg ctaacagcct gattgtctgc agaggtacgc tcatctgcca ggaagcaaga     82980
     caaaacatca gcattcctgc gcctttttcc acttctggaa agacatcaaa tgtcatccgc     83040
     agacaacgag gatcacgcat tcgataccag cagcctacgc cacttgaagg tatttgaaag     83100
     gttgcatgct tagccacagg tatgattcgg gtagtggtat aggctggtcg gagttcagga     83160
     gttgtatcat gtagacaaat cgaacaatga cctgataccc agaatcaata gggagaaaga     83220
     ggccgaggca tctggccggt catggagtcc tggtgaaggg ggtagaactg accagaggca     83280
     gctgcagtgg ccatcgcggc agcctgcgtc ggcgagatgg gtacgcgata cgaatcttct     83340
     ggtgactcat cgtcgatagt aatcatgtgg aagggacaga gagcatgcga cagtatttgt     83400
     ataggggagc tcgagcagac aagacatttg ttcgcgtggc attcgacttg agtgatagaa     83460
     atgagggtgt cctgttgtac gatccgagtc agcaaggatt gatctagttg gacgagttgt     83520
     cgtagcgtac ctgttcatgg aaatccccaa gtgcgctcga gacgggacaa tcagtttgcg     83580
     cagtgattat atcggcttca caactagatc acttacaact ttctgcaatg cagtcaccag     83640
     ccatgccacg tcgtattcaa gctcatcgca atctgcactc gcttcaaaaa agccgcgttg     83700
     gggtgcacaa gacaatttgt tgagacagta aacgcgcgtt acgaacccac ttgcgataaa     83760
     cattgcactt ccatggtgga tgaatgtgtc gcgatgccag aggtccaggg actccatagc     83820
     tgtgtgaagg tggtgggacg agggcggaag acgcgatgaa gcacgctcgt cggccgccac     83880
     cttggtctta tcttcgatct ggcggaatag gccactcgca cagtatattt caccgtcgat     83940
     gatggggtgg ccctacaata gcgtgaagat gtcagcggtg ttcgtggtta gaggaataat     84000
     gcttggcgcg gatggtcaga cacagcgcag ctgtaggcgt tagatctcac tcaccttagc     84060
     atggaaatgg gagtctcaag gttctatgca acgaagttcg cacatggatg gccgcaccct     84120
     gttgttgact cgctatcttg gtttgcgatc ttccacctag gacatgctgc attgttcgaa     84180
     gcgacggggc taggaatagt gtgtaagcca tggctttgcg tggagctctg gggagctccc     84240
     aaaggttcac tgtcaattat tagccagtag accagcgtgg aattccataa ctcacatttt     84300
     ctgatggtca agaccaggga tgaagagtgg cccttgctct ggtgcattgt gttcgaacgt     84360
     ctacggatct ggctgtcccg cgtctttcgg gtcagtgcag tttcaaggat ctgtgggccc     84420
     atatacctac agtgtgagca gttgcacttc aaatatgtgg tcaaccagag ccgcgacagt     84480
     agaccggctc gctatagcag agacctcttc atagacacct tgaccagcta atccaaatct     84540
     tgtatctccg atcggctggc gtaaatgggg cagtgaatct gcttggaacc acgtctctta     84600
     aagtacagga actgtctggt ttgctggtcc acggtgtata ctataaatgt cagtacggta     84660
     taaattccag tactcgatca aaggggagaa cttattgagt gcgtcagaca caagcctgct     84720
     cgactttgca gaatcaagtg gataaatagg agagcaattg caggggtaga ggacgtattt     84780
     ataggcttct cggcttctgt cactcaccga cctggttgga agtgttgaag gacacatttc     84840
     ctaattgagg cctgttgaaa cccgcgtctt cttttaccac aactatttgc agcgacattt     84900
     ttgatgcctt cagatgccca gcgagagacg agtaagagtg gtgctgagag aaaggggtgc     84960
     tgactcggtc aagcaatgtt ggctgactgt tgaatccttc acgttcctct taaattgagg     85020
     ctttgtggga gatatccaat ccgcaatgac aggcacgtat tcacatattt cttgtcctag     85080
     tcacctcata tgtttggcga ctcaacgttg gatcactgaa aactcctaca attccgtccc     85140
     tagggatcat ggaccttgtt tctggcctcg cttgagtgtt gtgttggttt gtgttgagct     85200
     gtgggtctgt ccgcctgcct agactgcaga aagcgaggtc acacacagta ggatgtgcgg     85260
     ttgctcaacc catcaacccg ttgaagcttg gccaaacgtt gtcaacactc aattttcgaa     85320
     gttgtgaaca accttcgaag atacatttct tttcttttct tttatttttc gtttctttcc     85380
     gaacatcttt tttggtcact ctaaggtcta taatgctgtt tgccgagttt ctgaggcttc     85440
     caacgggagt ggaagaggcg tctagttgag gtatctctca cgtcaatggg cgttcatatc     85500
     tggccctcaa catcgtcagg ctcgatcagt tttcccgacc aacccgttga cattcctttc     85560
     aaatttacta cccagcgccc gttgaaaata aaagcaaatt ctattcagaa gctgacttga     85620
     ctgcgttgat tgactatgtg gtgaccgtaa aacccagtcc atagccatct gtgtctgcat     85680
     agtctataag agataccaag gcttgtcgga aacagtacta tccagatcct tgactttttc     85740
     ctgtggacaa aatggactcc tcaaacagct cgccagacca ggaaaagcaa ggagaacagc     85800
     agcctaatga attgccgatc cttagtgaaa aggaccataa tcaagagcct tcagatcatg     85860
     tccctccatt ggtaagtgaa accattcggc ttcaaatgct ttggctgact atcgtagacc     85920
     tccccttcgc aacacgaaga agtgacaaga catgccttgg cgaccgagcc gtttcaacct     85980
     atcttgaagg tgctagcaga cctcgaacgt gacgatccca agttttcatt cccagcagcc     86040
     cgactcgttg gattctatcg acgcctatgg gagtcatgcg tttccaagca cattgatctc     86100
     caaaagattg agcagagcaa tgagatcttg aaggaggctg gtacgcacct gagaaaagag     86160
     agggacggac ttcagcttca ccacgacaag cagctagctc gactgcgctt ttttgagcat     86220
     gcaatggaat cgtctcggga acgactgatt aacctactcg atgactggaa ctacccctac     86280
     agtcccaatt tggccgggtt gacggacgtc gcaagagaag agtaaggaat tgcctatttc     86340
     gggttgccct gtcctatatt ggcaacatag aaatactaca agcggcgatg cagtgcaagg     86400
     gaaattacac cgcatgcaaa gcaggttata tattcccgag gcttttaaca agaagggcac     86460
     caaatagtca ttattcatta tcgtggtctt tactgaaatg agtatacgaa taatcccgct     86520
     tgattcagat caatctcact cgtaattact cgatatatta tgtacaaaaa accgtgggtt     86580
     cagggatagc gtcgggggaa gcctagtcaa cagagaatgt accgagagac tcgaatacgg     86640
     tagggattcc gtacgaggcc aaggggacag ccggaagata gtgcctgttg cacggacagc     86700
     atgccaggtg attgtgtcta gcaactgtct gcgaaaccga cgaagatttc ccagggcttt     86760
     ttcaacccgc ggcaggaaga acatatcctc tcctatagtc tcaccagaca cccgctcaaa     86820
     tcgcacaaac cgaaattcta tccagtgcac ctctttaggg aaaaggagcg ctgacatctg     86880
     gaggaaaatg tcgctagccc gggtagagtt ggtcagagga tctggacctg tccacctgaa     86940
     cccggacaga ctgtcgagat tgggatagaa aaggcattcg atcaaggaag gctcctgagt     87000
     tccgtattct gcagggtcgt ctttgccaaa agaatcctgc cacagatcat tgggatcagt     87060
     agcgagacag ggaggcggtg tcggtatgcc agaagattca tgccagatag cccgaaggtc     87120
     gagatccaaa tcgtagtctg taatgttagc gcaaactccc atcaaagaaa cgggtacaga     87180
     ccattctcgt tcaatccatt catttctgct atatgactgg ccgtcgaacg ctgtagggag     87240
     aatatagagg tgtgtaaagc agcgatttaa cgtgggttgg aagggatgga aagctggaga     87300
     cggagcagtt tttattcctc tctattacgc agaatgagga caaactaggg aatctataac     87360
     cacatgctaa gttatcgaat gcgttgaatg tatcaacagc gtgcaccgtt ggccccgttc     87420
     accaacccaa cgaaagttca ctagcagtat aggccttatc tatccttagg gacaacgcaa     87480
     atagatagca gaaaatccca taccattctc cctggctcgt aaacgctcta ccacatggtg     87540
     tctctatcaa ggcccaggct catcgacgga ctaggcttga aaatcgctcg cttccaaagc     87600
     tgaaacaaca ccattacaaa gagcctgaac cgctcgcttg cgctcccaca atactgaagc     87660
     ttgttcattg cagagctgta gaaggatatc gctatcgctt gctagcaagt catttgacgt     87720
     ttgaagctgt ctctgctcct cctcgagtcg tattttctgg gccgatttga cgacgtagca     87780
     ttcccatagg caaactacaa gtcgagcaat ttgagggctg gtgtagcgag ggagtcattg     87840
     aggtttacta cttttatgaa ctccgccgta agggtacctc gtgttcttac tggaagctat     87900
     tcagtattag tggttttttt taatttcccg cccagggggg tatgactgac cttggcttcg     87960
     atccaagcct ggcgttgaag gcgaacatct aggtctacca gtctttccat cggtcaaagt     88020
     ggtatggtat ttggcgggac tggcctttag ccgagctagg tatgacttgg cttcgcgctt     88080
     cgttgacgca gaattcaaaa ggcttagaaa gaattcctaa attaaacaag cggttagcct     88140
     atgacacaga aagaaaaaaa ttcatgtgcc acttacccga tcgagcaggt tcttctttgc     88200
     gcggtggccg agacgatctc ggttttcgct gctgcccgag aactcggcga tttgctgggt     88260
     tcggacattc agcgccgggc gcgccgcaat tgggtcacta ggacgaacta gatgttgctt     88320
     caaattctta gtcagtaaat actcagcatt agtggggtat atccggttta tttaccttca     88380
     ccaacgagga tttggccgtt cgagaccagt tcagcgttcg agagctcatg attaagcgta     88440
     tattttgcga ccaatactag tgcacatgag ctcgaagcag agtagttttg acgtagagat     88500
     caaactcgca tactcggtac cttgtcatcc aaggagcctt gaggcaaagg agtgttgcac     88560
     aagatacgca gaaatttgaa tgatcagtga gttccttcaa cgaggctcat ctcgaaaaac     88620
     cataaaccta ttggaaacta gagagattac gatgttctaa agacgtaggg tcgaggatct     88680
     ataaatattc cacatagagt gatcatcatg acctcagtct attcgcttgg aatacgcttt     88740
     ataggagtga agattgtact gcaaggtccc acaaagctcc tgtccttgga gtgttccgca     88800
     tcgccgtggt caaggatgga cctgacgtca aactcttcag aaaccccggg gccttgacga     88860
     aattggccct gtggatcgcc gaggccattc gagtccaaga gaaagagcgt ggtgactcag     88920
     tcaagctcgg tcagaaggga gcagcaggaa ctcctctcgt ccttgctggc ctcgatgaag     88980
     accgccatct ctatgtagtc gtcggcactg gtggcggcgg cggcgtcgtt gacttcgctg     89040
     ccatcgccaa gcgccaggag gagcgcaaga agaagaaaga cgtcaaggag aagaaacaga     89100
     aagagcgatc agagcgccgg tcccagcgag cagcagagcg tgccgaacgg gaagaagaga     89160
     ttggtgcgaa gacgaagaat cagaagagtc cgagtcctca tcagaatcgg agtccgagga     89220
     cgaggaagat ccgcgtggaa gcatcttctc cgcaaccgat ttggtattgc cttccaggag     89280
     gtagtccagg agacgaatgc gcgtgtgcgc atcgacagtt tcgagcattg tgttgtcaag     89340
     gtccagaagg atgacctcgg cgggttcctc gaagcattga gtttccgcag tgtggtgggc     89400
     taaatcctct acaaacacaa tcacgcagtc tacgacttgt ctttgtttac ttcgcatggg     89460
     atgtaaatga tatataggat gggatactgg actctgaaac cggctacatg cataatgtcc     89520
     gttgcatgtt ctacgcttgc aagcattcaa atgcccttca ttcttgcatc tgtctccaat     89580
     ggggtttatg gcgttgttga aaacatgtct gattctatcc agtccatagt tgcatcgaat     89640
     ctatgcattt tcggcctttc cgagagcccg catatccact tgttaacctt catgacttcg     89700
     tctgctttta gatagaaccc agactaatag gaaaaacaat ccaattcctc gccatatcgc     89760
     ggcacgatta cccggtcctc cgcgagaacg tcctcaccaa ccccccaccc gcaaagtatc     89820
     acaaggcgca agatcaagcc aaccggccag gggagatatt ttaataatac atgtataaca     89880
     ccatttaatt ttgacacatg cgattctcac atgttctctc cccccattga aagttgacac     89940
     taatcccagt cctcaatcca cgcacattgt gccaccaccc aataggtata tagagacacc     90000
     cgccttcatg aagaacaatc tccacataat ccgcgtccat gaacccaggc tgcatttcct     90060
     cccattgctc atactcagca ggagaagact caatagcagc cagatccacc ttggaagtat     90120
     cggacttgtc aaccagtcta cgagtcgttg gctgaactcc agatacagga tctggatctg     90180
     ccgtctcatc gatagacgtg acccattcct gttttcgagg gtgaatctga gattcaggcg     90240
     tgcgtggcga gtacagccgg atatactcaa tccatgtaca gatgacttcg gaggcaaaat     90300
     aaagtaaatt catatcctca acgccatacc acttcacgct caagtattca ttgaacatcc     90360
     attacggaaa ggcattaaaa tgctgctacc aaagcagcac ctgcaacacc gacaaacatc     90420
     cctcctgaca tataagtcgg catagaagcc aatcccgttg atgttgacgt cgacgccgtc     90480
     ggtgtcggtt tcgtatacgg cacaatagac gtcgggaaat cccccacagc atccggaatc     90540
     tccggaccat ctccaatctc cacaatatcg tccggccccg gattcccatt caaagcagcc     90600
     accccaacaa aagcattatt gtaattgatg gccatataca tatggtccga gaaactggtg     90660
     ccaattgtac ctgcgaaggt atcgtcctcc tcgtcttctg gttgtatgag gaagacacag     90720
     cgttccccgt attgggaatc ccatggacgg aacagatcgc tccagggtgc ggagatcgtg     90780
     gcgtctccga aaattagaga aacggtgtgg ttttccgttt tgcgtgagca ggggagtaat     90840
     ccgaactggg ggtcttctcc ttcccatccg acgaaggaga tgttgtagtc tttgtacatt     90900
     tgtagtacta tatccttggg gagggtcgtt gtgatgtatt gggtgctcag cttgtacggc     90960
     ttcggactcg atatggtgta atttgttggg acgttcgagt ctgtttgtac ttggaatcga     91020
     gagagaggga gtaacacgag tccggtggtt atgttaaagc cgaatgcctg taatgggccg     91080
     tgatacttgg ctttgttgat accaccgaaa agtatacctg cgcctccgct ttcggatatg     91140
     ttgccccata tgctgaatga gggggatcgg attagatcct gattgatgag atgataaggg     91200
     aatgatgtgt tttccggaga tagacctatc gagttccctg gattgtatta gttttaagtc     91260
     tgaagtcata gaacgaaggt atatactaac agctttcata agtgaccttt ataagggata     91320
     atccgacatc cttcacttgg gtccctccta tagtgataat gtcggtgcgt atggtgtctg     91380
     gagaagatga ccacttatgt ttacttggga tttctttcgt gctgttgctg gatgattcgc     91440
     tgatattgta tgatccaaat gaggtgcaaa ggctattctc ccggcatttt gagttttcgt     91500
     agtttgtgtc ctcggtaatg acataaaact cgggagccag gaggtctacc aacatgccta     91560
     tgggctgcgg tggtgtacca attgagacat tgatgaaata tgctgtctgt atagatatat     91620
     taaaattcaa tcctaagcaa ggatactcca ggacgtacct cgttcaacac attggtcgcc     91680
     agagtggcag tgtctctttt ctgtagcggc ttaggtattt tagagccata gagatccatg     91740
     ccgatgacag caggtacgtc gcgcacagga aatgtgtggg cactggcact ggcccagttg     91800
     gaccatacca atagagctgt aatgagtgac tggcgcattg tagagtgcta aatgttgata     91860
     ccaatatttc aatattgttt cttatactcc gtacagaaaa ggacataata aagggcagag     91920
     tcagcagaca ataaaccgcc ccaactccaa ggcgttactt ggcaaggcgt ttcttagctt     91980
     gaaaagtact atgtatggag tactttataa gacattattg ccttggcatt tgttaacacc     92040
     aattgcgagt tgtgctttag ccccggtggc ggaaacagtt ccccgtgagt ggacatgcca     92100
     aggcagatgg aaattacagg gctagccctg gcccccaggg agttgatata acatgactaa     92160
     tattttaaaa gggggctgta caaaaacaca tgctaaatct tgtgtattga ctagataaaa     92220
     catcttctca aaggccttga aagaagaata tatactcttt atacaggtct ttattgcgta     92280
     ctccactgag ccctcggtta ttgtatcctg tcactataaa taggcggaga agtacttaat     92340
     aatgatgaaa ggtccaccat tgccctagct ggcccttgca catgaatcct gaatgttgtc     92400
     ggcgtgggcc gtattgtaat gtagggtcca atcaatggtg ttcaactctc tgtattgctg     92460
     tatcgacttt cctagcaatt tatatgggcc gtcgattact aatctaaaat tacaaaacgc     92520
     ataggatcaa tggatcctcc ggtatgccgg tatgccaatg catctactcc gacagattag     92580
     cagtatgtct ccttaaaaac caaagctgta ccctgcgaaa aaaaatgaat aaaagttcat     92640
     gccaaggctc atagtcattc tgatatcatc acaccaacca ttcaagcctc gacttgcaaa     92700
     gttccttagt tccaaaggct tttcgccgat tgaagtgggt caatttggtc acaagccacc     92760
     ctgagtctaa agaactgcat cgacaaggtg attattggct gaccgcgaaa ttaagtgtgt     92820
     ggactgacgc gggggcctgt taccccacgg agaaccaaac aactgagcct cagtctgtaa     92880
     atccccccta agcagcatta aaagctctga gtaacatttc cctaagggag aatcattggc     92940
     tactgcttca tagcgatcat tcccgtcctt atatgtatag tcattgttac ttcgaagcta     93000
     aaagctcccc gacgagttcg ctgcgaatcc tcccgctcag atttgattaa caggagccct     93060
     agtactccgg cctcctatcg aagaagccga agaaagacac tatcgagaac agatttggat     93120
     gaaataccca tttacagaac tggggacttc cccggcagca gaaaacgtgg cggtactcct     93180
     gacgtggaaa gaggcatcac ctgccagcag actagcagct ctccagacct cgctgatcaa     93240
     aatctcacat tatcgagact ggatagctcg gtaagtggat ccaagattaa gaatgagggc     93300
     gccaattccg gctacacccc tttaccggct aagcctttac tacaccacaa cactggatga     93360
     cggtaaggcc acttccggcc ttctcctcgc catgccaaag actaccctgg atgcaatttt     93420
     ggcctcatga ttaactatga cagggctaat attgtatctg ggtaaattta atgctcgcca     93480
     tttgaaaatt aactaagaat acgatgccaa aattccaggt cccttgctat ttcgacccgt     93540
     tgtcatagct ctttcaaaaa ttcagacgcg agggagaccc acacgttcct gggatcatat     93600
     ccgaccccag ggtccacaac atggttccca ggcacgctct ttcttggtcg ctccaaggga     93660
     tcagactcgt atttcccaga ggacctaagt tacagccatt gccccactca agaacgcatt     93720
     agcctttatt ttcggtatcc tctttcttag aacaaaggga agatagagag ggaggggaca     93780
     agtcaaggta gggattaacc ttttgtgagg tcacctgtgc gtcaaccttg gcggtggtct     93840
     gttttggtct aaatgctctc cgaaagatgc caaaacaggg atatttcagg cttggcattc     93900
     cactgatgta taagtttcat ggtagttccc aatgaaagtc ccggtatacg gcaatccact     93960
     agcaacatgt acaacgggga gcagtacccg cggacgtatc gggtcttttc cacgaaattg     94020
     aattgatcgt catgctactc ggtaggttat ccaggccctc tgcgcccgcc agggaaggtg     94080
     agcgcggaga caatatagat tagatacgtg tggagcaaga caaaccgacc ccgatgctat     94140
     tcaaacctct ctagagactc aaggtgtggt tccgttgctc tcggcgaatt ccagacgatg     94200
     tgtcgagcca gaggacgcta ctgcagacag gatccggcca agtgctgtgc tcccggagtc     94260
     cttcgatggg gtaacgagtc agccaaggac tggtttcctt ggaataccca gagagaacac     94320
     ttcccgccgt ggcagccgcg tcgtggatgc cgccaatgtc cggagttgtc cctccatttt     94380
     atgcggacaa atcaataaaa tgctagaaaa gtcacgtgtg cattttttaa aagaccggta     94440
     atcaatgtaa tttcttgaca caccactcca tgtcatcgtg tccttttcgg gaagtatcca     94500
     ccgaagcgta tctgccccag caagagctgg tttggtgagc catccaaata gggctcgact     94560
     gcaactggca tcttatttgc accctgcaaa cattgaaaag cgccggcacc tatctgatca     94620
     acaaaacctc gaaccacatt cacggcctac ttaatcatga cctttgccgg gatcttcaga     94680
     ggtttctcct ctaatggcat ttattctcgt tcttatatgt gttttatctg gaagctaccg     94740
     acattttttg gctacagcag acatcgtgac agtatgtaat tgagcctcgt ttacttgact     94800
     atagctgcta aagatgcttc cagatacacc tccctagtcc gcccggtggc aatatgcccc     94860
     agctcctttc tattcacgtc atgtctatct gtcgaggaag caagaacgat atcaccggct     94920
     gttcttttct cagagttcct gttcatttcc tcccgatccc ggtttcggcg aatatgcaag     94980
     gcgttccatc ggtcaaacat gagatcgcct ggcctgaata tgttatggat cggttagcta     95040
     cattagctca aacgagccga ctaatgtcaa ttttttacct cattgcgacc ggtgcctcgg     95100
     ggctatctag tagttactgg ataagctctt ttcggcgagg aaatttgagc tggcatgtac     95160
     acacggctcc ggcgcagact cttgccagtc atcctgacat gcctccatca ttggtggaat     95220
     ttttaagcct tgtagtaagt caaaggcctt gttgctataa gggaagccac tctgaccttc     95280
     gtttcattgc agatgagtac gttctgtatg tgctttgcgt cgactattgc atcgatcatt     95340
     tcggaggaat ttgtatatct gatcaacact gatggcaatc cttacggggt ttgggctagc     95400
     catggcaatt ctttcttaaa gttgtcttgg gcagccacga ctctccaatt tttggtagtt     95460
     gttgaatcgt tcatcttaat cctcaaacgc agaattggtt gttttctgtg cgataagact     95520
     agttcttcac tagtggataa atgtggcaac tgatcgccct cgatttacct ctagcgattt     95580
     gatgacgggc cgcggtatac agtccacaat agccatatgt tctcaataag ctgacttctt     95640
     attaagctcc caagtgcgcg gtgtatatta ctgtttgcta atggatggcc tataatttcc     95700
     atgggcttat ctcttctaca aagttgaatc cttggcctcc ttttcggttt tgccgtggag     95760
     tttgggatgt taatcatcag ccctgcgttg ctgatcatga gcggtcacat agttcgtctc     95820
     gttctcctct actcccatac tctctcgcgg gttatgtgaa atttctccag gctgggaata     95880
     ttgaagggtt gtcttggcgt caacaagtgg cccaaggagg cgtcaatacc aatgctcttt     95940
     agcgcagtca tatttgagtc ttccatgtcc aatctgaatg gaccaaaaca actttcacgc     96000
     tctgatatac ggcatcatgt gttatcttga catacgttgc ctcagaaata ccccaatcta     96060
     atactatgaa cggttctaag ctttcggtat gatagaacca acagttgaat agagatttcg     96120
     attggagtcc ttatgttctg aactgttcac tccctggtga ctacgctgac tggataatcg     96180
     aggactatgg tttcctgttt gatgctttcc catcatatac cctagtacag aatgttttgc     96240
     gcggcatctg tgaagagcag caagtcatta tggaatggcc acccggacaa gtctgcttcg     96300
     tgttccattt tcacaacttt gcctaggctg agaacaatga gcttgtactt ttactaacta     96360
     tagaagagga agaatggata aggtctatac tggcttgggt tataacaatg gaagaagttg     96420
     gttgatgcca ttccaatgtt atccggaatg ctattctggt cacgcggggc ctacatccaa     96480
     cggaatgcct tttcgggtcc cccttcccga gcagcctcct taagaatccg gcggcagttt     96540
     aattgcaaag tatctactgt cattacccga cacttgcaat aacagtttgc agtcgcgtgt     96600
     acttcaatgt aagtctcgtt tctagcaatg gacgcaataa gtgccatagc ccggtcatac     96660
     gtagtatggc gggtggcctc tatataacac ccgcacctag taaaccgagg gaagtcatcc     96720
     tgctcggaag tcctacataa cggaccagaa ggcccatgta aggtaaaagg cgagcagcat     96780
     tttctgtggc catttaatgc aatacagaga gagcttgcga ttatcttcaa cgtagccgga     96840
     ggtcgctggt tagatacatc cgacattggc tcctccgttc gggcttcata ttctcctcgg     96900
     ctgcttcccc aatctcgcgc gacggctatt tagtcttcca ccatgcacgt cgcgacgttg     96960
     acccattaga gagataaaga tcagccaaaa ttgactgaat gaagaacccc taccggaaag     97020
     gataatcttt acccggatac ccaaacctac atagctatac gcggaaagga tcttgaatta     97080
     tgttgaatgt aactttaggt agacatagca agccgctgta tgttgttcac cgctgcttgg     97140
     cgacttccta gcccccaccc ctcggggacc agctccatac ttgtgcactt ggcatagaac     97200
     gctcccttgt gagctcgcgc tttactctct cctccttcta tgctttgaaa gaacccagcg     97260
     ggcaaggggt gggtgagcga tcagggatgt ctcttcctat ttggcctttc cactgatcgt     97320
     gcagtttctc ctgcttatcc caatgctcag ggatcctttg ctctgcgtgg ctgggtgagt     97380
     ttaaccagat ctccctgcgt caacaagaca cctcgcagga taggtccgcg tgaacaaata     97440
     tcctcgcagg caagagctgt gcaaccaagg acttcagagc ttccgtgact acgactgtcg     97500
     ctgccacgag cccagtgacg taagacctgc gctccctcac agccaatgag gccctgtgca     97560
     tgtaaaaacg cgctcatcca tgcaagactt ggctcgtcaa ggacttgtta tggctctcca     97620
     gcaacgtgca gtcacctatc cgtggtgctg ggggccagta ttcgagtact caaaagtatt     97680
     cgaaggaaag acctgtgcga catctccgtc atctggttca tatttcgaat tattgccatt     97740
     ggatacataa agtgagccct agatagatat tcacaaatgt catcacccaa agtaagatcc     97800
     aaactggact ttcttcgtta gcaactgccg tattctcagc ctctgccttg atattctgct     97860
     acctggtaaa gtccctttgc cccggcgtta tacggtacct gccagcaaat tttagagcaa     97920
     atttatacta agtattgatg tgtgtcaatg tcagtgttgt gatgagggtt gtggtgaatg     97980
     ttcgggcaat gaaggaggtg ctcaacgtct atcccacggg gactgatann nnnnnnnnnn     98040
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     98100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnag tccccctatc ccaccctcag attatgtaag     98160
     tttcctgaat agggggttca acttgaactt ctagaaattt atcgagcgat atccttccac     98220
     agctctggaa ggtacaggca tcaatattgt gggaccacaa aagagcagtt caagctcttt     98280
     gtaatggtgt tggttcaacc ttggaagcga gcgatcttcg agcccactct gtcgatgagc     98340
     ttgaaccttg ataaagtctc catgcggtag agcgttcatg ggcaggaaga atgacattta     98400
     atttccgcta tctattgcct tatctcctaa agattagcga tggccttgga ggcgcataca     98460
     accaatggtg aattttagtt gggtttggtg acgggggtca acagtgcacg gctgttgata     98520
     catccaacgc attcgataat ttagcatctg gctataaatc ccgcctggtt gacctgattt     98580
     tgtgtaataa aacgggaata aaatcactgc tcagccgcca gctttccatc cctcccaacc     98640
     cacgttaaat cgctgcttta cacacttcca cattctccct acagcgttcg acggccagtc     98700
     atatagcaga aatgaacgaa ctgaacaaca atggtctgta cccgttgcct acgcgggcat     98760
     gtactgcgga agaggaagat aaaaagccta gtttatactt tctaaaactt atataattat     98820
     actctcccta catgatgaca gatatcagct caacaataat atcttctcca gctgattaca     98880
     tgcaaaccac gcgttgaccc tagaccctta tacatttact ttttcatcat gtcctgcaaa     98940
     cctgctgatc tacaatgggt attgggccaa gtattgggtg aacccttgca ccgtgagcgg     99000
     tgcatatggg taggagatga cgggaatcat tgtcaaaaca ctgtgccgct tgactccagg     99060
     ataattggag tattgtgctt tgcgctgctc caggcccctc cgttcgcgta tcaactagcg     99120
     cagtaatttt cgttgactgc aaagcagtta ctttgctttg agtgcagacg ccatcgctgt     99180
     cggcggaaat tgtgggccac ccggattttg cagttgttgg atggtcgcca agatcaatcc     99240
     aaagatgtct cgatgcactc aaaaccattc acggttacca ggttacagca tacgcctctt     99300
     accatagcaa actctacgtg taatgacact tgaaatgctt gtgataccca ttgcgaagcc     99360
     agttttatca aagttgtaga tatccgcata tagaatacca tattactcaa taacttgctg     99420
     gacggcggcg acccattgct gaattacaac tggatctcca cattgcgcct ttgtagtctg     99480
     attgacgcga gaaattatta gggagctcgg aatagcgctt tacatagttc ttcgcccaat     99540
     acttgccggc catttgatag ggtgttcacc gcgcgcgcta cgcgagtata ttaatcggcc     99600
     gtttctcgcg caagagtggt tggcaccaat ttcacgatga tccatagaag ttaataatct     99660
     ttatagcaaa tcttttcact gatggtgtta attcatgatt tgcgcgtgca gcaagacgat     99720
     tgatgggttt gtcctggaag ccggcgctgg agggtagttt cggaccacca aatcgttctg     99780
     cccttcctcg aatggcggga atttcggggg ctgttgttta tcattacatt attattttta     99840
     atattattat ttgcatgctt gcatagcacg tgggatcccc tcttgacccg gccaacgagg     99900
     tctccaaatg gtgcgttctg gtggtagatg aattgtagtg aaaatgtgtg gaggaacacg     99960
     tggtcgcgga tgggcgaccc actcagttgt ctgatccact ccctgtccat tacgttacac    100020
     cttcagttga ctctcggcag gcgggcgctg gcgactattc agggtttatc gggtgacacg    100080
     tctcttttgc atcatctcca gtcacatcag tccatgttct gatccacagc ctggtagttc    100140
     aagatgatgt cacccctcag aatacccaat atatctcgaa atgggcgtga tcagtgcagg    100200
     aggcgggtca aatgtgatga gcaggatctc ccgtgctcaa attgcatgtc gcccgaatta    100260
     gattgcactt acttgaaggg tatggcatgc aatgctgctt cttcacgccc tcaaagccat    100320
     gcagttccca tttcctgctc gaagtctggc tcctctccat ggcagggtgg tgtcaactcg    100380
     ccagagtcaa aacattcccg ttctaggcaa gtgaatgaca tggaattgat ccacaaatac    100440
     tctacggaga cataccgaag cctttccgcc aatgattcgg agaattctat ttggcaaatc    100500
     actgttccat ctctcgcact tcaacataaa tatttaatga atggcatcct ggccctggct    100560
     tcaatgcata tagccacgtc ttcagagacc tgcgaagctt cggtttatct taacacgggc    100620
     ctcaagtact acgaccagag tttagcacta tttcgggacg aactcaatga cataacgcca    100680
     caaaattgca acgccatttt cgcaaattct atcgtcacgg tcgccgtcac cgttgcttcg    100740
     tcactactga tggacacgaa tggagaacac tcaagcaaaa cagataatgc agtgatcctc    100800
     gttgggttgt tgcagggtgt gaaaatggtt cttcaaactg gtcggccatg gatcaatcta    100860
     gagctctttc ctcatgacga atgctgggat aatgccgtcg ctgagctaga cgtcgacaca    100920
     tctacagcac ttgcacattt agccacatta aatgatgaga tcatgattgg tatttttgct    100980
     gagcaacatc gcaccaacaa gaaactcatc tcccatctcc ggcattgtta tgccgaattc    101040
     gcacgctctg ctggacttgg cccagtcctg gcatggcttg ctgcagtgga agaagatttc    101100
     gtgaaaagcc tgagatgtcg agagcctttt tcgctactca ttctcatgta ctggggcgtg    101160
     cttttaggcg agttagacga gcaacgatgg tgggctcgcg attcgggaag agccttggta    101220
     tctgagttac tggaagcctt gtcatctgat gatccaagcc tggagcatgc attcgcttgg    101280
     atccggcgca agatgtcgct ttaaggagta tcaatatttg gggcttatat tgatggttaa    101340
     ttttttgggt caggaacaca ttacagcatc gtctctgcaa gttgaatggg ccactccgca    101400
     tgtggattgc agtgggagaa ttttcgaaga gaaaggtgtg aagacccatt gcagagaaca    101460
     atccctcata agaacgcgta gccatgtaca gtaatctgca ttagcaggag atgatcgagc    101520
     gtcgaaagtt gaatcaactt ttcattggtt cactgaatat gcgattgttc tcaggccaga    101580
     gggataatgg tggatattcc agcaggctca gcatgacttt tcttagtcta tgtacagctc    101640
     ttcagtacga agtctggact aatattctat gaccaaaacg gaccattcca ccatgccttc    101700
     cccaattgac cggtcagcaa agagacagtg ccgaagatct cttggtccat aaataccgac    101760
     gcgatgttgc aaacccacca gaaaatttgc agatggcacg cacagtcatc gaactcgagg    101820
     tctgccagac cctcttctag agaacgaaag cagaatatat gatgcttgat ggattctagt    101880
     gctcataccc gatgcgctca cggcaaagtc tccgaaaccc ccatactaca ttgtataccc    101940
     tcgctaaatt ggccctcgag cttctcgatt ggtaatcctt gtctatggga atgctacatc    102000
     ctcaaagctg ccaagagacg aggcgaggat gagcaccgac agctttaaaa gttatataag    102060
     cggctagcaa gcgacagcga catccttctg cagccctgtg gtggtttgat aattaggtac    102120
     tggtattttg ggatcaagag cgagcagttc aggccgtttg tgacggtgtg gtttcagctt    102180
     ttcaagcgag cgatattcaa gcctacccat tgatggacct tgctgaggtc tcggctttgt    102240
     tggacgtccg tgttagagcg atatttgatc aagtccgcta tcgcgttctc tcccaaatat    102300
     catcactgat tagaggccca tgcaaccgcc ggtgaagttt gttcgatctg gtgatgggat    102360
     gtcaacggtt cacggatttt gatacatgta cacccaacct ttgattttag aggacttagc    102420
     agccggctat aatctttcct tatttgtcct ggtctttcga ggatgaataa aacccctact    102480
     cgatggcgcg aatataaagg agcaagactc ccaggagcac acagccctac aggtggccgc    102540
     gagatgtggc caggaaacag ccatagctga ctttctgaac ggggaagcca acgcgcatgc    102600
     cctaggccac tcaccacagt atatttcacc gtcgatgatg gggtgcccct acaagcgtga    102660
     ggacataaag atgtattgtg atatgagaca gggtgcagat caaaaccaag ccggactatc    102720
     ggacccaagt tatctatacg aagaatcaag ttgattgtgt tgcgatatgg ggctggtgca    102780
     gatcaagaac caagccgcgc cgtcggaatt aatcccgagt tatctatacg aagaatcaag    102840
     ttgatttcca atcaacttga ccttctcgtt gtatatatag cctcatgttt ccctctataa    102900
     tgatacctcc ataatgaaac aatcaattca tacctctgaa ctacaacaat attcaatccg    102960
     caatgacagg cccatagttc ttgttctgat tgctcctctc actttttaca acccctcgat    103020
     atcggctgtt ttgcggtgtt aaagcattcg tacggccagc tggttgaatt gaaaatgcgg    103080
     gttgggatga attatgttga tgaacttgat ttcctcgaag cgtaaccctc gcacgaattg    103140
     agccttataa atcggagtct atcaaaaata gctaaatagc ctcggacgac ctggtttagt    103200
     ccctttttca caggagatag tgatttcaaa gcttgatttt cagcctcgaa ccctaaaacc    103260
     ccctccgagc cggggtagcc attgggaccc aaaaacgcct tcgaactata tccagctaca    103320
     aaagcaagat tcgccaacta aggaattgct tcgtacgaga tcaagaagcc cccgagcccg    103380
     ttgagtagcg cgataaacca ggttttaaag acctgccaaa tcactatgca atctacggct    103440
     ttgcttgaga aagaagtgag cgagttgcgc gccgcttgcg agaagcagaa gcaaaagcgt    103500
     acttgatccc agaggcagat acctgccgaa gagggcctct cagttcaaga agcatctgca    103560
     ttgattatgc acccagagga agcaattgaa gcacctctct ccggtcccgg catttacgga    103620
     gaatcgggtt tacagccgcg tacaaaaccc ctcaagggcg tggaatctgt aggaagccag    103680
     gaaatagaag agagacgtgt ccaaatatat aacgagttta cttcgttcaa tttaacgccg    103740
     ttgtggttga gataaatgca tttcaatggg ctggtggggt tcgcagctcg gccgggaaat    103800
     acgttattag ggtcggattg caagatgaaa caaatcttgc cccccagtca attttcgtag    103860
     ccaaaaatgc ctttttgatc ctatcggttt tgtgcaagga gtgccattgg ctgtgatgtg    103920
     tgaaggtcaa gcgatgaaac tacgactggg gtattgctat gtcacctttg ccgattttca    103980
     tttgaccttg gggattgatt gtcttcttgt ggcaaataat cttcggattt agaggcttac    104040
     atcaatttat cgtaggctag taggctgagc tagatctctt caagtcccat tgctgactcc    104100
     actctccaag ggaccagtcc taagtctcat cattatgtat acctaaactc ttgaatgggt    104160
     tatagaccga ccattttagt acattggcag tctccagccc agccaaaacc tcttggcgga    104220
     actgaagcca tgggacttga agaggtctac atagtatcga tactgtctca cgacgtacag    104280
     tatgaaaacc agtgtagctc gttagtcagc aagcattgct aatcgactct gggaatcaac    104340
     gggttaatcc cggaaacgcc aaaagcaatt ctagggcttt ttatttcctg ggaacttctc    104400
     tctagctcct ggggccactt tctgtttctg tcaggatata catgaagcat acggaacgga    104460
     tggagatatg atctacgcgg gacccacatg gtgtatatgg gttcccctga acgcgaggaa    104520
     gcctgttcct tttgcttcct cgcgctacgt cttgtataga gtcaactata gttgttctta    104580
     atattgatta ttcaacttga aacactatcc acctctatgt atatgtgaga ccctcacggt    104640
     ttctaggaac tgaggtctac ccctgggatc ttcactctac attccttacg gaatatgaac    104700
     tggctatggg aatacattgg ctggctcgtc gtgggcttca gatatcgatc aactatatag    104760
     aggatagcgg gcctctccct tctagagccg agaagagagg aaggtcttca gtgacaacac    104820
     gaatgctcgc tggccgagac gctcagattg acgcagagca gatctctggt tatcctcccg    104880
     tctggtgcga tgtgtaatat gtcatgcggt gtcctgggcc tccatgtcgc aacgaaggac    104940
     aatattgctg gcaataagca ggggggaaca ggcatcatag attaagaata caccctcgtc    105000
     aaatatgtgg agcaaggtcg agttctcgcg acccacgagg acgttcctga tagtcttcgc    105060
     cagcagctct atgctgcgga gaaccagcaa ccggaccaaa aaaaaacgaa agctgcggat    105120
     aactctacaa tgggttcaat gtgtcctcca atcagtatct atgtcctccc ggcagtatca    105180
     tcccaactat cactatcgat acgcacccct gctaatgatg acatgcccac taggcccgac    105240
     tgtactggat caaccatggt agacggcctg ctaggtgtca ctgtggagga atataccgaa    105300
     tggcaacaac ggcggtgaac aacgagactt tcagggagaa catcaagaaa gcacgcgatg    105360
     taacccttgt aaattgtttc gacctcatgc agatttatga gggtcaaggc cgaggctttt    105420
     tgtcaaacag ggcgtgaaag taggtgctac ccggctgttg gtgatgtatg tctacgacat    105480
     gtgcgaccta cagtactggg gtatggagta aggggccgag aggtttattc tttcacctgc    105540
     tggtttgtga taatcctggg tttgcactga tcctcactct accctatgaa gaccttgttg    105600
     tgaggtgtca ttgtcatact ttagttgtag gtagtgtgtg gagttatgcc taaacgctta    105660
     gatggttcta agtttcttaa aatacattgt agataaaggc attcctttat tcagtcaaaa    105720
     ctcatcatta cgctctccat gcttctttct cttcggttgt gtcacgtatt gctatgtacg    105780
     tgtccgtgga ttatctcgcg tcggtggtct ggatgtgctg ggctagatac accgcgatta    105840
     tgtgtagtag tgtggagttt cacaataagt ccccacgagg aaccggtata tgttttagat    105900
     actccgttta agcgtcatgc cccggtagtg ttgtccaatg taatatcctg tgcatgggaa    105960
     tcccggaggg agagaggggc cgtggagctg gtacaaccat gacgttgtgt gggatgaagt    106020
     gcagcatggc cgtaagggcg cacggtgaag ttgccggggt tggtcggggt aataagcaat    106080
     agggctgggg tgtgttgtag aagtgctcag gattcgagac gagcgttgca gcacaggggt    106140
     tttcagggct gtgtccgagg aaaggtcgtt tgggtgagac atagctgaga ccggcaccag    106200
     gattgaatcg cgaaggagga taacggccgt cgagcggata tcgttgttgc tttggagctg    106260
     aggcatcccc cttctcgtgc actcatactt gaagcagcac aaatgcaaga tacatagaaa    106320
     ttcagatgcc atgcatagat caccaatcta gaacgcggag gagccatact aaggacgccc    106380
     ttgctatgag tcttcctccc ctgggccatg tttagaaagg aggtgaggat gggaaccgag    106440
     caaaccatat aatatgtaca gtgcggtggt ggcagcatgc gattttacca ttggctcctt    106500
     acctattttc atggtcagga ggctccaaat gaagcgtgga acgaaattcg ccgtgccggc    106560
     aattttggga cttgcttata tgttcgtatg ctccgtttcc cctttcatcc tagagcttat    106620
     gctgacaatg agcagagcta gcgtggctgt catagtccgt atcccatttt tgcattacgc    106680
     aggcagacca gacttccttt gtgagttgat tcacatcgtc cacatacgtc ttttcgtcta    106740
     gtatagtaga cgaaacaaca catatttcga tatggtcgaa tgtagaaccc agtttaggga    106800
     tcgctgccgg tagcctaatg acgcttcgac ctttgcttcg agttttatca aaatcaggtt    106860
     catcagtaac gaaccaacac agactcgtta cttcttttcc gatgctgagt agttgttctg    106920
     atggtgagga ccttgaatcg ccttgcgaat accaaaccca ctcttataat tgcggtcatt    106980
     ttgcaaatta atggagtcaa cttcttggct tgcaatgtag gagatggagg ggaaggtttg    107040
     ccacattcgt acagtaaaac aggtacacta gcaccttcat taaccagcta cttatggtga    107100
     tctccctgtt gtaacatatt gaacaatgaa aatatttgca gtgataaatc gatttttgct    107160
     ggagctgggg ggttatctgc atggcctggg catttccttg acgacggggc ttgtcttata    107220
     cttgtcccaa aattaaatag tatgtgtcac tggttagccc ttgggaacca gtaagacatg    107280
     catggagcac tcggatggag gctagatata attgacctcg gtggtttgat ggtcacgctg    107340
     atctggtttg gatcatcaat aaaacggtgg ggtaatatct aaaccgccca tagaaggcgg    107400
     ttaccggtgc atcgatgaag atgtaacgag ttaatattac tttatcaatt ataaacaccg    107460
     ggcgaaagag ccactgacca tgcggaaatc aagaaagccg caaatataaa cacaagaacg    107520
     gtttagatta cgtgttcttc ttgatcagga attatcagac aaagtcagtt atcattcact    107580
     tttgaaaact tcgttagatt acggtcttta tcaattgcat tactactcta aactatcacc    107640
     gtccaaaccc ggacagaact gttacgggca gaatgcacaa aatagtttgc cgaaagatag    107700
     gggataaata atgtcttgtc agaacttctc tagccacttt acacatctca agttgggcct    107760
     tgacctatta gttccacgca atcactatag tgcgctcaac tagttgctgt ctaccccttt    107820
     gctaatcttt taaattgcca tcaaacatcg ttgttagatc ggtggaggaa atgtgcagtg    107880
     aaaataggaa atataatgaa gaggcaacct cctgcaacat catctactct atcagactaa    107940
     tggaagataa acaggtcgcg cttgtgtgta catatgttgc attatattaa gcaattcaat    108000
     ttattataca ccggcaacaa gagcagttcg tttcgcagag aaagctatga tttcatatcc    108060
     gatcgaagat ttggagcacg caaagcggtt cgaaccacat ggccccggcg gctgttgccc    108120
     taagaaaagg ctcaacgctc atttgaccac ttgctcgatg gattgagata tttttggcat    108180
     ctctcaaaca ctttctcttg ggcgctttct tttgatcact ttgtaccgag gcccatgttg    108240
     aaaagcatta tcgcgaggcg aaagacgcga agggctatag ctcatctcct gcttcggtcc    108300
     tatagagcta ggctgaccgc gactgaagga ttcatgatga aagtcgccac cggatttacg    108360
     aaatccatag taataaagcc gcctaacaag agattggtgg cttttagtgg acaacttttg    108420
     aagtatatgc gtaggaaatc tgctttccgg ggcaacgaag acagattgcc catcttctga    108480
     ccaacgcatt actgcctcat tttttggatc atcaaggatt ctttcatata ttagtacaca    108540
     gggtaacagt attgatgatc caatgaatgc ttcacttact cgctcagatc ctgaatgaag    108600
     tcggatgcat gaagcctggg ttctggcctt gcatcgctct cagggcatga gtcagctcgt    108660
     tgcaagtcat ccctcgcaat agcaacttct ggtggagctg aatcattcag ctcttcattg    108720
     actggctgaa ctgaccggtc attgctagca ttctggacag tcaaataggg gcttgatgaa    108780
     tcttggtaac cggagctttc ttgttctgtc gaggaaacag gaccaaaacc accttgattt    108840
     ggaagagcgg attgagcacc atccagcggt agagctcctc tgttattgac gtggtccttg    108900
     tttccagaaa gctgagagac taagtcctga tgattccgga gatgttgctc aacaagcgaa    108960
     atttgttcct ggactacatt gatcggctta agcttcctgt actgcaccac gggacaaaaa    109020
     tttcagagac tcaccttcgc ttattactct ccgagcatca acaagctctt gcaataccgt    109080
     gtcgtttgat tgaagttcct tctggcaatc atctttatct ggccaaggga agagaaaccg    109140
     ccaaggccta cccgagcgta agagcctgag gtcattctct gataactcaa cgctagaggt    109200
     tccgacccta agctgtgctg ggccctcaaa ctggggacct gcaaacagaa caacgctggt    109260
     ccaagtcaac ggtggccctt cccttacgga cggtattgta atcgagaaaa ggctctctag    109320
     actcttgctg aggctgttgc tagtcaaaac ctctccgcgg ccaaaggcaa tactgccacc    109380
     ttcatttaaa accgacaaat gattggacaa ttcggtcgaa aattcggaaa tggaggtatc    109440
     ggcaagccta agaggtctta gacttttatt atgatattga gagacaaagt tgttaactat    109500
     tttatcaata gtttggcaag ttctatcgcc gggcacttcg ttgaaaggag tggtcatcat    109560
     ttcagagcac aggtttgagc acaccctgga ctccaggagg cagaacagca gaacatcaat    109620
     ggcggtaagg tgcttgccga ggcgggttaa agttactccg tgttactaat tgctagtcac    109680
     agccactcga cgcacgtccc acatatagtt acatactttg agcatttttt taaagccgcc    109740
     attctttagc caatttattt atttcggttt ggtttctttc taatcttgtt cgcctatcac    109800
     ataccacatt tccacttttg agattcctac ttgtacgcat aatacgtatc cattggttac    109860
     caattacaaa gatatattct tgggcaagga ggatcgaatg agtcatgcca gtttctacga    109920
     cattgaattt tacctcctag taataacgtt tcctgctgcc accattgtcg cgaaagacga    109980
     gaaagttgga aataagaata agaaaagact gctacgtcga ttttatggtg acggtgctgg    110040
     caggaaaaga tgattgtgag tacagtagtc tgcctcaaat tctttttgca cctgttgaat    110100
     accaccgaaa tacccgaacc actcaagaga caatattcta taaatgtgta ttttgactac    110160
     tagtattaat gatacgttct agccgtgttg tttatacacc ataaactgcc ctcttagcgt    110220
     catcacgctt tctcatgccc ttgcttacaa aaagaatgcc tattacatat gccgacttga    110280
     ccgcaagatg tgtaccgtca ccaggtagtt aatgaatcaa agctgttatt gttgtctcat    110340
     ctttgtccaa cggttataga ggagttagag agatatatta atacgcatag gcgaagatca    110400
     gtgataaggg aatgcacggc gagtcgccac tagccagcca cctcacattg taccgtttct    110460
     gaccatcttt ggccacttag cgtctgctca gccagacact gttcccgaag ctcttacctg    110520
     ctatccattt ttaagggaca tggccagctg cgccagacga ccacggccat cgtcaacatg    110580
     gaagtcacag gccccagcgc gcccggcctg gaagatagtg attaactata gttcagcaac    110640
     aggggcgtac ctctccagct gaccgaacaa aatacccgcg cgacacatca tcacgaagtt    110700
     tggttaacct caccctcagc caatcgttaa tgaggcatgc aaatgatcat gagtgagcgc    110760
     acggagtcaa aacgttcgaa gaggcaggtt cgacgagtgg gtcacaaaag cttgcccttg    110820
     atctccaggc tgttccattt cccaggctat tttatggcac gataagcaga tccgttcgta    110880
     gaatagagag cttcaccata ggatcaaggg agctatgggt atgatagagc tctcgcatgc    110940
     aaggctagaa actccaagca aagtcacatc agcttggagc aattgaatct agactgtcaa    111000
     ccgtagttag accatccctt ctctctctac cgagatcagc cccagccccg tccgcagcac    111060
     acataccatt atgcccaatc tcgagggtgt ctatgaatcg cccacccatt cacttaacca    111120
     gcagagtgcc tgcagagtca ttgccagcgc tgatgagata ttcgaaatgt ttcggaccgg    111180
     ctcttaagaa gccgacacat agtcctgatc acatggcccc gatcccagtc ggcagtcctt    111240
     gccgtgcagc aaggtattag acaggcgatg tgagcctcgc agagcgcacg caacaggcac    111300
     agcagtccgg accctacacg tggaacctca attaccaaat gtgtatactg cctgaccaag    111360
     acttatctat accttgtatc ctcatccaca atcacgggat gtgacgtaaa ctggacagaa    111420
     ccatactgaa cttcgtattt gatagggtga tttgatgcaa cgaacgaccc gacagacgct    111480
     gactgggcca ccataccacc gtgtctactc gctggcatat atttaccacg cagaagaact    111540
     gcctgtgtgg cttaaacatc ctccactaaa ttttcttcaa gcccatccag cttgtgtgga    111600
     ttctataccg cggtcgccca tatggcactg gcttgctaaa tcacttaatg tctatcttta    111660
     cgaaagccaa tatactcctt tcagatgcgg cctatctgtg aattggccat atgaagccct    111720
     cgactatata ctgtcagacg aggactcagc cggaaaatca aacgacgtac tcgtaaaatc    111780
     tgccctttgc atataaagaa tatctctaac tggtcactaa ttccgttatt tgcggagagc    111840
     tagtcgtggc tgatagatgt cgcacgacaa tcaatagtag gtgacttact ggcccaatta    111900
     cattgttgac atggtcgtag cccagctgtt ggggtattgc cgtttaatct acctatattc    111960
     tttgtccgag tgtctggacc tcgctgaact tggtctccgt gaaacctaat atggcattgc    112020
     gattatcaaa caacgtgaat atctttgatc ttggcgaacg ttttccgtat tggctctgct    112080
     catctgaacg tggttcatgt cgaatcggtt tgtagaaaat cggatggagg gctacaaggt    112140
     tgtggttggg ggatttgtag gtcagttagc acgaaaaaga acagccctag agagaacaaa    112200
     tttcaactgt attcaaaagt ctatcccgtt gcttctcgtg cttgatagca ggaaagttga    112260
     caattcagcg ccatcgtaca tctcgatcgc caggatcaat tttgaccaga gtaatctagt    112320
     ggccatccct ccggcgttag ctgcccacag aattcagggt tatagacaga tgctgtctta    112380
     tccagggtag ccacatagcg attgcggccc ttgcgtttcc catgcgttgc atagtgtgct    112440
     ttaaggttgt cgcgacgcaa gaagctgcgt tgacacccag gtacccagca gaaatgaggc    112500
     ctctcccctg aatggctttc caggtgacga ttaagggtct ttcgaagttt gaaatgactc    112560
     ctgcatccct gaatgccgca tttgaactgc cgtcgagtga cgttggtctg ggaacctccg    112620
     aggctcaaat tggacggatc ctgcgaggta tatagaagat tgacaggctg cccgaaggct    112680
     tggcggggtt cagcaacatc attttggcta tcgtgctgca gtgcctcgag tggccgtggg    112740
     tagggagaat tgatgttcgc ttggtttggg aaaaggcaag ttccaaagaa actcggcaca    112800
     tagtcaaaat tctcaggagg tggccctagc aggaggtggt tagatggcac tgacgtaggc    112860
     agatattcga gccaacagat cacaggccgt gatccgcaat agatcgaacc tggatcaatc    112920
     gagcagcctg gttgcccgtg atagtggcta tcacagccgc cttcgtgctt ttgcactgag    112980
     tggggcgacg cctgataaat aactaggccc ccatggtttt gatgaaattc catgccaggc    113040
     cactcggcag ggctaggagc aatgtttgct ttcaatttgg cgctgtcatg gaagagcgtt    113100
     tgtatgccat ttgagaatgc cagatcattt ccaccatata tttgcgagga tggtggtgtg    113160
     atttgttgtt ccatctgtgg acttccaccc gtaaataaca tatttgcaga catcttttgc    113220
     agacagccga aggaagtaac aagcggtaaa gtccgacaca gcactataga tgtgttgtcc    113280
     ggatgccacg cttaatctgt ctgggtgcaa gtatgggatg ccgggtagaa gttttcaaaa    113340
     agttatgact agctaggaga aagtcgactc agtagtagca acccttgtga cctttggaat    113400
     ttccacagta tcaagctttt attcgagagg cgaaaagagt ggccgagtaa attttcacca    113460
     tcacacggac agcgttgaat aacggagact tgctattttg cgttaggtta cgccttgaat    113520
     agatttgtta caatgatagg gagttgacag atgaaaagcc cgctgattga acggtggtca    113580
     aatacgtgcg aggtttactt caacacatgg tgttgtcacc gaccacaacc tcaaacaagg    113640
     cgtgatgaac atgaacgcca gggcctaaca tttatacgga ctctcaacaa ccttaatgac    113700
     catttcttca actcccgcat accaaacctg gctacccaag gatgggtgat ttaacacaac    113760
     agttattagc aaaatggaga taggggcgtc caacagctcg ccaaagtcta agttgattgg    113820
     aaatcaactt ggttctttgt atagactcct caggatttat tccgatggtg cggcttggtt    113880
     cctggcctgc accagcctca tatcacaaca ctttccactg cgcacgtact ccatgataga    113940
     tatacccaga aagcacaatg atacattcct caaaaaggct gactggtgag accacagtga    114000
     acctgaatgg tagtccttga ctgcccaaga ttgaggttaa catggcagac ttcacggtgg    114060
     gaaatgaacg aggtgtccga taaagagtcc tagtggtagt taatcactgc ctcagttcgt    114120
     caagtaatcc tattgagaag accacgcata cagtttccca tcgtttgaac attcactttg    114180
     gtagaataac atacgttgct gcatcgatta cgatcgacta aatcaaacaa atctaccatc    114240
     ctgagcctaa gcccatacat tgacagaaat tttctttcct aggccatcag agcactagcc    114300
     tctgcttttg gtaatatctt aaaatcgtgt aaacattgtg aaaaattcga gagattggtt    114360
     gctcaccttc tttttgcgaa ttttcgagcc ctgttcaaag ccagcacgtc ttagtgtata    114420
     gcctcaaatc tcatagtgtc ggtgctaata gaactgcggc acaggctgct tggcatttcc    114480
     cgaaagccaa gttgcatgcc attacggagg caggtgcact agcacccata gtagctcccc    114540
     aggtaaagcc tgctgccgag tagcaagcca tgacaacagc ggcacatcct gcttggcaaa    114600
     ccccgtaggc ggctggtccg gcagatgcag gagggatgaa aagtaggaga ttattaatga    114660
     gcacccacgg gactctcatt ttttaggacc tgaaagaagt tgaaactggg aaccccaaag    114720
     tatttgtgct gtaccaagag tatgctgaga caagggagac catgctgcct aaatagatag    114780
     acattcaatg atacgtcgcc aaacggtggc tactctctag gcctcatgaa attttgcgtt    114840
     ccgccgtttc ctagaaaaaa aggcaaacgg aatcctcacg tttggaaatg cagacatacc    114900
     tcggatgcat caaatgcaag gcgcacgcaa gggatcaaca caccaattgc attgccattt    114960
     tccacatgca gagagccgat tcgtagtcag catttcctgt caccgaccga caggccatga    115020
     atgagtgagc caacgatacc ccggacttaa aaccagttat ccacctcaca gatccccacc    115080
     cgaagctcac gaaattctct cgatgtgggc cgaatcagta ttcgttcaat cccagaaccg    115140
     aaaacataag tgatcatcct cgagagcaga tatgcaagaa cgacaagtct gtctgagtca    115200
     cgaggaaatc gttcgacaga gaccgtagaa tcacgagcgc aaccgtctcg gctggcctga    115260
     tcgcccgcct gcatcagttt gcatcagttt ggcctgttca tggcaaatat tgaaacgcac    115320
     tggtgagaat acctgcacaa agtgaggcat gttatgacct ctccttcaac taatttcatg    115380
     ctgagcgaaa attcgcttca gattctggta aaccaaagag aaatactatt cacggccgta    115440
     ctaggatagg ggtgtcaagt tcatggaaac accgtcgttg aaggaacgtt gattgacagg    115500
     gaaatcttgc gcatatatat cgggcctcag caagaactac tctgtcaaaa aaagagccta    115560
     gggcttcaag tatttcaatc cgggtttttc actatccacc gttgaccctc atttaaaaaa    115620
     aaaaaaaaaa aaaggtgaga ctacctgtag ttaacgaagg tgatcatcga agtgattggc    115680
     attctccgtt agctgccagc gccttcatgt tactccccac tgacggcgag cctggaagtc    115740
     caagcacgtc ccataatttt gagttgcggg tcgagaatct ggatcaacgt gcctctgctt    115800
     gtgcgagatg gaccctctca cctctggccg gcgacaaaaa acgtaaagct actcgctcta    115860
     cgctgagttg gccagaataa ttcctgtaaa tacatctgat gttctactag gccggctacc    115920
     tgtttcgtaa gcgtataaag ggatatgcta aacttcaaaa agtaactttc tgcgtcgatc    115980
     agctagcact acagctgcaa atctattttt aaaccattcc gagacgcgct taggcttagg    116040
     ccacgaaaag aaggtcaaag cttgccaagt ccacacgcgc ctgttcctcc gttgatcgaa    116100
     cgtaggcgtg tatgaacaca gtaaaacagc ccatgttatg aggctataga agatgaatgc    116160
     tctagcatac aaagtggcat aatcgcgtct tatttgcaaa ttcgatcgac gtgaagcgtt    116220
     cgatagctac cgtgactatt aataatcaag agactcttca attcaatatc aaaccaaatg    116280
     atcctggtga tacatgattt gactgtcgaa catttgcgtg atccttggtt gtgatgaatt    116340
     gcatcatgga aggtacattg gggccaacgg aaggactggc cacgtggacg ttcatagggg    116400
     aacttgccat atctggcaac tgaggggtat gctcagagat tattccggga tcttcttcgc    116460
     caagactgtt ttctgttggc tgctggacgc gttcggctga cttagtctgc tcggtcagag    116520
     atggtttgtc tgatggaaaa cggactttca gcaccagcgg atcgcgcttg gctggctggg    116580
     ctggctgggc tggttttttc ttggcttgcg tccaacagag agaccaaggc agcgagcctg    116640
     accagaaata aatgaaggac ttcgtcccct gtggaatatc tcctcgtatt cttgcgctat    116700
     ccgcgaccaa ctcaagtgcc ccctggtact caagaaagcg cgcaattgtc tcttttccaa    116760
     agggctccac gctgaagtca tctttaaggg cggtatgtga ctctcctctc cggatgtgct    116820
     tagcgccgca agagtactgc ccgtctcccc atcccgacaa tggtcggggt ttggttctgc    116880
     atcaattcta gtttcagtat aaactgcaga atctgtgttt gcatccacat cacacgtgtg    116940
     gatttcgacg ggggactccg aagattctga tctggtaaaa tctctatcgg cgctgtgggt    117000
     ctgttcttgc gaaatttgga ggattgtctg taccgtctcg tcaactagta gactttagcc    117060
     tatagacccc cccctttttt tttgacaggg gctatgtatc accctcactt tctgaaatgt    117120
     cctctcgcag gcgagtctta aatctttgat caactcagtt ctggcttctc gctctgcttg    117180
     cacatcttcg ggttcaggag gcatcaggag cagcttctgt agcaagttgg atgaaagtat    117240
     atcacgatcg cttttgctca agtctaatga caggccccga atgcaaagtc gatactggtc    117300
     ctcgtcacgt agctcaattt gattgttcaa attcgattct cggatgagat caacccagct    117360
     gggatgacct ccgcgaaggc tgtcgtcact agccaattcc acgacccttg ggcgagagct    117420
     actgaataaa ccgtttatcc tgtcctctat tttgttacta aagagaggct tgtggagctg    117480
     cttggcgaca ctgccgtttc gatcaaggat tccgatgtac agtctcatca gcttcagaat    117540
     tggctgtaaa ccatggcgca ccgtctcaat ccgcggcagc ggactagata cccgatggcc    117600
     gaaaaagtca atgggctcag tgggcatatt gctcatggga cttgggatta tactggcgtt    117660
     ttgatggacc ggttctaccg aagagaggag agcgaccttt attcaatcca ttgccagaga    117720
     ccggatccct gccgacacaa gagtggagag gactaattga aaagaattac tcgaaaccct    117780
     cagtggtaat ggaaaagggg gaagggttgc cgtcacacaa ccaaaaccgc ttagtaaacc    117840
     tgggtacttt gttattgatg ccccgctgga ggagcatgat tcgctgaggc tcttgtttaa    117900
     taagagtgtg gcatccgatt ggttgtgcta gccaacacga tggattaaat cgaccagtga    117960
     tcggagggct agaagcgccg ttacgacact aggagcgggc ggcggaaata tcgagcagaa    118020
     aattctttat tggtaaccga acacagtcaa gagatctcga cggatccaca catttggccc    118080
     ttttccgcct tactttttcg taaatgtcat atggcttaac ctaccagttt catgcaaagc    118140
     tttaagtgaa ggtttaccaa agagatctgg acgagcaaaa aatgaagatt gtagtagatt    118200
     tctatgtata attcatattg atctgttgtt tatggcccgg gccagggatc gggcacggtc    118260
     cgcgcgcggt ggaaaccccc ggaatgttta cccctgatat taggaccttc ccctctttcg    118320
     tgtcccatcg tacacttctt gggctaggga tgtgatgata gcaattcagc acaaattgca    118380
     aagtattgct gagtgacctg aatgaccaaa taatgattcc ggtgcgcaga ccaagaatgt    118440
     gaggcgtttt gaggagactt tgaacgagca tgaggtctgg tgaggggggc agctcttggt    118500
     tcaccaatct ccatagtgtg acaaaccatc catggttcca aagtgggttt ggggaccaac    118560
     aaggaaggga gatggtctag ttaatcctcg ccgtcttagg cgctgttggt gatcaaaacg    118620
     gtcgaaagct gccgagcgat catatttagg ctcggtacca aaatttcagg aatcgtagaa    118680
     acttagccaa tcggaattga gaagctcctc caacatgcgg acccgatata gtgtcataac    118740
     gcaaggaagt aataccgcga aaatgtatca aacattgact aggattatcg agcgccgtcc    118800
     gctgccatgt tacatttcaa aaaattgatt tgcaaaactg catcaacctt cgcttggtga    118860
     tccgaccgga ggagttgggg gcatcattgc tgatcgacgg gaaactagcc atcaatgagg    118920
     tgggagtgat tgaggctgtc tgcttttctc tccatcgatt tgacgcaata aacgggatgt    118980
     agtgggttcg gagtatcatt attcccttgt taggcgatct aacgctagaa gatgcagata    119040
     tcaacgcaca agcccgcaat atggatggga gattttgtca agatgcagga tgatattatc    119100
     ttttttacca tgtaaacatg tgatttttta ctatgcattt gcttactaat agtgtctgac    119160
     cagattgtta aattcaaacc attgttgctt ttagttagag aattgtaccg ttgtggattt    119220
     tacccgtacg ttcgccatac acctgatttc tgttagattt ccatttaccg acccttgacg    119280
     gaggtggaag caagaaccac gtttgtaaat gtggaggcct aataggctgc cgctgcgaca    119340
     gggagtaaga agggtcaaga ataccagttg ttcctagata gttccatgta cgctcttgca    119400
     aactcagtag aacttgattc agatatgtca gtcatctgct cctaatgttg aagggttgtc    119460
     ttggtaaaaa gaacccttga aaagaggagg ccgaaaatgc taggacatga aatatgacag    119520
     gttacttaga gaagaatgat gttattgtaa tttacagtaa atgtttgaat atgacacata    119580
     gctgactctt gctcgcggga aatgttcaac gggtgtgtaa ccactttggg agcgcctcag    119640
     gagtttggca tcttcgatcc catttaacgc gtatgttatt gtttgccgat caaaaccaaa    119700
     ccaaccgacc ctattagatg tcatttagag acacaactac gcttccacaa atcattttat    119760
     ggcatcgccg aacgaccacg agagtcattt cgttagcaaa cctcgcagaa atcaggcgtt    119820
     tgtctgttct ggttgaaaaa aaaggatgcc ctgccagttc gcctgccgct tttctgaatc    119880
     tggataccag acaagcattc tcttggcgag atccagaaac ccttccttct cctctccctc    119940
     aatgaaggga gcacgtgtcg cgtagtttcc ggtcggggat cagatcttcg caaagggttg    120000
     acccagaatg gttcgttagt ctgggaatac ttggatagaa aaacgcaggc ttcggaacca    120060
     aaccaaacaa ccttccgtcc aaatgggtca agaacaaaat ttattgatag catacagctc    120120
     cgtgagtgtc caaatgattt gttcccgctc gcttgttcat gtcgacagct cagcaacgcg    120180
     gagaggaaga ggcatcaagg actctatcag atgtggttat tgggtcttac tacgctcctt    120240
     gaattttgag tcttgcatta gtcaggcata ccaacgtctg atctgatgaa ccaaatcgac    120300
     tggagactgg aagaaagggt cgagtcagcc gacgtggtac ccactagcga ctcatcgaag    120360
     cgaattgtag tcatgtggaa tatagagagc atgcgaccgt tagttgttgg ggggtggggg    120420
     ttgagaagac aagacatttg ctcgcttcgc attctaggca cggaaatctg agggtgtctt    120480
     cctgtggtga gatccgagtt agcaagcgtt ggtccagctg tccgagatat tggatttacg    120540
     atgaagcatt tcccgagtgt acggttggat catcataata ccagcttacc aactagatca    120600
     ttgccaattt gattctgcaa agcagtcacc attcatgtca tgttgcatcc aggttcgccg    120660
     cacttctccc actgtcgctt cgagaagccg tgctggatgc actggtcaag ttcacaagac    120720
     ggcaaaggcg cgcgacgaac ctacttgtga caagaaactg tccagtctga ttgggagacc    120780
     gcttcgtgtg gacagtgagg ggctccgctg ttcagtgtgt gaagatggtg agggagggga    120840
     aagacgcgat ggcccgtcgg ccccttggtg ttgtagttca gaggtatgat gattataatt    120900
     tcagagggaa catgaagcta tatatacaac gagaagatca agttgatttt cagtcaactt    120960
     gattcttcgt atagataatt cgggattaat tccgatggtg cggcttggtt cctcatctgc    121020
     accagcctca tatcacaaca cttggtcttg cctgactcgg caggaatagg tcactcgcga    121080
     caggtgtttt cgcgattggc ggtgggctgc tcctacaatg gcgtagagat gtcagtgatg    121140
     tttgtgtccg gggcacagac ttcgcagaaa atcaaaaccg gcgcagcagg aggcgcgata    121200
     ttcccctcac ctcatcgtgg agaacgaacg tctggagctt atgcgtcctg tttttggcca    121260
     gcgaccttgg tttgcagtat ctcacatagg acatgctgca tagtttgaag tgacagggta    121320
     agaatcggtg tgttaaccat gatcctgcgc ggagcactaa cggagtgccg gttcggcctc    121380
     actttggtgc gctgtcaacg atttccagtc catcgtcagc ttgtcgatcg acgataaatg    121440
     catgattcac aagttctgaa aaggcgcggg aaagggctcc atgactggtg tgtattggac    121500
     agaattcaca gacctggtgg cttcgcatcg tctttgcagt cagtctagtc gcggaaaggg    121560
     tccagacaac ttttgaactt atgaatagtg ttgagataga taccttgttg ttgcactttt    121620
     attgttttcc gtgctgtaaa ttttacaaca tctacttttg ggatttcttg gcttttcaac    121680
     gaatgtggaa aaagtgttgt gattgggata ttatatcctt tggacctttc accagtaagc    121740
     cagtaaaaat gaggcacatt caccaaccgg cagatgtata tacatactat agtggaaata    121800
     cttaaattcg gccggttcca tgggctcaca ggagttgttg ctgtcctagc aaaagaacaa    121860
     gaatggtttg ctatattcaa gtgtatggca gacagcatgg aattactacg gaaactgcat    121920
     accaacatat tcaacttcta gagcaggcta tcaatcacaa atttgaggaa agtgctcatt    121980
     ggcacgggaa atgctatcac caggatcgcg tacgacccca cccatcctgg ctccgaaggg    122040
     atcttgtcta tgcatgtgca ggggagaagg ggaacaaccg cctgaacgag gtgtggtaca    122100
     acacatggat tttccgcatc aatctcaaga ttgacggcga tttggatgaa cggaccgcac    122160
     gcacgctgct agggttacac atgaaggtgg agaggatcca gtttacagaa aggagtccca    122220
     atgaaactac gaagcgtatg cgtgaattga gagacgagat cccatggttg gcggatgggt    122280
     cggtagagat gagaaacacg ggggattgtc gattcttcgg aaggcaattt gagattggaa    122340
     gggatatctg atggacgaaa acaggaaagg cggaaggaaa tgctacacgt ccgggaaaaa    122400
     tgattgttca tcacgtcaca atgttggatc ccatgccacg tgatgtatat agatttatag    122460
     gagcgtctgc ccaacaggca gacactccgc taggcagcag ggagatgagc tgctgcaatt    122520
     gcaaatagct gtatcctgta ttcttctatt tttctactaa taacctcaat tcacggcctc    122580
     aactcaacga gcggtcaggt gaattgcaca cacacagtaa gaaatagata cataaaatat    122640
     atactaaaga gcgaaacttt ccatcaaggt tagaaaaata tcaactaagc aatgcgcatg    122700
     caattgggtg acgatgtcag cgaaggtgct gtgcgcacgt atcacctatg cgagtccctc    122760
     ctgcctgctt ttgacaactt ccttcttctt cttgtagttc gcgtcgttgc cattgataat    122820
     ccttttcccc tccaagtcat ccagaagatc aaggacgtag tcttgacagt tataccccgg    122880
     gtattcgttg tggatcggcg cctgtctcgc tgcctctttg attgaggtaa ccttggcaat    122940
     aggcacatcg cacaggtaaa tcagctcgga aagtgttgct gatttacggg catcggaagc    123000
     tctcatttcg aagcggtaat tggtcgacga acccatgatg tggaggactg tctgttccgc    123060
     atccgtgggt ccgttaacaa agaggctcca gtgtttgtag acacctccgt cattgtagat    123120
     agcgacatgg attcctgcag tcgaagacat ttgtaaagtg tagacggcta ccgtaagaac    123180
     tttgggacgt ggtggatggg tcttcgagcg taagaattgt aggatacggt accgactgtt    123240
     ggagagcaac agaaaatgca gcaacagtaa aagcacagaa ccgggaggca aggctgtatt    123300
     tggtaaaagt aagaaaaggc cttggctaag agcgatccgg tgccctgttc agacttaatt    123360
     gaaggagacg gaatgaaatg gttctgagat tagggagaac gatggttgta cttatagaat    123420
     acactgaaga ttagatacta ctatacattt gaaaattcac gataccgctt ggcaaatgtc    123480
     aagcagagca actagccatc catacatgta tcatgttaga acactgtcgt ccaatcaatt    123540
     agcgctaagg tgtctgtaag tgataccaat gtgcatgaga taggcatcga attctaaatt    123600
     taggtcgaag gaagggtttc ctagctgctg aaaccaaaga gcgtcacgct attttcataa    123660
     ccatgtaagc gctcgccatg tgtgacttga acgcactgac ctgttcgtaa atagggacgg    123720
     attggcatct cacagcgaat cacaccaaac tcgagaggga cctgcattga ttagcgccgg    123780
     cctcgacctc catcccacca atacaagatt cccattccct ccgaccacca tagcgcctaa    123840
     agctgcttat ctattggaag tttcaaaaat gcggaattag atggataaat aggggttaga    123900
     caattctagc taataaaatt gatctctagc agctggaatc taccttgccc aaggtttaag    123960
     ctatgtggac cggacgtgga tcccccaaag tcggtcaaca agccaacgta tagaatattt    124020
     agaaggcgag atgctctctg gtaagtagag aaaccagtcg tcttcatcca ctagactcag    124080
     ggtgcgcgtt agggtagtac actcatagta cgccggataa aagccgctgt cctcccaatc    124140
     aatgatccca gtgacaatat aatgaccatt gatattccgg tcctttgtca ccatgatatt    124200
     gtcaacccta acatcaccat gggtgaacac caatctatgt gccatatcag gactatcatg    124260
     gtgtaggagg gatcgaagga gtgtgacgta tgtgttgctg ccatggtgac gggccgaaaa    124320
     ttgcaggttg ctaaactcca tggctgtagt gatacctttg aataaggcac attcgtcaac    124380
     gcgaagctct ttagcccctt ctccgcgaac cccgccgagc gcctttccct cgtcctgttg    124440
     aagagacctc aatcgacaga aaatgtcttc tagctgttgt tggatcgata actttccctc    124500
     atgtgacaga acaggccatg cttgagccag cgttgtgccc ggaatatagg acatgaaaat    124560
     aacccgaaaa ggaccgaacg cgatcaagcc gtagggtctc ggagcaggta tatcgggcgc    124620
     ccgctcagca aggaattcca tgctcgtgta ttcggtgtaa tccctattcc ccaagatgac    124680
     tttggcaaca atgtcgtcgt tgcacttaac aacaacgcct ctaacagggt tttcccacaa    124740
     cttgggcgaa ttccaaagaa gttgtttcaa aggcacaacc aatgctttcc cattgtcact    124800
     tgacccgact tctaaagcat attctgaaaa ttgcgccagc agagcgacca cctccttaga    124860
     caatggaaag atgaccgtgg cagtctcggc aagatcaagc cgtgtgcgga actcgggggc    124920
     ttgtacctcg ggagcatctt tctcgaccag tggcaatacc ttcggtccag tcgccatagt    124980
     aatctttcga ttataatttg tcgggaattt ggacagcacg ttgacctcgg gttcgtccct    125040
     gagtgtatca cggagctcat gcaaggttcg gagattgatt tccgcaggat aagatagctg    125100
     acgatattgg gaattccgat gttcaagacg atatgagtcg gagaacattg acatcaggtc    125160
     agcctctgga ttcctttcca gttctgcctg aaatgcaagg ataagatctc tgttccattg    125220
     tgctgcgtcc gcgttggaga gggaaagagc ttctgggtga ggagtatcac ccatagttgg    125280
     tgtcgttgat tgagacaagc cagtaagcct aaagatattc tcttgaataa cttgagtgtg    125340
     gccaagagag gcgagctcta gggacagata gggtggagcc ccgtgaaggt gggactcgcc    125400
     taggctgcaa taagctgatg gcgcgcaggc gtgcttcacg tgaccattat tgtcttaccc    125460
     accccacacg taggctaagc tcctgggagt gaagagtggg tttaccagga acttgcaact    125520
     ctttaacgta tcgaggaaag atgccaggaa gagcgcggaa tagatatata ccgaagtatt    125580
     ggtctacctg tgagtgttgt cgagttacag ataatcaagc aaagactcag taatacaaaa    125640
     cgcaaacaca agtaaacaat gtatgactga ggacggagaa ctaaactagg tacatgaacg    125700
     cgtattctta tatatccctg agttcacccc ttgtgatgag tagatagtag agtggtaaaa    125760
     tctccttggc agattctact gttcgaccat ctacccttct acaacctgta aggtcacgtg    125820
     gtcatgtagc tccctaaagg ggtaacctta gatgaaggtg acatccggta cagtgaagta    125880
     catatggcta taaattcccc tagcttgccc tcattctgtg taataagaga tgaataaata    125940
     actgctcggc atccagcttt tcatccctcc cagcccacat taaatcgctg ctttacacac    126000
     ttccatattc tccctgttgt gatatgaggc tggtacagat caggaagcaa gccgctccgt    126060
     cggaattagc tccgaagtgc ctatacagac gaccaagttg atttccaatc aacttggctc    126120
     attgttgtat atataggctc atgtatacct ctgaaataac aagtcaattc atacctccga    126180
     actacaacac tccctacagc gttcgacggc cagtcatata gcagaaatga acgaactgaa    126240
     caacaatggt ctgtacccgt tgccttgatn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    126300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    126360
     nnnnnnnnna ggtccagatc ctctgactaa ctctactcgg gctagtgagg ttttcctcca    126420
     catgtcagcg ctccttttcc ctaaagaggt gcaatggata gaatttcgat ttgtgcgatt    126480
     tgtgcgggtg tctggtgaga ctataggaga ggatatgttc ttcctgccgc gggttgaaac    126540
     agccctggga aatctgcgtc ggtctcgcag acagttgcta gacacaatcg cctggcatgc    126600
     tgtccgtaca acaggcacta gctttcgact atccctttgg cctcgtacgg aatccctacc    126660
     gtattcgagt ctctcgacac attccctgtt gactaggctt cccccgacgc tacccctgga    126720
     cccacggttt ttgtacataa tatatcgagt aattaagggt gaggttgatc tgaatcgagc    126780
     gggattgttc gtatactcat ttcagtaaag accacgataa tgaaaaatga ctatttggtg    126840
     cccttcttgt taaaagtctc gggaatatat aacctgcttt gcatgcggtg taattcccct    126900
     tgcactgcat cgccgcttgt agtatttcaa agttgccaat ataggacagg gcaagccgaa    126960
     ataggcaatt ccttactctt ctcttgcgac gtccgtcaac cctgccaaat tgggactgta    127020
     ggggtagttc cagtcatcga gtaggctagt cagtcgttcc cgagatgatt ccagtgcctg    127080
     ctcaaaaaag cgcagtcgag ctagctgctt gtcgtggcga agctgaagtc cgtccctctc    127140
     ttttctcatg tacgtaccag cctccttcaa gatctcattg ctctgctcaa tcttttggac    127200
     atcgatgtgc ttggaaacgc atgactccca taggcgtcga tagaatccga cgagacgggc    127260
     tgctgggaat gcaaacttgg gatcgtcacg ttcgaggtct gctagcacct tcaagatggg    127320
     ttgaaaaggc tcggtcgcca aagaatgtct tgttacttct tcgtgttgcg aagtcgaggt    127380
     ctacgatggt cagccaaaga atttgaagcc gaagggtttc acttaccaat ggaaggacat    127440
     gatcagaagg ttccagatta ctgtccttat tactaaggtt tggtaattca cagggccgct    127500
     gttctccttt ttcctggtct ggcgagctgt tcgaggcatc cattttgtcc gcaggagaaa    127560
     gtcaaggtct gggcgatact agttccatca ggccttggtg tctcttatag aatatgcagc    127620
     cgcaggtaac tatgtactgg gttttacgat caccacatag tcaatcaacg cagtcagctt    127680
     ttggatggaa tctgttttta tttctagcgg gcggttggca gtcaatttga tagaagtgat    127740
     agtgatcaac gaatcggtcg gggaaactga tcaagcatca cgatgttgag ggccagatat    127800
     gaaccctcat tgagatatat atttcaatca gacacctctt ccacttgcgt tgaaagtctc    127860
     agggactcgg caaacagcat tgtagacctt agagtcacca aaaaaagaag ttcggaaaga    127920
     aaagggaaaa gaaaagaaaa gaaaagaaaa gtatcttcga agattggtca caaattcaaa    127980
     aattgagtgt tgacaacgtt tggccaagct tcaacgggtt gatgggttga gcaaccgcac    128040
     atcctaccgt gacctcgctt tctgcagtct agtctaggcg gacagaccca cagctcaaca    128100
     caaaccaaca ctaaagcgag gcaagaaaca aaggtccatg attcctaggg atggaattgt    128160
     aggagctttt cggtgatcca acgttgagtc gctcatagat gcgctgatca aaagcaagag    128220
     atatgagcat gtcattgtcg attatatttc tcccacaagc ctcaattaag agggccgtga    128280
     aggattcaac agtcaaccaa cgttgcttga ccaactcagc atccctttct ctcagcacca    128340
     ctcttactcg cctctcgctg ggcatctaaa ggcatcaaga atgtcgctgc aaaaagttgc    128400
     ggtaaaagaa gacgtgggtt tcaacaggcc tcgattaaga aatgtgtcct tcaacacttc    128460
     caaccaggtc ggtgagtgac agaagccgaa aagcctataa atacgtcctc cacccctgca    128520
     attgctctac tatttattca cttgattctg caaagtcgag caggcttgtt tctgacgcac    128580
     tcgataagtt ctcccctttg atcgagtact ggaatttata ccgtactgac atttatagta    128640
     tacatcgtgg accagcaaac cagacagttc ctgtacttta agagacgtag ttccaagcag    128700
     attcactgtc ccatttatgc cagccgatcg gagatacgag atttggatta gctagtcaag    128760
     gcgtctatgc gaagacgtct ctgctatagc tgatctacta tcgcggctct ggttgaccac    128820
     aaatttgaag tgcaactgct cacactgtag gtatatgggc ccacaaatcc ttgaaactgc    128880
     actgacccga aagacgcggg acagccaggt ccgtagaggt tcgaacacaa tgcaccagag    128940
     caagggccac tcttcatacc tggtcttgac catcagaaaa tgtgagttat ggaattccac    129000
     gctggtctac tggctaataa ttgacagtga acctttggga gctcaccaga gtggctctga    129060
     taaccctgca ctaccgtcag tgctccacgc aaagccatgg cttacacact attcctagcc    129120
     ccgtcgcttc gaacaatgca tcatgtccta ggtggaagat cgcaaactaa gatagcaagt    129180
     caacaacagg gtgcggagat tcaagtgcaa gcttagtcgc atcgaagctt gacgcgtccg    129240
     tccttcctga tagtgagtta tcgcgtcttc ttctgcgccg gtccgattaa atataccaag    129300
     ccttgtgccc aaagtcacga caccactgac accttcacgc tattatagga gcaccccatc    129360
     atcgacggtg aaatatactg tggcgagtgg cctattcccc cagatcgaag ataagactaa    129420
     ggtggcggcc gacgagcgtg ctccatcgcg tcttccgccc tcgtccccac cgccttcgca    129480
     ctattgtgga gtcctgaacc tctggcatcg cgacacattc atccaccatg gaagtgcaat    129540
     gtttatcgca agtgggttcg taacgggcat ttactgtctc aacagatcgt cttgagcacc    129600
     ccagcgcggc tttttaagcg atagccgatt gcgatgagct cgaatgcgac atgccatggc    129660
     tagtgactgc attgcaaagt gttgtagttc agaggtatga attgacttat tatttcagag    129720
     ggatacatga gcctgtatat acaataatga gccaagttga tttccaatca actaggtcgt    129780
     attatagaca cttcggagct aattccgact gagcggcttg gttcctgatc tgcaccagcc    129840
     tcatatcaca acacaaagag ctgtaagtga tctagttgtg aagccgatat gaccattgtg    129900
     caaaataatt gtccagtctc aagcgcacct tttgtcggtt tccatgaaca ggtacgccac    129960
     gacaactcgt ccaagtagat caatccttga tgacttggat cgtacaacag gagaacaccc    130020
     tcatttctgc cactcgagtc gaatgccacg cggacaaatg tcctgcctgc tcgagctcgc    130080
     ctataccgat acggtcgcat gctgcctgtc tcttccacat gactactacc gtcaataagt    130140
     caccagaaga ttcgtaccga cctcggcttc tatctccctt tctccctata gattctgtgt    130200
     atcaggccat tgttcaatct gtctacctga tacaagatga aacctgatga gcgtatatca    130260
     ctacctagct catacctata gttttagtca ttgaatcctt caaatccctt caagcggcgt    130320
     atgcagctgg cgttgaatgt gtggtattat cctcggctgg catttggtgt ccatccaagc    130380
     ctgcaaatct gaagataccg tggaatgatg atgttctgtc ttgcatcatg gcagatgagc    130440
     tgtacctccg cagacagcca ggcggttacc agaagtctcc attctcatag catactagtt    130500
     gacgttggtc atctcaggta caaaccgata ggttagaccg gggcacaggc aaaacaatga    130560
     gagctcactg ctcaagaatc acttggggca tacaggaagc tgtatcatga aggctgtcaa    130620
     agtgttatgg ggcacccagt tggatatgtg gtgcgtagag ttgattatta tgcacgcatt    130680
     ttcctatcca agctgaagca ctatgtgcaa agaccgtata ccctgggtgc cactgcagct    130740
     gcaggttagt caatttggct gcgcgtattc tttatccgtt catatcgtct cctacatatc    130800
     acgcacctgt caggtaagcc ggattctcta catccgctag ctcgactgtt ctttgagatt    130860
     gaatcatata tatattcgtc gagctcaccg cgctgtggag gacacgtggg aatgccactg    130920
     ttcgaacagg cagccactgt aaagactttg ttgtccgaaa caacatcgaa tcagagtggt    130980
     tgtgggacct cttggactcc tagatcctgg aacaaagttt ctaccgttaa tcaacactta    131040
     aaaacgctcg gcggagctcc gaatctcttg caatagccaa cgttcctttc aatggacaaa    131100
     tacatccaat aaaaagcgtt ttgttgcttc ggcgacgcgg tgagtggctt ctaggaagaa    131160
     tagcgccctc gcagccacgt tagaacacgg aagtataatt gatccgggcc gatatgggaa    131220
     ctcggaagtt ggtcacctcc tgcatacctt atccatcgga gcccaagtgt cactagccca    131280
     cgtgtccagt gagtccccgt cgatatcgca gctgttctta ttttgcaatt taccgattat    131340
     tcattgctta gatttagttg ttatgcctcc cgaaagaaca acgaggaggt gccttcgtac    131400
     tggaaggcca aaaagggtga aaattgaacc ctcggtctca tcagagagca gtggagagga    131460
     tatacccttt gcacccagct cagaagcctc agttagatca gaagcctcag ctactgctct    131520
     tgatcccgac tctgatgata acgatggtga taacgtatcg gaggcaaccg ttcttacgtc    131580
     aactcggccg ggaggaataa gccatcaaca gaagacgatc aagagagagt tatgggaact    131640
     tcttgattct tggttgaaca aaaatcccgg tgaaatgcca ccgtgtgctt tgcgtgccga    131700
     ttacaaccca ataaataccc tctgaaatcc cgaaatccgt cattggtaca catgacgaac    131760
     ggaacttcga ctattatgtc tttcgtgtgc atatccagcg gaaaggaagc ccggttgact    131820
     tttgtatctt gatgctggaa gctggggacg accaattttt cgttatgaag cgcggcggtc    131880
     gacgttataa gcatttattc aaatggctag gaggaaatac aataaaatca caatccaccg    131940
     ccaaggttga gttcaaggat gccccagaga cgagaacgat ccaacctaaa ccacgcgcaa    132000
     aaagaaccag agagcccaag cctcaatact cagccggtga gtttcccatt gcatcgcaac    132060
     caatgcctct aatcttggaa tgtagactct actccttcca cgagatgtcg attcattaac    132120
     ggcaccagat accgcccatg ggatctaact atttcatcta cagtcaagga tgtctttagc    132180
     gaagcagata aattctatgg caaggagcca cggggtcttc tataccgggt agaaggagaa    132240
     acagatgatc ttctaccctg tatgctgaaa aacaccgaag attttgaaat ctttaaacta    132300
     tgcatactac gggactgccc tgggctagtt gattttttgc cctacgactg atattgaacc    132360
     tgctattgca ttattgattg tttgtttacg tatattatgc acttggtttt tatgtctttc    132420
     gtgactaaac accccttctc gccaggaaag gccgattgct acacagggtt ctgataggtg    132480
     gactttctgt tcggggatga atacgtagcg gacaaaaact gcaagaccat ggtcaatgaa    132540
     ttgttcgaga cacctttgat aggatcatgt tgtcttgatt aacttagata ataggatttg    132600
     caccgagccg gtcccgtact gatcccccgc acaaacgcaa agccccgcat aagatggcaa    132660
     gtgactgctg gctgggcacc aaaacatcac attgtgaatg gccgatcaat atatcccacg    132720
     gaaaactcaa catcatccgg cagttgagca acttgagccc ccatttcact gatcggttgt    132780
     tcagaatgat tggtttatca gtgacgtgat gcaggtgagt aaatgagcga ggctgacatc    132840
     gttagtcggg taaatttccc gaggattcgg ctcggtcagg cctttcactt tgaatgcgaa    132900
     ttgatgcatg agtaacaagg gtatgtattc cccgtgacaa ctcaatttca ttcttcgaca    132960
     ggtacgcttg tcggaggagg cttccaagtt tcccaagagc cagaatcagt ggtagacaag    133020
     caaatccaac tcacatagta ttaacaaatg ttgtaatttg gaggtattac ctgtgttgta    133080
     ttctagatgg agaggtgagg ctatatatac agcacggagc caaattgatt ggaaatcaac    133140
     ttggttgtct ccgtagacac ctcggagcta ataccgacgg tgcggcttgc ttcctggtct    133200
     gcaccagcct catatcacaa gaataattac catatacgcg gggcggccgg ggatagccgc    133260
     aaagccttta aagttggtcc ttctatatat gccctctgga aacgttacac cgcctctaca    133320
     gctgaagatt gatggtactg ggagtacaaa gtaccatggt gagcttctgg ccgccggtag    133380
     taacgccggt gatagaattc tgtgctctag agacaccagc gaacgcgtct atgaaaataa    133440
     tggacttcat ggtaggaata gaatgcaaga caatattgac gaagtgatgt agtgatcagg    133500
     gctgctcaaa actgccgtcc tcccacgtac cacgttgact gagatatgag gaaaacttgt    133560
     tcttccagat ttaagaggct taagcgaaag cttcatgaat tcaaatattc tttctcagta    133620
     tcaatcggtc aaagcctctc ccagagatac ctaccgccgc ttctgacgtg gaacgcacac    133680
     gacgaacagc cgccccatcc ccagaggcgt ccccaaacga agctaataga taaaaaaaaa    133740
     tgggacgaag gcacctcgat cagtttggac ccactaccgc gaacattcac aaagcagact    133800
     gaaactaatc actttttagt tccacaacct gtcgggtcgt cgtgcgagaa caaagagcct    133860
     tcaggtggcc actccgtgcg aaactcgttc gtgagggaag ttgagagatc gcactgcgtg    133920
     ggcgagtaac aaactttcgt cattcgtaaa tcccatcgat tgtactggat gcatgtaaca    133980
     acagcacaat tgaagccgct tgtcgtctgg agaacgtccg gatcctcgat cttcacggcc    134040
     cgggccaact aggggtatgt cgctagttga cttcttcgcc aggcggcctc ttccggcttc    134100
     gagaaagact cattggggca aacggctgtg gcgacattgt gggacatgct ggttggccat    134160
     tgatgtacca atagagccga atcatgaggt tccgagtgaa ccgtgacatc tttggcttga    134220
     tccaacatgt tcaaaaatcg ggtggcccac acttttgacc gacagcgacg acgtctgcac    134280
     tcaaagcaaa gtaactgctt tgcagccgag gaaaattcct gcgctagtgg atacactaac    134340
     agagggccct ggagcagctg aaagcacaat actccattta tccgggagtc aagcggcaca    134400
     gtgttttgac aatgattccc gtcatctccc gcccatatgc accgctcacg gtgcaaggga    134460
     tcacccaata tttggcccaa tacccattgt agatgagcag gattgcagga catgatggaa    134520
     aagtaattgt ataagcgtct cgggtcaatc gtgaggtttg catgtaatca gctggagaag    134580
     atattattgt tgagctgata tctgtgatca tgtagggtga ttataatata tataagtttt    134640
     agaaagtata tagtaggttt ttcatcttgc tctttcgcca gtacatgccc gcgcagaaga    134700
     ggtgtgattt agctagttcc cagcactcct cattttgttc ctgaaaagcg gttattattt    134760
     cctgggagct ctagccacat ttgtcgggat acgcgcgagg catacacaat gagtgaagat    134820
     acgatatatg cgggactgac atggcatctg ggttcactgg gatgtatacg cgactttccc    134880
     cttacaactg ggcctcaaga tccgagaaac cggcaaataa ttcatatagc agtgtagcaa    134940
     tagagcctag gggacccact ttaagggcga acataccaca tgtcgtatcc agagccttcg    135000
     gccttgaagc tcatgaacca acacgctctt cgaaataccc ctgggcgact cgcagtttgc    135060
     cagctatgcc attccgcgaa tgcatggtcc aaatacacgg cccactgaat ccaaagagtg    135120
     aaccagaatg agacatcctt cttgcaaccc actgatcagc ggtgtagcgg tagacactgc    135180
     atcgcagtgc attcttcgac attatgactg tttcagggga gaatttccac gtcagcagcc    135240
     atgacacgat gtaagtatag atccaatgat gaaggcatat aaagctggcg agggaacgct    135300
     gcggagattg cgcaatatca atacccattc gaatcatttt ctgcctttgc catcagccca    135360
     atgtcttctg tacttccttg gaacccattt gctgtctgcg ggatccctta tggtgatcct    135420
     gtgtcctgtt gcggggtgac gaagaaaggc gagccgtgca aaaactctgt caaggttcaa    135480
     gacaccaaaa tcggccatca aaagttgacc actctcgcca gagagccgtt tgacttgtca    135540
     actttgcagt caaagctcta tgatattgct agagtcttcc tctgcgcgag atggcaccgt    135600
     caacggcagg ccgaccaagt tggccagcgg tggtatgaag cagccatccg caaccaggcg    135660
     cgagagccgc atggctctag agttgccgct ccatccattg cgcatccggg ccagcgtcag    135720
     atgtcgtcag tctccagcag tcgccctgca ccaggcaaca ccgacaggtc acctcacggg    135780
     ctcagacaag acccacctgt gcggctgtca accaaccccg agccagtgca gccatttaat    135840
     ccatttgtca cttccgcaat gctgcggacg aacagtgttc catggcatgt ttcgccggct    135900
     caacccgcta tcctgacatc ggtcgctaac atctgggctg gcgtccaaga tttgacgctc    135960
     aaggatctca ccctgagcga ccaggtcgac gacatccact gtgtattttg tcttgccgag    136020
     gatgaggatc ttgcaaatga gagtgtgatc ttgcgctgtc agtgcaaggc gctttcccat    136080
     ctggcctgcg cggaagagtg gctggagaaa cgaagtgcag gttttgggac gtcatgctgt    136140
     gtgtggtaag tagggctggt tccagttatg caatatccaa gatgctgatt aatacagtcg    136200
     aaatgaaggg cctttagacg ccttggttcg cccaatacga gtccaatcgt cggatgccga    136260
     gacacgtcat ttccactcgg caagtgaatc atctcccgaa ggagaacttg ccactatcat    136320
     ggagtcatca ccgaatgacc cgagtcggag tcagctgcga cagcgctcag tgggacccca    136380
     agggagatca gtcgagcgga gtgtggagaa tggcccccgt cgctcggcta ggctaggagc    136440
     tcatctacca cgaggccctt ctacgtctgc accaccccgc cggtcagcac gactaaactc    136500
     cactcgaagg tgatcttagt ttacagcgga ggtgtgacgg gaatgagaaa ttagcgaagc    136560
     gactgtcaat cacgcgtgaa gacacgtgac cagacgcacc gtattcggcc cagcaacata    136620
     gagcatagcc gcggtatgga gttttagagc aagttgagaa atgatgcaaa taaagttctg    136680
     gatgttcaga ctcgcagagc accaaaacca cgcgattttt tcatctttgc aagtactaga    136740
     tgccaatgca cccccaaaac ctgttggcag tttcgcttaa ttttggatat tttttagatc    136800
     gaaaccgtgc gggcagataa tagttctttt tgttcatacc taacggtggt ggccaaagaa    136860
     ctgtagacat ggttttacct cagtggagcc gtgtcgcgtc aagacggaga ttgtggccga    136920
     agaaaacaca tctcgggccg gcaagggact ctggaaaact tctgtgctgg ttatattgac    136980
     tctgggattt aatatgtaga ccctgggaaa ctcaaaagca tttctaggag ctgtatatcc    137040
     cctgggaaat acaccttagc tcctggggct tttaccaatc tccaggaaaa tgaagatcta    137100
     ctcctgggat cttgcctcta cgctcctggc tggatacaga ctggccctgg gaacatattg    137160
     gttagttctg ggagccgttg cactcctagg accatacttc tggattctag agtcaatagc    137220
     ttgccttctg aggtcgcgga acgctctcac aagacaccct caccagacct ccgcacaaac    137280
     ctgagacatt cgaccactcc cagaaggctt agtcatagcc ccaggaaccg cacctgaggt    137340
     tccaggagtg ggtgaggctg ccaacaggaa tatgacttta attcctcgaa gtgggagtaa    137400
     aaggccccag aagttacgtc ggggttcctg gggtctattt gacccctagg agctgcttat    137460
     atgctcccag aaaccgcact aaagtttccg ggagcgagag aactcccagg gccaagacat    137520
     gcgttcccag ggctgataaa gctgctaaca ggaacgtaac ttattttgtg agtggggatg    137580
     gagagtgtac aagttacgta cgatttcctg gggccatatg attcctgggc ggctcacatg    137640
     ttccagggtc aatttctgaa gagtttacgg caatcaaggt agatggatat ttatacagag    137700
     caaatcgtca gccatcacct ttcgtttaca tcaagccatt cggaatactg ctccaatgtt    137760
     ggccaatatc ggccggctag tcacgtcaag cgacgaacat gctttgattc caattaggaa    137820
     attcaacatc taaatcatct ccgcaactca gcagtatgtc tattcctttc caagacccta    137880
     tccgtcgcac ctctaatgtc tatggactcc accgtcattc ttcgaaaatc atcatataat    137940
     tctgcaattg ttcttattcg taaatcctct ctgcctctcc gtcacagccc taccatatta    138000
     ggctgttgga cccgtctttt tgactgtttt gtagctcggt ccgtgttctc tgctagtgac    138060
     ctcgtaagcc gcatacggga aaatgcacga gggacataat gatcactaga gatccgaaag    138120
     cggcctggcc aaaggatcca taatacataa tcttgtaata tggaatgtgg ctcctggcaa    138180
     aaaactcgaa ggatgtctga aagccgtgga cgcggctggc aatccagccc cccaatgaga    138240
     gcacgatcat gctcacgacg atttgaatgc aaccgtagta aaaccgagcg gcgcagttct    138300
     cttgtagcca ctttgggtag attacaaggt caaacccgaa gatggagaac agggctgaga    138360
     ccagggccgc aatcaccatg ccatcaacga tgtagtccat gaggttttcg aatgtgatgt    138420
     ccaaaataga atcgctcggg gtcacgaggt cggattcagc acggtctcgc aggaggaccg    138480
     caaagtgtac agtgactgag ctgagaccgg caagggctag ccaagtgatg gtaagggaaa    138540
     taatgacgtg gcgcattcga atcatggcgg tggcagtagt tggagagatt ttgtgcccgc    138600
     aagaacggat ttattgagtg taaagaattg aggcaggtgt cgctcaaggg aacaaagtaa    138660
     agacccggag gtagaaagat gaagcaggtc attatccccg ggtactgtaa agtttatgtg    138720
     ctacgtgata ttcacgtaaa tgctgcccta acaaaggatg gcccagcaga tagtgagccg    138780
     tgccaggtgc cattttcatg ctttgctgca tcagtggtaa tccttatagg cgcctcctcg    138840
     gtaagagtgt ttcaagtaga agcactattt ctatcttgaa agcgtcggcc acggaaaccg    138900
     cctccggtac ttggtagtaa agcagctcta ggaatcactt gtgtattcct aggatttaca    138960
     gtcctgtgaa acgggccagt atattatcat ctccagggcg ggtgatgaat tgtgcataat    139020
     atatttcaag ccgtatagag tttgccttgg tctttttgcg atacctcacc ttgctctact    139080
     cgaggaacat attctttgct gttgatcaac aaactaccga aaacttccac aggaagacaa    139140
     atcccactat tttttgtcgt tactgttgag cttactttat ttttacttta ttattttgcc    139200
     agctagctta agacctgctt ccaacaataa ggcaaccctt actgttcgtt gaatcaaggc    139260
     agccgatcaa gaatcaattt tgaactggaa tcaaaccaaa ccccgctagt gagtagttaa    139320
     ctaacataac tcaagtagat attttctatg ggcgtaaaac atacatgctg ttggtgttca    139380
     gtggatttca tgttcaacgt tgatgtaaac gttgacatca actttctgac accaatcatc    139440
     acccgtgcat tgccaaaggt ggctatctga gaatactcag caaatccatc gaatgtataa    139500
     gcacgatact accaaactct cgtggacgag accaaaggcc ctaatactct tggaagcata    139560
     aacaagtctc cgctagtcgt ccttttactg tggcttttca tgcggctgaa tcatgatgca    139620
     ataacagtcc ccgaggtata ggaaatgcat ctcccttccg catgtttcta tccgtggcca    139680
     actccagtct ggcagccaga ttgctcccag gaatgcactt ccaatctatt ggttgttcgg    139740
     gcaacacgtg gatacgtcaa ctggattgaa acttcgttga tcgcaatggt ctacgtaccg    139800
     tggttgaggc aataaatcaa cgttagcagt cctcctgggg gctggcgctg ataatggtag    139860
     cccacgaaaa cttgatagtg ggtatatctt gtatggtgga tatcaaacat ttaaaagctt    139920
     atgattgtcc tatagtggat gctattatac ccttcctttg ctccaataac ttgccagtgc    139980
     agcatcatca ctagaaagac caagcaacta tcatggatca caaggtgttg caggtaccaa    140040
     agaggtccaa tatcccagac acagaagaac acaatggact tacatggcaa actggtaccg    140100
     ttatcttaga tccctttctc gagaaactac tcggctaaca atatatccca tggaggcaat    140160
     gaatcggcta aaaacttccg tcgggccgtt ggtcagttta gccacaggga tcgcggccac    140220
     acaagccaag ttttacaact gtctgttgac cagtccacta gctccgtatc tacagaggta    140280
     gccacttccg ttgctagctc gagggactat atgatgccca aaagcgccat aaaggcagaa    140340
     tgtcaagatc taccccccct gaacgtgaga aagagagtag ccgactcctc aaccttccca    140400
     cgaaagcaac gtcgacactc atcctctgcc tctcaagtac aaggcggctc acaaggggcg    140460
     tatcaagaaa tatatcgaaa gagaccccga accctcacaa caattagtag aaaattggct    140520
     atcgatacaa ttcaatatct acaaacgcta tccgaccgca tcttgatctc cgacaccatc    140580
     ttccccaggg agtgggccac gatgcatctc gccacacaat tgctacagag caggtacgaa    140640
     gatatcgttg cgagggaaga gatagaatcg gacaccgcgt ccgagtgtac tttctcaccg    140700
     aaacagccag taaagaagtg cccgaagtgt gctgctgcgg atgaggagga gctgtatgat    140760
     tgaggctact cattcttatt cttttgttgg ctattctttt agaataactg gtattttcga    140820
     aatgaacgag caaatatagt gttttgtaac taagagtcgg tatttaaaaa catgctaagc    140880
     ttcaagccta tcagtcgatg aaaaaggaac cttcgggtgc ggagaagtgt cgaacgattt    140940
     cctgagggtg agtagaccac tcgacaagca aaaataaata tataagccag ctgcatcttg    141000
     atccccaatc aatgcaatat cgattaaagg agtcagaaag tacatgtatg taccagaaaa    141060
     atcagaactg gaattaggaa gcaatatcat tcttcacaag tcgaattgcc tcgaatatca    141120
     aaaccagtca gtctttggga tattctaccc gctttgctcg tagagatgca attgtttgtg    141180
     ctgtattgtc taaagaactg gaacattttt gccgttctgt tctgttaatc ggctcatgac    141240
     tgctggtcct tataactaga cgactttgcg attattctgt gtctaaatgt cagcatatta    141300
     attcagatga gccaatatgg caccgcttgt agactataat aggctctaac atcggtagga    141360
     caggaaattc tagagcgccg agacctaaat cagctgtgcc agtaggcctc aggttcttgc    141420
     ccgcagccct tataattcag ccacagatga gaatagccgt ggttcctgtc ccggctccgg    141480
     ctgaagatgt tggcagacgg acctgtagat ctctgagagt tcatttggac agtcggtcca    141540
     ttgttccaat ccagccgggc agtcttttct ggcgggacga ggtatggttc cggttgttga    141600
     gcgagatggt gaatccactc tcagagatcc ggagagaagt acatggcggt actggatgag    141660
     ctccgcgaag gtggtcggtt agttgcgctc ctctgtctgt ctgccttcgt ctctcttttg    141720
     cctgcagata aagatgtttg tagtcctggg gtcagccatt gatgtgcagt aaataagaag    141780
     gcgatacttt gtgacgaggc cggatcggcg gttcaggtcg cattcgctgt gctgatctaa    141840
     tattagaaat taattgctgc cacggcttaa ctatgtgact taacaagcgc caagaaatcc    141900
     aggcagctac acccagcccc cagcgcaaat gatttttgaa ccgttatcaa ccagacacta    141960
     cattaaaggc tcgctcctta gtgagcaccc ctctcatttg ctaactaacc cctctcaact    142020
     cgttacccac ctcaacttgc tacatcctcc actccctcgg catttagagc ggcttcagct    142080
     tatcatgatt accacggata tattgattag ggccaatgga aaggatgagc ccattttcgt    142140
     cgttttgggg ctcatctctt caatgtcccc gtacatagca ccgagaaaaa catgacacgc    142200
     cccttaagta tgaagatatt catagtcgta cagatcgttc caaaagggtg tatcatgtga    142260
     cctaagccta cgatgaactt ccccagccgt attccagccg aagaagccag ccatctccca    142320
     atcaatgagg cccacaatct tgtcatcgtc aactatacag ttggaatcag taaagtcgtt    142380
     gtgcatgaag ctcatgtccg gatcgttatt ggagtccgag aagaggatat cgcactccag    142440
     gggttggatg cggccgttgt tgcgaatgtt ggggtcgggc acgacgtaag accgaatctg    142500
     gcatctatct gtaggcttga ctgagtgcag ctgcacaagt atctcccgtg cttgttgttt    142560
     gaaggactcc atctgggatt gcgaaaggta tggccatgca acggccaacg caacgcctgg    142620
     gagtctttcc tggacaagta tgtggcggcc atttatctaa ttggatgtaa gtatactcat    142680
     gggcataatc aaacagccag agaaagtacc ttgccagcaa agtaaatctc gggtactcga    142740
     acatctttta agacattctt cgcaatagca attgcctgga tctcgttggc gtcggcatac    142800
     gagtagtcga tctccgtata cctggcgccc ccaggcgcgt gaaggtggct cgactttaca    142860
     atgatactgc caagagcgaa cacgtcgcgg ccaccctcat cagccggata tattctaaca    142920
     gtctgattgc aaaggtcaac aactgaagcc cagtattcca atgagtctcg ggactcagag    142980
     ttgatgtgct ggcgatcaat gcggaagtcg tccggtttgg gatggtatcg accgtagagc    143040
     ggcaaatccg catatagatc agaaggaggt atgtcatcgg ggtccgtcgc atatggattc    143100
     atttttgagg caggatgtgt gatgaattaa tcattctggg tgaagcccaa aaaagatatt    143160
     aatactttct tttgtccaga ccgaaaggaa tgatgaatgc tgacctataa atctgccaag    143220
     attcagcggt gtggatagga tagaatagat ggaattataa aagcaaaatg ggtaaaatga    143280
     gtggaatggg cggaatggat gaaggcgagg atctagcgct cggttatggt gggaccgggc    143340
     tctgttctta gcggcaggaa atggagcacc tgacccggaa ccatgactac aatatattcg    143400
     gcattttttc cctcccgaaa acaacctcca aatacagagc tcctgatgga ctaattatag    143460
     ttagaatatt ctaatgcaga agtagagtct caaggagaaa tcgtagaaaa gaaatctaaa    143520
     ttccaaggcc cggtgccgac ctttttacag tcaagagcgc ttctggggaa ttatagatcc    143580
     aatagcgata gatgttcaat tggcatccta aatctgcaga atgagtgtgc tttgaaaatg    143640
     atactccagc tgacgtaact actagttcca atcaaataac taaaacccaa ggttatcctc    143700
     cgggacaaat atggcttcct gtctccgcat gcgtgtgtac tgaaagactg aagaaagtag    143760
     gaaagacaag gcgtggcgta taacgtgcat tgcaactctt tgccaaagat gacttgggac    143820
     tcagcatctt caactctagt aagtattgca cttggcataa aaaaggcatg aggacacggg    143880
     gtgcctcctt gactcacagg ttgcttgtct agattaaatg gaatgaacga agcaggggag    143940
     ctttatcgtc atcaatattg gagagagtgg aaagctcatc ctgcgccttg ggctggggag    144000
     ggttggaggg gggtttcgga gcaggagcac caggacagat gtgtgcccca ccgccggttt    144060
     taatccaccc gtcgcagaca gagcatcgct tagccatgtt tgtttgaagt gggaggaagt    144120
     tttggacggc tggggctgga gtattgtcgg cttcgcgagg atgtagatgg taacaaagat    144180
     aacaaagcgt taaagacgac atataggctc ggcctttata taggtgttcc tgatgcgcct    144240
     gccttaggct tctacgggct gcataactag ttaactagtt aacttaactg accaattagc    144300
     tagttaatga atgggaagat aaatgtgatg gcagtacagt atcaaagtgc gcgggccttg    144360
     gacttacagg ctcttctggg gccaatcaga aagagtataa atgccaaggc cctccccgaa    144420
     ctgctcactc cggcggtctg acctattttg cccaatccat agtgtccaag gcggccatag    144480
     ccactcaagt atttttgtga tccaagagat tgccctcggt aggcgtgaga cggccccggc    144540
     ggcaaaggat gctttttcat tcgctgacgg aaatacgcct tgcacagata atcaccacga    144600
     atggagatct tggtgagcgt ttgcatagcg gttgcttcct ggtctgcctt tagtgtttgt    144660
     tggttttgag attggcaccc ctgtttctct tggaaattat gaatatccca cttcccctgg    144720
     tcacgccttt cctctctgca tgcaccattg ccataaatag tctaaatttt ctagatgaat    144780
     gacggtcccg agttaaaacc agaaatacca aattgatgat atctgttgtg ggctatagta    144840
     tccattcttg tcttagcagg agacccatcc tccctccttc cctccaccca gggaaatccg    144900
     attcagtcca atctagtccg cgtggacaag attgcactga atttgaatgg cgtgcgcttt    144960
     gacctgctct tccccctaaa gtagcttgta ggactttcat ctttacaacc aaaaatcttt    145020
     acatttctgc caggtctgtg cgtgttccag taaagtagta aagattgcgt gtgaaattct    145080
     caactcaagt cattatcttg cgggaccggc ggttgtgaat gacgttactg gagacagccc    145140
     agaacagggt gataacccaa gccgaaactt ccagcgaggg cttcagcgat atagatcagg    145200
     atgtcgatgc agtcttatcc gagcacccgc tcgaagctct cccaccctta tcatcccaag    145260
     gaaccgctaa agatttccat gtactatcta ttctctttta cctttacata tttacaaaat    145320
     atagtcgatg tcttggatat cgcgcaggac cataggagag tatatgtcta ccctgcctcg    145380
     cccgatcttc ttcaatgcca agatctattt ggtgcccaga gcctttgtta taagtcatct    145440
     tccaattcac ctacaccaat taattacgct gggggaaatg ggaagcttag aagcagcggt    145500
     ttctggttgc gtgagtcgtt taatattcag atttcacatc agcctactca accaactggt    145560
     cataatctga tctcttcatc ccgaatcatg accgaagaca caatcgccgt ggtatgtggg    145620
     ctcatatttc ctgtcttatt attgttttag atcggtcttt tgtgacaacg ggaggattct    145680
     gacatatgtt gccacgaggt gcagcgatgg ttggcgtttt taactaatca tccgttttgg    145740
     gtcgcgggag ctggctggtg tttagggcga ccatagtacc acggaacacc gtggagttct    145800
     cgggcagacg aacatacgac ggatttcaat gaatatatat ttttcggtct ctcagcatcc    145860
     agttacggaa gaaaaatgct acccaggtgc atgagccctc aaatcgacta gttaacccag    145920
     gcccggggct cgctacttca cttttgagtt ggttgcatac atgaaaggca gccttttgga    145980
     taggcttatt ggcagaacac actctagaaa agagaatacc actgacgtta gatgcacaat    146040
     caagggaagc tcattctggt ggcttgcttc aagtcaggag gttcattgaa gatcttctcg    146100
     tagatctcaa cgagaattcg agcatcggcg cggagggttg gagatatgtt ttcgctttga    146160
     atgagaaagc ctatggtgcg gacgaggagg cgcttgagtt gctctggctc gacaagctcc    146220
     tttagaccgg agtaaagccc atgtcactag acatacgcgc catgctcgga gcgcgagcgg    146280
     acatgtttag catagagggg ggcaattgtt ggaatgcagg tgattccatt gaattctggc    146340
     tgatcggacc gacgcgagca cctgtatggc cgtaatgcag tacatgatag agaaggggtc    146400
     ggtggataat ataccgggca ccgtaatact tggcacgcat gcgggcagcg ttgatttcgt    146460
     ttgccggcgg atcactttcg tcccattgca tgctgtcggg tagactttca cgccagcggt    146520
     cgaggttcag gctgagagcc tcttgaacgg tgaacgacca tcgtgtctgg tcttgctttt    146580
     caaccttgta taagtctgta tgttctcggt tcaagatttt gcgtagatgg atttgggcag    146640
     aataaaacag catcgtcatc gtctctggtg cggtgagatt atttggtaga aacatcgtcc    146700
     attttccttt cggaataggt atccgacctt ccgaacggga gatgccactc gctggaatat    146760
     ccagctctgc gagaagatca ctctccagtt gcagacaggt ccagtacgca aaatcataca    146820
     agtccttcgt agctccctca ttgagttgct cataccgctt ggttctcaca aggatctggc    146880
     aagcccttga tgcctgagaa atccaactgt ggctctggaa agggtgggcc aactggccgg    146940
     cataaagtcc agcaagcaag ctgcactgaa catgttctag ctcatttcca ccctgcagat    147000
     ggcccagtat tgcggttgca tatccataga gagtcaagcc agggatagcc tggtagttcc    147060
     ttgtgttccc ttgtttatcc cgtgtgtttg tgatatctct ccttgacagg ccttccatac    147120
     cattgttgga tgaactgttt ggaaaagctt ggcgggctga ctgggctggc acactataga    147180
     gaggattaga aagcgacatt tgcacggccg ctgagtcaga gttggcgggg ggaagcacac    147240
     cattagcatc ggtgacgtat gccgtaatta aaggcggcgg agaatgtaat ggtgtcagcg    147300
     gagcaggaat atgctgattg aggtagtcaa tcttcttgtc catgatgggc ccagggagag    147360
     gggcaggagc ttcgcaaatg gccccgatgg ccaggcacag cagaattaag gcagtatcaa    147420
     tgtttttacc gactcgtggc cgtagcgggt tggagacagt ctccataaac tcgccacgca    147480
     cactcaggtc ttcatttgac tgcctctttt tggctggagg cggaccatca cgagccggtc    147540
     gagcgtagct ggaaacagag cttggtggtg agttattgac tcgacaatag ctttcgataa    147600
     agttatcgac cttaatccca agttcacctt ccataaggaa tgggtggagc ttgaacatgt    147660
     gcttgaagta gctatcatag tagcgcctag cagtcgtagc atccagatcc aagtttccaa    147720
     attcgtcgat gtcaatattg acgtgctgtc ctgcaccgtt cacaccgggt tgagcacctt    147780
     tagactcgca atccattggt aattgactgt tatcggcagt gtatgagatc tcgccttggc    147840
     cgtatatact gatgagaccg tgctcttctt ccaaccgcat gacatagtcc tcatcatatc    147900
     tttcagggtg tatcagcctc ttgattgacg gccacattaa tagcttgtga gctgcagtgg    147960
     tgtgctctac tgggatggag agctctccct cggcctcctt ctggcggtac ctggggtcca    148020
     cggctccaag ctgttggcca aatttcgaac cgctcacatc ctgggtctga ggcatcgctg    148080
     ctttgagagg tgagtcctgc ctgatgactg gtgatggtgg gagggccgga tgttcttgca    148140
     cagtcggatg tgtatgtcta acctcttcag ctaggttgaa acccacttgc tcttgcattt    148200
     gatcttgcca ttttgcaaaa tgctcatcga tgcggttggc tcgctcctcc atgcgagtct    148260
     ctatctggga gagtcgatcc aataccagct gagtagtctt ctcttctttg tgcaacggca    148320
     cctctttgta gacacagcca aggttgttta ctttgcagtg gctgcaacat ggtcgtccct    148380
     cgtcacactt tgcttttcga gctcgacatt gatcgcaagc ctatatggtt agagtgtacg    148440
     tgggaaaatc tcccgaaaca agccctcctt ctactagctt aacatacctg cgtagctcga    148500
     tgtgccttcc tttgaggtgc tttaagcacc tctctttggt aagaaccctg actgtacccg    148560
     acatggggcg tatcttttgc catttgggta acacgaattg tggaatctga gacaggaggc    148620
     agacttctcg aaacggataa atgttcagcg ttgttgaccc gatttaggag cgggtagccc    148680
     atgtgagcgc gaaacccagg tgagccctcg tacggcgcgc cctttgttga ctgttggaag    148740
     ttttggtaag gaactggaac ttgggcagaa tctgtgggcg caggtatagg taggccatgt    148800
     tcattcagtc gaccatacat gctttctgat ggaacttcac ggttacgcat aaaggggtat    148860
     cttggtcgct gcagcggact cataggcgca tggtgccctt ccggagagga aatgcgatcc    148920
     attgcaaatg gagagtccag gtgtgtggag gtgtttgaag ctgccaggta cggccgtttt    148980
     gttgtattgt tgcaactaac cagggccctt gacatggggt atgtcttggg cgtttactgt    149040
     tgcgaattaa tctctcttcg taaattggga ctcaaaccga cgtgacactt ttggttggaa    149100
     tcagaaaaga tatagtcaat gagaggaaat cagtggatta gttgtgggtg taaactcggc    149160
     aggagtctct ttcctgacca ggtggtccga ggcttccttc ctcacatcct tggctacact    149220
     ggctgggctt tactactggt gggtgccatc cctggctgct tagccaatta ccatacccgt    149280
     aggtacgggg gttgatcccg ctatatgaac cgcacattct ccatccacac tttatttgct    149340
     gcacaagctc gcaacaattg tcaatgtgac aggttgaaat atgaactggt agcttgctat    149400
     ggagcggggg atcctagctt tgagggcgtg cccggtaggg catggtttaa attttgtacc    149460
     acccttagtg accatgaaat cgaccaagaa tagttgataa taagcggcga agccgagaat    149520
     caaccccaaa aagacatttc cagttcttaa ccaaagtcac tttaattcca gtatggagaa    149580
     caactcaaag cggaagtatt gctatcgtgg attggatgta ggtaaacgtt ttggcggtcg    149640
     tgttgttttg ggaacccatc cccgggagga gggtataaaa tctgaaccat accgtatagg    149700
     gaaatctccc aatgccagaa tcactcgccc cttttgcgag ctacagattc cagttcatca    149760
     gttttacatg accataattc attgagtgtt tttcacgaac agcaatggaa gggaaatccg    149820
     ggtttcctgg gaagtatcta acggtggcca actaccattg gacagcttgg aggggattcg    149880
     cttcatatcg agggtagtcc tgtctgatcc attgaacttg ccgatcgtaa catatatttg    149940
     actccgaaag ttcatatccc ttgtgatatc ccctcccaga atgatcaacc cgactggctc    150000
     cagcatccgc gttccattcc gcaccattct cgaccatccc ataacacagc aatactaact    150060
     tgaggccccc aatcggatcc acgggctcat acgtagaatc cttcgcggag cttaaggctc    150120
     tgaattacac atattcactc tttctgccgc agaaatattc caaaaactcg tccctactca    150180
     tatcgccgtt cacaaacttg gcgcccgggc taatattgcc gtagcctgcg cgaacggggg    150240
     ccttctcttc tgcgccatct tgcgtatttc gatcctataa ggatgagtac cttgacggga    150300
     caggtaaata atccgggaaa cgttaacata cggtgccgac gccctcgtcg ggcgattcag    150360
     gtcccccaag aaccggtgta ctgtccatct gcttcgcccg ttctctaggt ttgaacaccg    150420
     tcgatgcatt tctgtcgttc aaacttgatc cgtcgtcgaa ggtacaatgg gatcgaacgt    150480
     atggtggtgt ggcctatggg ccttgccatt agaggtcaca tttgtggaaa gtattaattg    150540
     tgagccgtgg aagtacctga attggttttg tcctcatcga ctgatcaacc tcagagactg    150600
     gataagaaga ctagcgatat cacctctcag taagcaactc tacacgactg acaatgatag    150660
     atctggcagg gccatactct atgatcctga tttggtagcg attgcgcggt cccttcccca    150720
     ggttttggtg cctcccgatc ggagtgttga ttagtccgac gaggcaactc tttctttaag    150780
     taagtgatag ccataatatg gatagtgctc tctgaaacga gaatagtctg agtattcagc    150840
     gctgataccg ttcaacggaa gaattatgaa gaaggtggag gtgaaaggag accagcccct    150900
     tttggatcca gtttagcact ataataatcc accggtgcga cgtaataaca ttgtcatgaa    150960
     actttcagta aatttactgg gtgggcctat atggaaagag ctagctgctg gggcgtcaat    151020
     atgaccgtca gcgtaaaaga ctcaggccga tgcccacggg ccttccagct atcgggagcc    151080
     agtggccaat aatggccaag ccatcatgcg ctcaccctaa ataaacgaat gacggatcta    151140
     acgaataaat tgtatccatg gtgcgattct aaacaagaaa tgaggtggac tcgggaaggt    151200
     gaaagcaaca attttcctac ctgtggcatt tattgcgtat gctagactcc aaccgtaagg    151260
     gtggtacacc taccgtttgt acgcacacag aaacagctac taaactggcc aggtcatagt    151320
     gggccaagga ggtgggcaaa gagaaggttc agatcaaaaa ctgaggtcgg tccgggtcac    151380
     atcggaacaa cgacgtgagg caagagcgcc tatcatgatc caccagaccc ttgcaagcct    151440
     ggttcctaga atccttccgc gaggtaaatg cagccaatgc gtgctcaaag ccataagcca    151500
     gatttgtgtc atgcacagga aaacagacta ccccttggga tctgcgcgcg cattctgccc    151560
     tcaaggcagc aagcaacctc attcctactc atcaagcctg ctccatgaac ctctataagg    151620
     gtaactcaac ctcatgagct actgacattt taggttggtt cgttattgca gcattatgtc    151680
     tcatgcgcga aacccattta atgtcactgg cttcgtgttc acggaagtcc caacaaacta    151740
     ttccattggc ccgacataca atccactacc ttcggagata ggttcaggaa gttctctcca    151800
     tccgagcgtt ccacaatcgg aaagctggtt aacaggatct gtgtcttcaa ccgtgactcc    151860
     ctctccccgg tcaagttcgt catatcgaga aataagacct cggccagcac cagcattgcc    151920
     tcaaccggaa accaaaaatg aagaaaagca acgagtccgg aggcccacca aaaagacatg    151980
     tcgaagggta tatgggctta ctggcacgcc caaccaacca gcccggcgta atgaaacgag    152040
     gtctgcatgg ctggttcccc gaacattcgt cacattggct aagtaggctc tttcagcgca    152100
     gcaaaaacac cggccatgac gagtcacgat tcagccactc agccccagag ctctcgctca    152160
     tgcgattacc ctccatataa tcaagaaagc cctccccaag cttccgtcga ggctctccag    152220
     aaagccttga aggctcaagt cttacactca ctcagggttt tgcgcaagat tgctatggac    152280
     caccaagcac ttaacctggt ccctgagata atagatggtt gggtggcgga tattgaagga    152340
     gttgatgcaa aaaatatccc aattgcatcc agcatggcgg cgcagatgtc tgttccgttc    152400
     gaacgattca ccattctcac gaaatgcatc acagctacgg gcccgatgca acagcttact    152460
     atcaggcacc agacaaccga gttgctgaaa tatatattga gttatgcgga ggagtactac    152520
     ttagtccagg gttcgcaggt ctatcttgat attggtagat ggatagaaag actcaccaag    152580
     acaaacatga ggaagtgaaa tgttattatc cagagggtct ggaatattcc attgctcttt    152640
     ctatggaatt atgtgtagga tgttatcttc ttcttgtacc agatcccttt tcaatattat    152700
     gggaatatgt tctgtaatgt cacatatccg agagtcccag tgccgctatc cccgtattag    152760
     accggtgaaa gcttctgtcc tttccctgag atgggtgtca agggagtatt ccaatgtttt    152820
     accgattgct cacctcggta cttccatcgt cctttgcgac acagaatgaa tatcatcatg    152880
     tccagctagt attattccag tgttatgggt gtcttgttgg ttccatcatt gtggtcgcta    152940
     gctggttggg atgcacgggt gcgttgagaa gtttcttgta aaaccgatcc ctaaggcctc    153000
     ctctgggctt tgggaactgg agtataattg ctccataggt gcatcattgg tacctcttca    153060
     tcatgtggca cacgggattg gaccgattct ttgacggaaa gatcctgcag gaaaaacgta    153120
     aatcattagc ctatggcttc cactgcgaat aatgattccg aggttcaaca gagggtttgt    153180
     gttactacct ctatgaaaat cctgttattg catccgtggc tttttgaaac ggccgcctcc    153240
     tgtttgtttg accaaaatcg acagcggata gggaacaaat cttcgtctac aaaaagtcat    153300
     cagcaagccc taaagttgtg cgactgggcc tacaaccact gaatggatgt gggaaagggg    153360
     aaggggaaag gggatgctgg agggggaggc gcggtgaata ggaagccgac atttcttggg    153420
     cacatcttcg atctagacgg gatgcttaat ctattaaccc acggtgagcc atttgtcagt    153480
     atttcattct cttgctgcac ggtgaagatg cagtagcata agagtatctg agaagttgcg    153540
     ttgctcactt gcctgtgata ttattcgtgc acggccgttg atgggaaatg tcaaaaaggg    153600
     ctttcgatta tgtatttgtc tgcccgtata aacaaattag ttcaatttcc tctagttgga    153660
     tacctgttgt tgagtcctgg gtgcgaggcg tgagcttgag gagtgaagag atgaaccgct    153720
     gactgtcagt tttaggtaag tcagactcac ctaggccacc tactttccac ccttcctaga    153780
     gcatccgacc atcctagccc tgcttgcctc atgccaccat tagtcctcct accatcagat    153840
     acaatccatc cccggttgca atgtcacttc tgcacagttt ctcttctgct atgctcaaac    153900
     ttactgaatc atccaacttc cccccgacta aagctcttcg cacctgagtc ggaaacgtct    153960
     tagccatcaa gatatgacat cttactccga actttggctg gactggtttg gaatttatcg    154020
     tttgattgca atttgctggt ccaaatgata attgtcaggc ccatcgaact actgacctct    154080
     cccatctatc tcttagtcaa acgatcgctt gtctttgctc gaccaagatg ccgtatagca    154140
     caagggtcag cacactaccc caatgttata tgcttcgaac aaagggatcc tctacacgac    154200
     tggtgagatg gtttggtgtg tcttgaaggc gctagtcaga cctccggcca gaagccctgc    154260
     ggctccagtg ggagattgct cgcgcgcgtt gctgatccaa gataagttga ggtaagcccc    154320
     ctctgtttaa tctgtcacat atcgtaccat actctgactc tatctcttct gctcaaaagg    154380
     atgtcgctga ataccctcag ctggaatcta cgcctatcca atcttcaatc acggtctatg    154440
     attcttgccc gcagaatatc cataccccac aaagcccgtt cctttatcct cctactgcgc    154500
     tgggtggtag agccactccg cgatgatacg actgaaaaat cgaaggggag ggcgaagggc    154560
     taaatcgcca acctctcgaa acacgtcatt ccagaggttg atcttccaag gtccaccgtg    154620
     gacttagcta actatggtac tatgggagaa gtaccctatc acacactgca cgaagatggt    154680
     aacaaaagca ttgacgggga agctgaagag tttattccat ggctaaaccg agatttgggc    154740
     agagccacag atatccgaca tgttgctggt aagccagaaa gcacattttc tcatgtcgat    154800
     attgtcaact ccttcaaatg tgcatcccga ggcattcctc tgacctgact gctttggttt    154860
     tcatatctct cttctccata tcaccatttg acttatgtga ccttgctgac ggagttttag    154920
     ttaggcactt catagctgtc agtccgggtt aggccgatag ctatcctggg ttagggatac    154980
     atgccataaa ttgaatacta cccgactgtg cggctagatg atgcaattat ctgccatata    155040
     ctgaaaacta ggatatttct tcggaacgca aaagacccga agacagaata ttgtgttctt    155100
     atggtgagcg gaaatcatca caacaaggac aagtttcaat ttgctacaac atctccctat    155160
     gctgagctga ctttgcatcc tcacccacct catgttcctg acgctaggac cgaccatgag    155220
     gtacacgctt cacacactct ctcgtccagc aacgctatat tccagaaaac ttgacttcac    155280
     tatcaatcga ttgatcccca gtgtagattt tctgtgacac attttattgg cgccacgaag    155340
     atctgccgca tttttgcacc tctcaaggaa gcgctcactg gccgcagtgc gaggtacagt    155400
     actgcaggga taaggaatta ggtggacacc tggccatggt cctcacgctg ggagctggtt    155460
     gtagtttgga acagccgaaa tagcgactgt tccaccgact cgccgcgctg tttaaactcg    155520
     cgaatatgag gctggaggaa cggaataccg ggatgctgat tgtagcgctg gcggtatgaa    155580
     acgaaattgt ggctcgggtc tatgagaggc aggattttgg gcggtatcaa atgggcagga    155640
     gtaacagtac gactggcggc gaaatcacgg aatatattag atccgatcgc aatatatttg    155700
     cgaaggccgt ctagtatagc cattagagaa taatagttcc gtgcttcata aagctcctgt    155760
     gagaaaacaa attaagcttc agtttcttgg tatgttcaat agttggagtc ctcaccaatg    155820
     tacaggcctg aaggtacgga actaggtgtg gcagtccaga gcagcattcc aacacagaat    155880
     tgcttagcct ttgccaatag atgagggcct ccgaaagcat agcatcctct tctatatgtg    155940
     ttcctcgtga cagcccatca aataaacact tatccgtctg cgtcaaggcc cctgcgaaat    156000
     cggtcgctga tgaagaaagg cagtcttcca acaaaggaag agaagtttcg aagggctcga    156060
     accaattcat ctggtcagag tgtctgtatg ctttctggaa acgtacagca aggacactga    156120
     gaaccttgaa tatagttgat aggctggagg aatggttttt gaacagttgc tgaattgggg    156180
     ctgcgatgaa tgcaaatcct ggggtatcat gcgaaggcat atcgtgcttg ccctctggct    156240
     gaatggccat gatacactgg gaaaaggcgt gatgtgcaaa cggacttcga gcccgaagat    156300
     gctatgtgaa ccaattagct agtttccctt gatcttggtc tttctttgtg ggcttaatgg    156360
     atcacccacc ttctctattt tcagataaag caaaagttcc tccgggtaca tgcgtagatg    156420
     atctacaaga agagcatata acgaagtatg ctgctgcaag aaccactcta ctgacacggc    156480
     tttgtatcca agagcggagc gtacgatatc ctcaaaagcg atctgctgga aatgaaaata    156540
     actctctgcc tcaatttcta gagcgattga tctggggtcc gatgaacccc ctgatatagt    156600
     gggaatccag ttccatgtaa gtaatggacg ttgcgggata ctagatcgaa gcaggatctc    156660
     ttccactttc tgcagatgtg gcaactctga taggcggcaa tgatcgtacg gctttgacgc    156720
     cgcaaagagg cattcattga tgaactgcat attacgactc agcagtgagc ttcgcggaga    156780
     agattcgtcg tggaatagcc caaatcggat cgcttgactg atatcattga aatcgtaagc    156840
     ccatagcata ttgattgcct catcttccca ccatcgatat gcgacgcaaa attgaggaat    156900
     cgccacacta ggacgaaaga caaacgggaa tggccccata tccacgggag gagcgctgct    156960
     tgttgggttt tgcatcattt gagacaaagt cggcagcact gagttggtga tatcctggag    157020
     gtgggggata tgtcggcaga cccaggacag agagagttcc atccatctat ctaaatttta    157080
     atttaccgct agtcaccttc tgtgtaggag tggtctgtat cggaaatacc gtcgacgacc    157140
     acacttgggc ctggttgtag cgttttgaca atatggcgag acgggagggg gacggggagt    157200
     tagccaaggc aaagcccacg ccccaaagtt agctagcatg ccgtgttgaa ccaatattcc    157260
     aaatagttgc cctcatatct ggttcccatt agcacattgg ggatggtatg aaatctgaac    157320
     catacccgat tgggaatatc ctccaagcca gaattcctcc gccccttgcg acctttgatt    157380
     tttctcaagc accataattc cttgcatctg ggtttcacgt attataatag aagggaaact    157440
     caagattgtt ggataggtat tttgcccgca gcatgtcgag atctaggacc gatacgcttt    157500
     gcccgcccca cgaggggtgt tatcaagtga cttgcaggcc tatgtgaaaa ccgaaaattt    157560
     gtaccaactg tgtgcctgta tctaaattga caagtgggtt tagtccgcgc ctaaggaatg    157620
     taggatttca tgtggagttg atagggttgt gttattcctg gtgtagacca tggagatgct    157680
     ggtgagaaaa acatggatat tagggggctc aacggttagt tactaaaacc aacgaatggg    157740
     aaaagcggcc cacgtattat tatgttgaga ttgtcaaggc attcatgttg ttgagcattt    157800
     tgggtcccac tgttattgtt ataaggcctc ttaaagtgaa tatcttgaca ccatttggat    157860
     cataaggtag cctgtatttc cgcacatttt ggaagcatag ccattacgtc attcaacatg    157920
     tcagggaatc attcatacaa agtcaacgtt agtggcacgc tcatgggaaa taatggctga    157980
     tttctctgcg ggcggtcgat tttgagatac cctctgttat tgtaaaagct ctggggcagt    158040
     ggctacttca tcaacccagg gaagatcttc gaaggtatcc gcaaacatga acactagacc    158100
     tggaatgcac tttctttgtc ctggattgaa tatcgctacc cagggcttaa tcttggctaa    158160
     cgtggtgatc aacgcgcatg caaattacga tgttgaagta tatcaaagca gccctcaggg    158220
     tgctgatggt cagtttggtt aatttagatc tcacttcctc tagcgagggc catgacatat    158280
     gcctccatgt ggatcattca agcggttctt ctttttctag cttttaaaac acgtagactt    158340
     ccgcgagcat catcacagct agcgctaggc cgcttcctca gccatacttt cccaaagcac    158400
     cggggctaga aatttacaca gtcatgcgaa catctccttt tgaaagacct cgtaatggcg    158460
     ctaagtgggc tccatttggc tcgtaattgg atgcaagcag gggttggtat gtgaccttgt    158520
     aatattgaac cttgggttat gcactagact ggttgcgttg gaaaagacat gttctgtagg    158580
     cggagcgaat gttcgggcca aagattcgag gtcgatccgg gcaacatcgg aacatccggt    158640
     ttaggcaaaa gccctcctat cggatatcca ctggcccctt acgagattgt cccccgatgt    158700
     ctcacttgcg atgggcacat ttaataccgc attacaagcc agaaggaaga atctatttcc    158760
     tgcgaaagaa cacagataac gccttcgaat tctttcgacg tgaaggcaga atataaacta    158820
     cttcctactc gtcaggtgtg ttgcgtggaa ttgctcacag gtaaccaaac tcttggccta    158880
     cttggggaat caagactcta accaaactta tgattgcgac agtatgtacc atgacggaaa    158940
     ctcatccagt gggagctcaa cctacccact cgtgggagtc ccaatagact acccgtatgg    159000
     cctgacaccc gctccgttga tggactcggc tcctgcagta gaccaagcga gtgatgtttg    159060
     ttggagcttt gagcaagcac aaaactggac gataacacgt gcgtcgccaa cagtcacact    159120
     gtctcccctc cctatttcga gatatcgaga gataagacct cgaccgctgc acgaatcagc    159180
     gtccactttg cctccggtgc agcctggcaa agaagaacag cacagccagt accggaaatt    159240
     ggggagaaga aagcactcga agagccacag acagtcagat caaggatacc tcaagaagac    159300
     agccaggagc gcgattcgaa cggcatctga ggttacggat acgaccaaga agcaagtgag    159360
     agttggcaga atgaggtatg tacggctgca ctctctaact ggtaacccgg gaaatggcta    159420
     agtcgcctat tacagcagag cgaaaccccc gaaagctcca gggggagatt cagccacaca    159480
     aggcccacgc cgtcggtcgc ctgattgctc ttcaaatcat ccggaggata gcccccaagc    159540
     ttcagtaggg gctcttcaga gagccttgaa ggcccaggta ttacaatcac tcgaggtttt    159600
     gcgtgagatc gccaaggagt tccgcgcctt caacttgggg cttgagacga ttgatgactg    159660
     ggtggcagag atcaaggaag ttgacgaaac attgatcccc gtcccatcaa gcaccgcggt    159720
     cttacaggta catgttcctt tcgaaaagct aagctttatc ctcacgaaat gtattacagc    159780
     ttcaggacgc atgcgagact ttattgtcag ggaccaggca ctggagttgt tgaaatatat    159840
     acagacctat gcggaggagt atcacctgtt taaaaacctg cgggtccatc ttgacattgg    159900
     taggtatata gaaagactca gccaaggcaa agataatgag atgggcaaat gatgttgttc    159960
     tcccgggagg tcgcgcatag tcttttgctg tataccagtc attttctgcc taatttgctt    160020
     caaaattgag aagatctctc tggagtgttc attgcatgtc acatactgaa gatgcttaat    160080
     gccgttctgt cagtaatgaa gactctaccg cagccattct gctgttccag accttcccac    160140
     cacctgcctt ttgatgtaca ggatacatat cgcgcagtcc aacaactcta ggcccaggag    160200
     catgcttgta tataattgct ccgtcgtggc tgcccgcaat ctttgggaat gcggaggcct    160260
     tcaaccttgc tttcgcatcc caaatactac catgccgatg aacatgagta tacttgttgc    160320
     tcggtttcgt tgttcgtatg gtagagggtc tgttaagccg gtccgattcg ctcacgtaaa    160380
     taacctgcta gaattccaag accattagct cgaggctttc actttaggta cgcactgaga    160440
     gactcgacag actggtttcg ttatgtcttc attggacagg ttccacctca tctggcgctc    160500
     ggtatagggc cctcttgtgc acgtttggca attgggtaga aagacatctc gtcgtgtaca    160560
     gataataagt ccggcaaagc ttggagatat gtaagaaatg gcaagcaaga ctcggggaat    160620
     aataggaaga gaacgtgcct tgagagtttt cactcaccgt caatcaagaa aattcttgat    160680
     ttcctcctcc acagcaagcc ttgtatcagg attatatttg ctggctgtac aggcaagtcg    160740
     tagtagccta aaaggatccc agaagttcct cgcttgcata ggatgtggtc cgtggacggc    160800
     agatgctgaa tggtgctttc tgttagcatg tggactcttc aaaggaacaa aaggtctcga    160860
     tctgttaggg ttgtgataag ttgttgaata ctccagggaa tgcgaggaag gaaggtcggg    160920
     gaaaggagaa atgtatcact gactgtctgt tttaggtaag gcagatttgg gtcctctgcc    160980
     ctccacctta ccctgacgcg agcacctgag tattctggcc ttccttgtct ccttccacca    161040
     ccagttcccc ctaattagat aaaatccatg cccgtgttac aatttcactt tctctcggta    161100
     tccttcccgg taagtgcgaa ctcaccgaat cctccaaacc tgtacctacc aagggtcttc    161160
     gggctcaagc ctgaaggcta cccacctcga tcctttgcta ccaaacgttc ctaaggctga    161220
     ttcgaatcgc aatctagtat tgtactaccc tagttcgaac aatagcaatc ttcagaccga    161280
     ccagactcct gcctccccca tccatccttc cgtcacacga acgtcgcgca tgattgctcg    161340
     actttgttcg accaaactcc tgtataaggc tagtttcagc acacgatatc aacataccgt    161400
     tctttacttc tccaccaccg gtgcggatta ttgcgtgagc tctaagggct agtctgacca    161460
     ggtcagaagc gcagcgaccg cggcgtaaca actctcgagc atttttgctt taaggtgaga    161520
     cgtcggaaca agctgtcgca tactggacac tggttccatc tcttcttatc aaaagacagt    161580
     ccctaaatac ccttggccga atgctacact agtcaaacct gccaggtgcg tatggccgtt    161640
     tatgagatgt cctcgcagca aacgaccgct agtaacgact tcacacaggg agacaataga    161700
     cgataaacgc tttaaacttg tctggagcct agggataatt cgtcttcatg ttaggcaaaa    161760
     attacagaca gtcttagatt gtgataagag gtgggaaatt catacattca gtttccggaa    161820
     caagctcaaa caattgagct tatattaatc gccggagtaa catatatata gggcattcag    161880
     acacgactaa gcccatcctc tgtcctctta ctcaatccgg gtcacctgct cgttttgcgt    161940
     acttgcctgt catttggcag tggtttctcg atgacacaac ggagaaactg gaagacccta    162000
     acatcggctg ccttgcaaac gccctatttt gccggatttt ccttccatga cttaacaact    162060
     ctgatacggc aagattattg atgatacgaa ggatggtcta cattgcatat catgcagaaa    162120
     ccatgttttc tttcaacaat ctggataatc tatgctttgc tgatactaaa gacaatgaca    162180
     gcggaatcat gccactggat atggaacaag aatacgttaa tgattttgat gctgaccggg    162240
     agatcttggg aggcggctcc taattttggt acatatctgg tgtcctgcag tctgctttaa    162300
     agtatattag agcaacacag agacagctgc atgaaccttt gtttcccata aagactactt    162360
     ccgtttccca gaaaattctc ttaagaatgt ttctgtatcc atccctccgt gaacacaaaa    162420
     ggttcgtcca gtgttggaat tatggaagac catcgtatca tccatagaac ctgcacatcc    162480
     ggtaatcacc atgcttgcgc catcaaaagt gcagtctttg aagatatacg tcctttgctt    162540
     tcttttattg atatcggttg gttcctcacg agggaagacg gtggctgatg caagtcaata    162600
     cccgagtcat attctcaaat gacgcatcat agatacctga gtgtctctgt tcatcagaac    162660
     tggaatgacg atgactggat agctttcctt cgtgcttgaa tggttgcttg agtggaaagg    162720
     aagaagggtt agtaaaagct gctgtaagag cgaaggcact ctcgcccgag ctttagtttc    162780
     agacttacct gatcccgaat acacttcatg gatgtcgaca ttggctttct ggtatcatcc    162840
     tgatagcttt ggggctgggg cttgtagatc tgttagaaac agtaatctct ggaaaaggaa    162900
     agcctagcgc aagggtatga taccaattct attctctcca gatgtggccg ggtagaccca    162960
     ttgagccatg tcgaagtatc atctgaatcg gggttgcctt gagataatgc accttgacag    163020
     ccgcctttca accatctgat ggtcatcttg gaagttgggg ctttccagaa atatcgtaaa    163080
     gaccccctgg aatgagacaa tgaagtgaag tcagaatgtg agggggaacg gatcagccat    163140
     gacctagacg gtaaattacc cctagtaatg tctacgtact gtatggcttg gcactccatg    163200
     ccctaaatga tggtaatatt tctccgtagg tatccagcgt tggcacatat gccatacggc    163260
     tggccgtgga aagaagtgcg gatctatcag gttgagggag ggccctggga agatcagcca    163320
     ctaaggcctt ttttatggta gcggtataat tcagaccttg accccgacat cagctgcgcc    163380
     tacctcggac caagtacagt atcatagttt ggttcaccta ctcttgcgtc caatggaaat    163440
     gagagcatga gaggaagagt agttagagga ccacgctagt acaatggccc gagagtgaga    163500
     agaagcgcca caaccctttc cccaaacccc tcgataaacc tactcccagg aaaaatgcga    163560
     cgatcatttc tattactacc caccataaat atattgttca ttatgaaaga agaacctgag    163620
     gtggtgttgt ccccaaatac ttggggaagc tcccgggtcc atcggaaaac ctgcactctg    163680
     gatcaaatgg gtacttgaaa tcaggtcaca ttcggtcagg ggactacagt aacacaagct    163740
     catgtgcctc accacattac atttcggata acccccagtg gtggacgaca tattctcgag    163800
     gcttgctatc aaaaatacga cttcatctac aaagacctcc gtcagcaacc tttttggcag    163860
     caccacacgc gccctcccgc ttttctccaa cttcgcccct ccaatatcac gcgaaatgac    163920
     ctgcacccaa taaatacgga cccactgcgg aaggcgccga ggagacactg cactgcaata    163980
     taagtcttgg aaacgtcgaa taagtgaaat gtcctggaag agccaacggc taccacaagt    164040
     gcgaggtggt gattcaaagt cggcccagct aggggcggtg tcaacatggt cttttcagct    164100
     agatccggga gagaagggca gtatttccga gttgcttggt atgtactgta attctgacac    164160
     aacgaccata atatcagctc catccttcag caaaatacgg attccgacct cgtctttagc    164220
     agtcaagaac cttcctttgc cgcttgacca ttcccacctt caagcaacct cgcaagtccg    164280
     gcgatgaatc gcgcgctcca aatgggccac tgatgctgtt gaagcgcttt tttccctttg    164340
     gccaacccat cgccacgacg tgcagtcctc cttttatttg cacaataacc agttcacatg    164400
     tacgagtgcg gccctgagtt agcggtacgt aaatttcaac agaggcagtt tatatttgtt    164460
     tcgccgcaca tgttgaaata gcccaagttc tgtagtcact gagcattgta tagggttacc    164520
     cggtgaatgg ccttcgatcc atgaaaggca aggcctcaag gttcagagat ggattttgga    164580
     tcataagcgc caccgtgtcg ccgtcattgt ccgaatgagg aacgacagct cgaacagctg    164640
     cggtcacgac atagtttgta tgaatgatat aacacgaatc gctcccgagg cccagggttc    164700
     tcctaccact aatagctgat attaatataa ggatccccat cactgccatg ctatagcacc    164760
     atgcaaaatc gctggatacc aattatagca atacttttcc aggtaaagtg atctatagac    164820
     atgaaccatt agatctattg ccttctcacg ttagatgaag ttggatgcgt atacaatatg    164880
     agtatgaacg ctatatatta ttgaacgaga agtctttagc tctgttgcct cctcataaac    164940
     caaccattca tggcccaaca ctaggaatcc tgcccagaat tttcatcata tttggaccaa    165000
     gagcgcattg tgttcaaatc tttgagccat tcttgcctga ggatcacgtg tttgtgccag    165060
     ataaacagct ttttctcttc cttggatatt gtgcgggatg gggacattgt ttccttgcac    165120
     taatgagcgg aagaaaaatc ttgcatatcc gaaattgaaa gctgcttttg gttctgcgaa    165180
     tttgaactct tagatcgact atgttcctag aaaagggact cgtcactcac tggtgagtaa    165240
     actttgatca ctgttggagg gctgaacggt aaatcgcctg agggagaggt gaaaagcagc    165300
     ccacgcagta cgattaccag ggcgttcaaa tctgttcaga atgttgagga ttttggggac    165360
     tcttattgta cggtctctga tgttccgtag acacgatttg cattagaacc atcataaagg    165420
     tgcccggtat cgacgcactt ttgtgcattc taccctctcg catcattgat tatctcaggg    165480
     ctatatagcc aacgcaaaat tcttcatgca atattgccgc tccctgcacg ctcatggcca    165540
     actgtccaat aaagttgcaa gccgccccgc ttatacatgc tccttgagaa attgcccagc    165600
     tttagccggc agtatgttcc aagaacgtga caaacatctc ctcctacttt cgccggctca    165660
     gcctttgccg cagcttgacc agcatgatgg cccaagtctc ccaaaggtca acccgctgac    165720
     cccacctgcc actcctgtcc ctaattggga ctcacgagtc cttccaagct ggcccgacgc    165780
     gggtcacggc atatggatgc ccaataaacg cgatactaca tctctagaac gcgaatgccg    165840
     ggtagaccat ggggtaatcc aggcctacca ctgtttccca ggttctcatt accatgcacc    165900
     aatgccgcta agggaccatg gcatgcccag tctctgtctc tctcaaaaaa cagacggttc    165960
     acttgagtcg acctccatac cttacttgcc aacattggta ccctgccact tgagacaaat    166020
     cgactcatcc ccaatgtcca atgtagttga acgtgcgccg ggggctggtt cctcgacaat    166080
     gcaaactgtc aaccctgcgt tggtatttcc agcttcggca actgcttctg agaccttgga    166140
     tattacatca agtctccccg cggcccccga agttgggccc ataccctcgg gtaccggtat    166200
     cgtctctact tggattcttg accagccaca agagaagtcc caggtactcc atggcaccac    166260
     tatgtgtgta aatgaccatt cgcttcttga ctgtcacgtt aatagcaggc agcataatca    166320
     caacttgaac cttgagaacc agcaatctga tatgcacgag cggaggttca aatgcaaaat    166380
     cgttggctgc agaatgggct tcaagcgtga ggaccacctc gagcgtcaca caaggagtca    166440
     cttgaaagaa aagccatatg tttgctgggt gcctggatgc caccgtacct tttcacgccg    166500
     cgacaatctc aaagtccatt gtacgaagac acatacgaga cgcggtggtc gcaaccgtta    166560
     tgttgctacc ctcgacgagg cgagccccga ctacgatcca gagttccgtg gccagctgtc    166620
     atttgatgga cgcccactca ggttcttagc tcctattagc tctgttcctg aagctaagcc    166680
     tctgcaaccg tgaatttggg cgataataaa catcaaggac atattttgcc gacaacaagt    166740
     aggcgggact aggtggccaa agtaaaccac cgtcatccaa gctcagctgc ttacgatgcg    166800
     actagggaag aacctgcggc gcaatgccct gtccccctgt caacaatcaa gtttctcgtc    166860
     cattgtttct gcctaccgga gagctttgtc gtcaaacatg ccgaatgtat acaactttag    166920
     gaaacacaac gatagcccca atagtgcaaa ggtggcacct aaataatacc actgcccctg    166980
     ccattcctgg attcgtcaat ttgtagatta tcttcgggca aattactggt caagggagtg    167040
     cagctcgttt aaaactgttt gacaacatat ccgaggctcg tcaataatca cacatagttg    167100
     caatctgctc cgtactataa atcaaggtac tcggttaaaa ttctgatact acgtttgact    167160
     aggttgtctt ccatgatttt tcggccatgg ctgctatatt acatgacaca ttcctccgct    167220
     agcgacctct cacgagcatc tttcgatatc catcagcatg gccaaatcac cccgagagga    167280
     ttgattccag accttgagca cgctgatcag cctttcttga gtctgctcta aagcttcttc    167340
     caaggaaacc agacgagata gctgctcatc aggacgaagc tggaaaccgt cccgctgttt    167400
     gttcaattta gtggcagctt ccttcggagg tctgtcattt tcgtctggta tctcgctctc    167460
     ggagtgtttc ggctcacatg aggcccatag acgtcggaag agtcccacgg gtcgagccgc    167520
     ttggaaggcg agtttcgggt catcgcgatc gagatctgcc agtgtctcca atatgggttg    167580
     aaaatgctcg atcgtcagag gtttctttag gatttcttcc tgctgctgcg agagaatgta    167640
     gtgattagcc acagtataga aagtgtcatc gcttagctta caagtggggg ttcggagtcg    167700
     gaaacggcct gcggataggc ctcatcactc tccctaggca tttcactcgg ctgacggtct    167760
     gccctatctt ggtccggtag ttgttctgag gaatccatcc tgttcacttg caaaatctca    167820
     gcgcccaaaa acatataatt accagctggc gctggtctct cttatagcct tcccagaatc    167880
     aaacagttag ttcaacactg tgacaaaggt ggctagctcg tccaacacaa ccatgacccg    167940
     acacatgaca gagacctcct tgaacatcta ttttcaacgt tcggacttga tataaccgat    168000
     ttctttcttt ggtcgacttt ctatttttca ttgtaccatc tgctcaccat tggacgaaac    168060
     ctgagggaca aagaaagaaa aaaaaaaagg aattcctccg cttattgtat ggtgactgta    168120
     gtgatattaa gaaattctcg aggccattac ctccccatag ttttgcaact gttgaatatc    168180
     aataacctcc gaaagcttac cgctagtaag gggtattccg gagatacgta atcctttccc    168240
     acagctcttc gcactatttc acccactcgt ctactcagaa actgcctctt gcatttaggc    168300
     tgtaggctgt ttcttggtgc tgtggagtgt ggtcgttgag tcaacgttag tgcatcaacc    168360
     gtttacaata acgtcctttc ttcaccgaat gtgtcgctta agccagtgga aatataatcc    168420
     agacatatgt acaggcctca catttgttag tcaccctcac aaatatgctt ttacacttga    168480
     cgcccactag aagcttgcaa atagcaagac aagcgggaag gtctataact acctctttta    168540
     cctatgtttt tgctcaagac aactgcatga ctgatccgca gccagcagat attatatcca    168600
     aggcgtcaga atgattttgt cccaagttga ttaaccgcgg gcatcttaat atagtgggaa    168660
     ggtgagaaga tgaatattgt agaggttaaa aaaacgcgga acatatagta ttaatcactg    168720
     gaatgtccgt tatacattgt gctagtcgtg tctttgcaat ctcgcatagt ggagatagac    168780
     cagaggaaac ggcttgctcc tgttgtttta gggaagtaca ttactgaagg aagtaaaaca    168840
     actgacaaaa agatgcacgc taacccatct tatataggtg acgtggaaag agaacgtccg    168900
     cgattttgag acgttggtgt tgtgatatga ggctggtgca gatcaggaag caagccgcgc    168960
     catcggaatt agctccgaaa tgtctataca gacaaacaag ttgattgtaa atcaacttgg    169020
     ctccgtgttg tatatataac ctcatcttgc cctctagaat aaaacacgat ttatacctct    169080
     gaaccacaac agttggtcca ccgcccgcct actcagatat ccccacaaca ttccatatct    169140
     cacatcaata atcaaatttc attcgtctct gcttgcggct accgactaac tctagcttga    169200
     tgtaaatgtt tagtgaaggc gggtaagagc agattccagc ctgttctgga acgtgttgag    169260
     cctcaacagc tgcatgaaga aagcatacca tgtgacttga acatgtttga ctaactagac    169320
     gccgccttcg gtaattttct gctggaccca ctttttgtgg ttggcattcc ctccaaccac    169380
     cgcatcgtca ctccgccagg atcgtctatt atccaccaag gtctccccgg acagccgggt    169440
     ggtctgctca ggaacagcat atgcagcggg catggcagtc ggtgtccgac cgggctcaaa    169500
     ctctctttca atattggagg gttctgttgg cgctgcgatc gtgtcggatg tgccattgat    169560
     gaaagggtca ccgtccggcc accacttgca ggagggttct agatcaaggt caatcaatcg    169620
     ccaatcacca ctcgctctgg aatggacgat gcggtgtact gctgcgcgtg tccatttgct    169680
     tgcgcacact aatacctgtt agcctggcaa aaccgaagtg cataaacggg agagcgctca    169740
     tacccgaaac cgcggtcgtt ccgcctctac catccattag acgtgccatc tccttgccga    169800
     tattgatgac atgaaaatgg tatttcaggc gcgtgcaatt gcggttgcgg taacgagtcc    169860
     ggtccactgg ctgggtatct aggatatgta tagtgaattg cagaatctgc taccgagtta    169920
     gcccgaccta ttgtaggagc gatagcgaga agaaagattt actcacatca aaaccccggt    169980
     catctcggtg tctatgctcg ggacaatcgt ttcggtcaaa catacggtcg agctcgagga    170040
     tttgcgagat ttcatccccc acccaatggg ggtggtctat tccggtaagc acaggacacc    170100
     gcaaagcatc cgagcataat gggggactca ctgaaatgtt tcagcctaac ttgccacagg    170160
     acttctagcc ttcgcacagt gtttctccgg cttcggcttt cttgaacgag atgtcgtatg    170220
     aacggcaacg cgcggaagag tccaatgtct tcaagtacaa agacgatggt cccgtactgg    170280
     ccaaggttag gtggatgccc atacggaccc agcacgcata ccggaaaatg gatcgtcgag    170340
     tacgtcgcat gatccgcggc ttgtgcaatc cttccagtca ctcctggtcg gggtcgggtc    170400
     actatgcgta atgtgcgagt ggtctgtggt cctggcgcat tctgcactgt gtccactgaa    170460
     gctacgtaga atgagggaag ctgcaagaaa gacctcaccc ctgagcgtgg catccagagc    170520
     tggacatact gccccggttg agcctcccac cccatgggaa ctgcaatatc aagccataaa    170580
     agctggttga aagaccgcgc gagtgcccgt ctagaggtga tgcgccacga cctgtggtac    170640
     cacatagtat gcagacatgt cccggcactc caggcacatc cggcgcaaat accaccaagt    170700
     aaaacccagc ggtaggacga tacccggtcg atcaaatggt agaaaagggc gccggtggcg    170760
     atcgaagcaa gcatatagtg gaccttgagg ccgagttgcg gccaccggcg aaggattgca    170820
     gccaacgtcc aaggcaagat cgagacgaga ctacatccgg cctgttcatt gttagccact    170880
     tctagtcaga catactgcgt aggaatggga aggctgccgt cctcagaccc gcttcacgta    170940
     ccagaagtgg gatggcgaga cgagctccgt ggcttttatt tcgagcattt gctcctaaga    171000
     cggacccatg aagaaggcaa tgcagcacgc aaatgcgacc tagccaccga tgggcccagt    171060
     agaacgtgtc gcgttcgaca tagtagacgt gggccggaag actgaagcta aacccggagc    171120
     agaggggaac aaggtgtgtg accgccaagc atccggctcg cctctgcaca tccacccagg    171180
     tctgagcatg aaggctgatt acaatggtat ttgcaattac caaggctgta agtactcccc    171240
     cttgcaagta tgttggtata tccagccact ggagcacgcc tggtgttggg gcctggaaga    171300
     aacttctcca ggatacctgc tgcaacctca aaggcaaatg acggaatctg cgtccgaggc    171360
     tacaacatat ccagcataca agagcaagga gcccacatag accgaatgta tcttggatgg    171420
     aagctctggc aagccactcg gcaaactttg aaacagggcg tgacatgctt tttaggacag    171480
     gcaatactgg acatcagcgg gtttatatct tgttttctaa atggctgttt gaacaacgtt    171540
     gacctagagc tttgattcag gcaggcgaaa atggcttggg agagcgatgc ggcaaaaatg    171600
     acactggtga gtaacgatca gaaacctcat tttatgactt gggatggtgt ggcaggttga    171660
     tggctgaaat ttatctttat cggcagcgta acagtggtaa tccgtctcat gtcgattgca    171720
     agacgtgcgt ctcagaaaaa ccacgttcgg cgttgagcct taattctacg gttcccatgt    171780
     tcctgcatta tattacaatt gtgagttcac atagttcgaa cagttgaagt tgatcaacat    171840
     tctgagaagc atctccacat ggtgcatggt cgcttatcta atagacggcg accgtcttta    171900
     ttagaaatat cgttgaggca acctcgtgat acgctcttca aactggtcac agttaggtta    171960
     gaagcgttcc aggtcgtact tgccttacgc tttctcaggc ttccaacgtc aacgatctgt    172020
     ctctcaaccg tactgtttcc tatcagggct ttctacagag taggtccgtt tgaggtatcg    172080
     aggaaagatg ccaggtggag cgccgaatag gtctattctc aagttttggt ctatctgtga    172140
     gagttgtcaa gttataatcg agcaaagagt cacatattta tccacaaggt aaccacaagc    172200
     aacaatgtat gattgaagac gaagaaccca actaggtaca cgaataggcg tccttatata    172260
     tcgctgaatt cttcctgtgt agatgagtag atagtagagt aatagatttg ccttggcaga    172320
     ttctactgat caaccatcta ccgttctacc acctgcatgg taacgtggtc ggttgtccca    172380
     aagtggcagc tgatggtact gtgatttccg gcacaggtag tcgcatatgt atagaaaagc    172440
     ctctgctggt gggtgtctta gtcttgctca ctgggcgtga tcatggtttc tctttccctg    172500
     aacatctgga gttgccagac tatagaatgt tgcacgtgat cttctgagac atcaattggt    172560
     tggatcttgg tggcccatcg gtgtgggtgt gagtcacatc tgattttggt gacgggtatg    172620
     ccaggaacac ctcggccagc gacggcgagg aatgcgggaa atagtataca tacaagatag    172680
     acccgctgtt gactatcgtg ttttcctggt ttctcttctg ctcttgggta caagaattct    172740
     tcaagtaaaa caaaaccgcg acactgttag acaatgtgaa actgtctcgt gaccctcaac    172800
     ctgtttgcgg caaacatgcg tttgagctgc atttcgaatc agcgtccaaa gtaatctcaa    172860
     gtcgtcaaag gtacacacaa cctcgcaaat ccatattcta tgactccttc ggggtaaagt    172920
     attgtactgg tatagtgata ttttgcgatt acgtccggat ccctctcgct aaatctagac    172980
     ctttgtgccg ggatcactga tcctgcaagc ctcaagagac cttgtaacca cgtaactgaa    173040
     tctctttggc cccttccatt atggactttc ctcaggcgtg aactaactcc agatgagggg    173100
     agttggctaa agacctatca tccctggcat tcctctggcc ctcctgtttc gaccacaaga    173160
     aaagattgtt gtcacaagtt cgagattcta aaattcaatt cccaattttg gcaacgacaa    173220
     tgaatggcaa gggaaaagaa aacaatcaaa tcaaaccata aataccaaca gctacgttgt    173280
     gagccaccaa agccttccaa cacgcatgcc gactctagga gtgagtgatg ggcttatgag    173340
     aagaggtgac ctgaacatga gaaacttcga ggagctcagc aaggatagcc gctttctctc    173400
     tactcgacgt ttcgagtctg aacgtgagct ttgccctaac aagccaagat tttccgctca    173460
     ttcgctccag cagatagtaa actgagtggt tggtggaact atcagattcg cccgtggtta    173520
     tcttgaagtt tgccgggtcc actacggaat atatccagat aaatccgttg gagtgctcga    173580
     aagaagcggc actcgcgttc catttcgata tcagcgtgtt gaataatggc ccgaagattg    173640
     tgactggaag gccaacacag acatatccca tctcgtcgag tctctctgga cgcagagcct    173700
     tgagtatcaa ttctgcctcc tcgatcgact ttgaatcaat aacaaccgag tctgataccc    173760
     agaattcggt tgaccagcta ctgaagtaag gtgggacctt ctccaataca caatcctgga    173820
     agtgaaagag gcttgcccgg aggccctttg cttgtttcct ttttttcgta ttggcaagga    173880
     taatcttcag gtttcctgac tnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    173940
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    174000
     ntcgtttggc aattgttctt atcggtattt tgtggccaac ctagggatgt cagctcatcc    174060
     attagaaaca gtattcccat gcaacttaca gggttagaaa agtcatcatc atgtctgtgg    174120
     tggcagtgct gactatagtt tgaagactca gaggatcggt tcgagtaggg tgattgatct    174180
     ccatccgaca ccacgaatgc gcggtcttca cttgtttccg aaatatcttc ttcctctgag    174240
     tgctcagaga ttgactcttg ttcttcggat tcactgggct cactgtacga ggatataatt    174300
     tcggaaagct cattttcttc ttccatggcc atcttaggta ggaaatgccg gtgccagatg    174360
     aatttacaac agaagatgga caaattttgg attttcaatt caggtacgac ccccatttat    174420
     gtagcccgag ggtcgattct aatatgcctt gaacatgcct aaagagccat gcaaagttcc    174480
     aacgacaagc gaaagaattt agctagtgct tatgggtcaa attactaaaa cgttgattca    174540
     cctgaatacc taattgagcc agtgatacgt cgggaatcgt tgacgtcatc gactttcacc    174600
     gctcaagata ttcccccttc gtgtagcaca ggcttcatct atgacctgat gatcctgaag    174660
     ctagtgagga tatcaaaaat tcaatagaac aatacatagt gatgctgtga gacatttttc    174720
     aacgtttgcc tactttgaga ctcaagaacc gctggtggtt cagttacagg ctatctgcat    174780
     tcttgaagac ctttaaactc accatctcaa atccccttcg gtggttcctc aatctggtca    174840
     ctgggattca tcgacttcaa cactcagggc aaaaggacgg acggattagt caggagacca    174900
     cggtatataa tttttgacgc gatgactgat tcgtgggacg cagcggtcgc cctaccataa    174960
     aaagctggca ccagtctcgc ttgctttggc tgtgatccca tttattctgg cggcgtcccc    175020
     cgccagcttt acacccctcg gcgcgatgtg ttcgattgag actgcctcat catcctcgtc    175080
     agtcccaatg tcgctgtctt cggtatgtta tcaccgggag ccagtcaact gattctaact    175140
     taatttacca cttgaagctt tttaatcgcc cctcaggcat cgtaacgctg gaagaccgac    175200
     ccagaagccc cccagcaaaa ctcacacggt ttgcaccggg ccgccgagat tgggtgctct    175260
     acgactccga ccaggagaaa gaatttttat cgtggtggct ggagaccgag tatggacaac    175320
     agctgaccaa aaacggaaaa tacaaattca gatggtcggc tgagtctcgt tcctcaaagg    175380
     tgtggaagca ctttgaccag gtggcagagc tcagctctgg ccgacccaag gtagtttgtc    175440
     ggtcttgcct cacgccgctt aaccacccac atcatccacg tcataaatcc catggaacaa    175500
     gcacaatggg taagcacttg aagtccaact catgtcgcag aagcaaagag gaagtgtccg    175560
     tttctgctgt caccccaggc ccaattcagg agtctcgtgc aagcttctcg cccatgagga    175620
     gcagattcac caaggcacag ttcgaaggac accttctgcg gacaatcacg tccgcaaacc    175680
     tttcttttga ggtcacggaa gaacccacat tccgagaatt gttggatcta gtctattccg    175740
     gacctcaagc tttggaggtt ccctcgtcaa agaagctccg ccattatatg cacgacatag    175800
     taactaccta ccaagagtca cagctgcagg acctgcccgg agattccaag gtatcgatcg    175860
     ctttgtgctg ttggaaaggt ccgttcgggc aggactttat ggcgattact gcctattatt    175920
     ttgataaaga gtggagctac cgagaggtgc tgcttgggtt cgagctaatt tgcaggtccg    175980
     agacagggaa tgacccctgt gatcaaatac ttggactgat ccaggaaaaa gggttgctcc    176040
     atcggatatt cagcgtgaca gtcgactata gggtcgatga gaacctgatg ctgtcattaa    176100
     gagagaagct cacttcttct ggtggtatca gctcttggca gtgctttgtt ggggttcctg    176160
     gcatagtaca gaccattcag ctctgccttc ggcggtatat cgagaacatc acaagctccc    176220
     cagaagggga aagggttgag aatgtgcgag aaatatcaca cgccaatggt tggaccgacc    176280
     catcagatgg cgacgaaata tcacatgttt tgggaaaggt gaatgccctc catcctcttg    176340
     actaaaaaac aaaatctgac ccttgccttt cgcagattcg atcatttgca aaatttgtca    176400
     acgagacccc taggaagcgc gatgagtttt tgtgtctcca gcctgcatcg actcgagtct    176460
     tgccgttaga cgatgcgagg tcccgatgga attcggtatt cctgatgtta aaacgagccg    176520
     gcagactgcg aagatatatc gaccaatact gccaggagag tgggaattta caatacaaat    176580
     taacaaatac ggattggcgc aaggtcgact accttgtgca actgataatg ccattcatcc    176640
     agtttactac ggccctcctg gcgtcgagag aggcgacagt ccacagggtc tgtttcgtgt    176700
     ttaagatact aatggagcat ctcgacgagt caacccgaat attgagaaga aaatcagcac    176760
     cgtggaagcg caaactatct gaggcgtcgc ttatcatgaa gatggaactt ggagaagtat    176820
     acgaaaagac atttcaaaac tttggggtca tgtatggccc tggaactttc gttgctcccc    176880
     aatataaggt gtccgcattc gatgaggcca catcatcgca aggtttgggc caacccgagc    176940
     gctacatcga gtatctgagg atctttcacc tacaataccg accgcaaatg cccacgagct    177000
     tgtcttgcgt gaacggactg tcttgttccc cgcaattgtt ggggcttgac cggcttctgc    177060
     acccactagc tggtctggcg ggtagctcaa ggtgtgcgca agatgaagtt gatcaatatc    177120
     tccgcgaagg tctgaacaac tgcccaatat ttcctgttga ctactgacac gcaacagggg    177180
     ttctcaatat ctcgccatgc gcttactgga aagaccatca acgcgaatgg cctgttctca    177240
     ctcgactggc gcgcgatcta ctctccattc cggctacagg agctggcaca gaacggcttc    177300
     tcaccgttgc acaaaacatc tgccgtactc gtggaggatc tctggacgag tcgaccatgc    177360
     gagatttggt gatgtacgcg tactcggagg gatccgaatc agggaagcaa tcgatcagcc    177420
     gggtgcaacg tgacatggcg agtgacgatg aatgggagga gttcgaagta gaggcagaaa    177480
     ggcctgaacc gatcagcgat gacgagtggg attcagccga gatgagtgtt gacgagcgct    177540
     ctggggacga cgaaaacagc caggcagagg cagtgatact ggagatccca cctacaggag    177600
     acctggagca ggatgtaacg gataaaggcg aggggggctc attcctgcct ccgcctgtca    177660
     cgcagctcat caatagcctt cgaagaagat tctccggcag atgacagtga tctagcaggg    177720
     tgtgtcatca ttcttatcca gcatttgttt gctagaatcc ggcccagccc tacctatccg    177780
     cagtacaaat tcattgtcgt tgatttgcaa taaatcgttc caacgaagaa tgcatcatat    177840
     taatagattc tgtggaaagc gcgtatatag gacagtcaat gttacaattc tcacctttgg    177900
     aactgccagt cttgttgcag cggtcataaa aatgtggttg cgacgagcgg acgccctgca    177960
     gcttgtaggt agtcagtgat tacttgtaac tctttctgtg ttcacaacta tctttatttg    178020
     cttttaccat catgtctgct agatatagag ttggcagaat tcgatcatca gattgaccct    178080
     cacaggaacc ctagcccagg aggcacttga ttctaggtcc ttggcagtaa cgagggctgg    178140
     gccccagccg gcacatcaat caaacttcca aaccaaataa ttgaggcgca atatccattt    178200
     tgcccttcgt cgccatcctg ccactggtta ttcgagggat cttgtcgttc ctgcttcttc    178260
     tatgtggttt acaggcgtag cagaattcca gtcattcaaa aggcagctga gatgaagaaa    178320
     cattggaatt gacccgcgat atgtggcggg tgattaatgc agagggctct ttccaagata    178380
     aagtaccagg ggatccaaca tgatcagttt gattcggttg tgacaggaat caaggtatgg    178440
     cgagcgtact ggtaagatct acaatggtaa aattatctga ctaaaaacaa aaatggtctg    178500
     aatttaacaa tctggtcaga cataataatt aaggaaaaca cattgtagaa atgtcgcatg    178560
     attcagtggc aaagacggta attccaaaat aacatctggt ttcttgacac atagatttag    178620
     tcaaaatttc gccaaaaaaa agaaaaaaga aaannnnnnn nnnnnnnnnn nnnnnnnnnn    178680
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    178740
     nnnnnnnnnn nnnaaaggtg cagctggctt atatgtatat ttatttttgc ttgccgggtg    178800
     gtctcctcac ccttcaggaa atcgttcaac acttctccgc acccgaaggt tctttttcat    178860
     ggactgatag aattggagct tagcacgttt ttaaatattg atccttggtt acaaaactat    178920
     acatactcgt tcatttccaa tgtgccagtt attctataaa aagatagcca ataaggtaat    178980
     aagaacgagt agcctctcac tcgtacagct cctcctcatc cgcaacagca cgcttgggca    179040
     cttctcttct ggctgtttcg gtgagaaagt actctccgga cgcggtgtcc gattctattt    179100
     cttcccacgc aatggtatct tcgtacctgc tctgtagcaa ttgcgtggcg agctgcatcg    179160
     tgaccccatc cctggatgga tggtgtcgga gatcaaggtg cggtcggata gcgtttgtag    179220
     atattgtatt atatcgataa tcaatttcct actaattgtt gtgagggttg ggggtctctt    179280
     tcgatacatg tttcagtcac attcttgggg atgactctat ctagggactc acatcctggc    179340
     cctaggagct atcttgttcc tgggggcatt ggtgcgattc ctgagagcac agatgcagct    179400
     tctaggggtc ggataggccc caggaaaccc gacgtggctt ctggggtctt gtacttccgg    179460
     ctcagggaac caaagtggtg ttcctgttga ctgcctcatt aactcctgga gcgtcaattg    179520
     cggttcctag ggctttatct caaccttcgg taagagctct ggtccgtgta tttcccagcg    179580
     gatacatagc tcctacaagc gcttcgacgt ttccagtgtc aatgcaccta ttgtcatagt    179640
     caaattccca aggaagaaaa tttgtcgagg cacccgacca caagttttga tttttctgcc    179700
     aacaatcttg gtcttcactc aacattggtc cattgagcta aaaccgatgt ctatattctt    179760
     ttggcctcct tcattaggta tgacgaaaag gagaactctt atatactaca ctatttagag    179820
     ctatgaacct aaaatcaatc gaaattgcaa agcttttggg gtgcactgac atctagtact    179880
     ttgaaagagg ggcagtcgcg tggtgttctg atggtataaa tatcagtatt tcacatttgg    179940
     ccgctaagct tgctctaaaa cttcatatga acggctacgc tctctgttgc tggtccgaat    180000
     gcggagtgtc tggtcacgtg tattcacggt gattgacagt cgcttcgcta atttcccatt    180060
     tcttcacgcg ttgtctgtaa attgtaatcc cccacgctga gtggaagtca gccgtgccga    180120
     ccagcgaagc ggtgcagagg tagaagggtc tggcggtaga tgagcccctg ataatctggc    180180
     tgacgacggg gcccaccagt gggagatggt tcgcccccgc cgtgtggacg gaatgtgagt    180240
     ggctagcaag cgatagcgat atccttctac agctctgcaa tgtgcaagct tcagtattgt    180300
     gggagcgcaa gcgagctctt gtaacggtgt tgtgtcggcc ttgggaggga gcgatcttca    180360
     agccgccgag gagcctgagg gttggtaaag tctccatgtg gtagagcgtt tatgggcaga    180420
     aagaatgatt ggattttccg ctatatattc gtgtcatctc ctaaggatta gcgttaatat    180480
     tagataaggt ccatactgct ggtgaacttt cgtcgggttg gtgacgggga cgaacggtgc    180540
     acggctgttg attcattcaa cccattcgac aacttagcat atggctgtaa attcccctag    180600
     tttgtcctga ttctttgtaa taagggagaa tagaataact tctcggcctc cacctttcca    180660
     tccctcccag cccacgttaa atctttatac acttgggtat ttcgtcttat aacagaaatg    180720
     aacgaactga acaacaatgg tctgtaccca ttgccttgat aatatcttgc gctaacatta    180780
     ctcgtctacg atttgcttca cgctatctgg aatgaatctt ttggcatacc gacacctcct    180840
     ccttgtctcg ctactgaccc caatgatctg tggcaggatt ttcttggcaa agacgatcct    180900
     gcagaatacg aaactcaagg gtcttccttt atcgaatgcc ttttctaccc tgatctcgac    180960
     agtctgtccg ggttcaagtg gacaggtcca gatcctctga ccaactctac tcgggctagc    181020
     gacattttcc tccacatgtc agcgctcctt ttccctaaag aggtgcactg gatcgaattt    181080
     cgatttgttc ccatttgacc gagtatctga tgagactata ggagaggatc tgttctccct    181140
     gccgcgggtt gaaacggcca tggcgaatct ctatcggata cgcagacagc tactagacac    181200
     aatcacctgg catgctgtcc gtgcaacagg cactagcttc cgactgtccc tttggcctcg    181260
     tacggaatct ctaccgtact cgagtctctc gacacattct ctgttgacta ggcttccccc    181320
     gacgctatcc ctggacccac ggtttttcgt acataatata tcgagtaatt acgtgtgaga    181380
     ttgatctgaa tcaagcgggg ttgttcgtat actcatttca gtaaagacca cgataatgaa    181440
     taatgactat ttgatgccct tcttgataaa aagcctcgga aatatataac ctactttgca    181500
     tgcagtgtga ttccccttgc aatgcgtcgc cgcttgtagt atttctacgt cgccaatata    181560
     ggacggggca gcccggaata ggcaattcat tactcttctc ttgcaacgtc tgacaaccct    181620
     accaaattgg gactgtaggg gtagttccag tcatcgagta ggctgatcag tcgttcccga    181680
     gatgattcca atgcctgtcc gaaaaagcgc agtcgagcta gctgcttgtc gtggcgaagc    181740
     tgaagtccgt ccctctcttt tctcaggtgt gtaccagcct ccttcaagtt ctgattgctc    181800
     tgctctagct tctggccatt gatatgcttg gacacacacg actcccatag gcgtcgatag    181860
     ggtccaacaa gtcgagctgc tggaaaggca aatttgggat cgtcgcattc gaggtctgct    181920
     agcaccttca aggtgggttg aaacggctcg gtcgccaagg tatgtcttgt ttcttcttcg    181980
     tgttgcgaag gggaagtcta cgatggtcag ccaaagcatc tgaagccaaa tggtgtcact    182040
     taccaatgga gggacgtgat cagaaggttc cacatcactg tccttattac taaggtttgg    182100
     taattcacag ggccgctgtt ctcctttttc ctggtctggc gagctgttcg aggcatcaat    182160
     ttttcccagg agaaagtcaa ggtctgggcg atactagttc catcaggcct tggtgtaatc    182220
     ttatagacta tgagacgcag acagacggct atagactgag ttttacgatc cccacatcag    182280
     tcaatcaacg cagtcagctt agaatttgct tttattttca gcgggcgctt ggtagtaaat    182340
     ttgagaggag gagtgtcaac gggttggccg ggaaaactga tcaagcctga cgatgttgag    182400
     ggccagatat ggacgcccat tgacgtgaga gatatctcaa ctagacgcct cttccacttt    182460
     cgttggaagc ctgggaaacc cggcaaacag cattgcagaa tgggtagttc ggatagtaac    182520
     gaagggaaaa atagaaaaga aaaaaaaaaa aaaaaaacaa tttatcttcg aagtttgatg    182580
     gtcatcactc aaattgagcg ttgacaacgt ttggccaagc ttcaacgggt tgacgggtca    182640
     tgctaccgtg acctcgcttt ctgcagtcta ggcggacaga cccacagctc accacagacc    182700
     aacacaacac taaaacgagg ccagaaacaa aggtacatga ttcctaggga tggaattgta    182760
     ggagttttcg gtgatccaac gttgagtcgc caacatatga ggtgactagg acaagaaata    182820
     tgtgaatacg tgcctgtcat tgcggattga atatctccca caaagcctcc tttaagaggg    182880
     acgtgaagga ttcaacagtt agccaacgtt gcttgaccga ctcagcgtcc ctttctctca    182940
     gcaccactct tactcgcctc tctcgctagg catccaaagg catcaagaat gtcgctgcaa    183000
     atagttgcgg taaaagaaga cgtgggtttc aacaggcctc aattaagaaa tgtgtccttc    183060
     aacacttcca accaggtcgg tgagtgacag aagccgaaaa gcctataaat acgtcctcta    183120
     cccctgcaat cgctctacta tttattcact tgattctgca aagtcgagca ggcttgtgtc    183180
     tgacgcactc gataagttct ccctttgatc gagtactgga atttataccg tgctgacatt    183240
     tatagtacac atcgtggacc agcaaaccag acagttcctg tactgtaaga gacgtggttc    183300
     caagcattca ctgccccatt tacgccagcc gatgggagat acgggatttg gattagctgg    183360
     tcaaggtgtc tatgcgaaga ggtctctgct atagcgagct gatctactgt cgcggctctg    183420
     gttgaccaca gatttgaagt gcaactgctc acactgtagg tatatgggct cacaaatctt    183480
     tgaaactgca ctgacccgaa agacgcggga cagccagatc cgtggacgtt cgaacacaat    183540
     gcaccagagc aagggccact cttcatccct ggtcttgacc atcagaaaat gtgagttatg    183600
     gaattccacg ctggtttact ggctaataat tgacagtgaa cctttgggag ctcaccagag    183660
     tggccctgat aaccctgcac caccgtcagt gcaaagccat ggcttacaca ctattcctag    183720
     ccccgtcgct tcgaacaatg cagcatgtcc taggtggaag atcgcaaacc aagatagcga    183780
     gtcaacaaca gggtgcggaa attcaagtgc aagctttagt cgcatcgaag cttgaggcgt    183840
     ccgtccttcc tgatagtgag ttatcgcgtc ttctgctgcg ccggtccggt tgaatatgcc    183900
     aagccttgtg cccaaaatca cgataccact gacaccttca cgctattata ggagcactcc    183960
     atcatcgagg gtgaaatata ctgtggcgag tggcctaatt ccgccagatc gaggataaga    184020
     ccaaggtggc ggccgacgag cgtgctccat cgcgtcttcc gccctcgtcc ccaccgcctt    184080
     cgcactgttg tggagttcct gaacctctgg catcgcgaca cattcatcca ccatggaagt    184140
     gcaatgttta tcgcgggtgg gttcgtaacg cgtttactgt ctcaacaaat tgtcttgtgc    184200
     accccagcgc ggcttttttg aagcgagtgc agattgcgat gagcttgaat gcgacgtggc    184260
     atggctggtg actgcattgc agagagttgt aagtgatcta gttgtgaagc cgatatgacc    184320
     attgtgcaaa ctgatcgtca cgtctcaagc gcactttggg atttctatga acaggtacgc    184380
     tacggcaact cgtccaacta gatcagccct tgctgactcg gatcgtacaa caggagaaca    184440
     ccctcatttc tgtcactcaa gtcgaatgcc acgcgaacaa atgtcttgtc tactcgagct    184500
     cccctataca aatactgtcg catgctctcc gtcccttcca catgactact atcgacgatg    184560
     agtcacagaa ggttcgtatc gcgcacctcg gcctctttct ccctattgat tctgcatatc    184620
     gggtcattgt tcgatttgtc tacatgatac aactcctgaa ctccgatcag cctataccac    184680
     tacccaaatc atacctgtgg ctaagcatgc aacctttcaa ataccttcaa gtggcgtagg    184740
     ctgctggtat cgaatgcgtg atcctcgttg tcttcggatg gcatttgttg tcttcggatg    184800
     gcatttggtg tctttccaga actggaaaaa cgcacaggaa tgttgatgtt ttgtcttgct    184860
     tcctggcaga tgggcgtacc tctgcagaca atcaggctgt tagcacaagt ccacctgcaa    184920
     ggggaaggag aggcaaagtc tcctcattct tagcctacaa tttgacattg gtcatctcag    184980
     gtacaaaccc agagggtaag atcggggcac acgcaagcca atgagagctc actacccaag    185040
     aatcacctcg ggcatacagg aagctgcatc atgagggctg tcaaaagtgt tgtggtgtac    185100
     ccggttggtt cttatgcaca catttcctat ccaaaccgaa gcactatctg caaagaccat    185160
     ttacccctgg gtgtcactgc agctgcaggt tagtcaagtc gaccgcgcgt atcctttatc    185220
     cgttcatatc gtctcctaac atatcacgca cttgtcagga aatccggatt ccctacatcc    185280
     ctatttcgat ggtttttttg agaataaatc atatattcgt cgagcccgcc gcgctgcgga    185340
     ggacacgtgg gcatgttact gttcggccag gcggccactg taaagacttt ggtgtccgaa    185400
     acaatatcga atcagaatgt ttatgggacc tcttggacta gcccctagat cctggagcaa    185460
     actttccgcc gtcaatcaac gctcatgtgg tggttgcttt tggaagcatg gccggattgt    185520
     ctactacgac tacgagcgaa ctagcactcc tgcggggata tcacccaacg gaaattcgtt    185580
     tcagacggca ctgcttgaac ccaatcgggt ttcaatcggg tttcaaccgt gtttcaaccg    185640
     tgttccctta tcagcagaac atggttgatt gcattaactt gggacaccgc ttcccaaaag    185700
     gcaattgccg tcacttcgat ccgggattgg ttgaaatatg atccgtcgtt gccgaggcat    185760
     agtaggagcc aaccgggtat tcttgattgc ttgcttgtcc aaatctctca gcaacatggt    185820
     tgtctctgcg gtaaaattac tttgattctt gcgctctctg ggatataaga gctgaaatag    185880
     ggtaaggtcg agtgactcaa tcgccgcctc aagtgatggc tttgacttcg caaggcacaa    185940
     agcctaccgc atggctaatt ttactcaagc cattcgttcg gcacctcatc acatgcttct    186000
     acacgtgggt cttgggcgta ttgcttggtc atagttgaac cagtggatct actatcacta    186060
     tcggattgag gctgtatgtc aacttcaccg agtgatcaga gtgggactag aattttcgct    186120
     tacgagatag aatctatagt gattgataca tttatccatg tgggtgagat ggcatgaaaa    186180
     tctccgtact acgtcggtga gacattgata gacctcgcca cgggccatga ggcccatgga    186240
     ttatgggcgg gcgggcggtt gaccgtagcc ccgtgtcatt taatgggccc atgtgtcgct    186300
     tactaataag cacttcagtc acatgaaatt ttataatttt ataatgttta gccacgcacg    186360
     tatatgtcct atagtagtcc gtattcaggt tatttgagta gaaaagtata caatggatat    186420
     gctcagctat aacaaatcct agtaaaagca atggactatt gagtctaagt gaatgaaagt    186480
     gtgatccgaa atgcatagaa attgtgatgc gtctgcattg cgcgtaaata tatacatgac    186540
     tacaaaacat gctgaaccta caaaaccact cacaatataa tgcctaccag cgcatcagta    186600
     aatttattat caacacgaca tactagttat actgcatact aggattcgcc tttattatga    186660
     tcaattatct gctatactag tggttattgg gggtaggtga caagtgatag atttccaaaa    186720
     gttgaacccc ctattcagga aacttacata atctgagggt ggcatggacc gatggcaagg    186780
     tctagacgtt gaccaccttt ttcaccgccc gaccattcac caccacgctc accaccacgc    186840
     tcatcaacac acatcaacac tcacatcaac actcacatca acactcacat caacactcac    186900
     atcaacactc acatcaacac tcacggttca acgcaacaag cattgcaaga cgacactcat    186960
     ctctgtttgc ctacatctga atgaaagatg ccaatttcta ttgtagcgag gaagctattg    187020
     gatcacaagc tacttcagag tcaagtctcg acctgctttc aaaaacttgc gttcagtatg    187080
     gtgaaccact ttttcgactg ttgaaaagac agtgatactg caaggatatg attctcacat    187140
     atcattgaat ttgcaattaa accgctcaac gctgtggcag actgactact ctggccgttt    187200
     tgaccatggc cactagccac ggtcaccgtc tctttcatga ggattgaagt gcttcaacag    187260
     atgccgcaat aatgggttgg aggctttgtg tacccgtggt tggccataag acgtgcctcc    187320
     cattgatccc tctacaatcc cttttgccta gcctcgcgct aacggtactt tctgcgttgc    187380
     tcgcaaccaa ctgatgttgc ctccgctaat acttctgcta cctgtcggta cagatactat    187440
     gaatatactc ccaaatccag ggtattggtt gttttccttg acggagaata aaaagtctag    187500
     accttgttgg aaagcccaga atagaaaccc gactccagtt tccaggacaa tgaagtgagt    187560
     tatttcagct cccatggctc acgaggtagg ttttcgtgat cgccaccccc tcgcaagatt    187620
     gcaacgctac tatcacagtc atgagaccct ggagaagaat agcacccgac gggccaatca    187680
     aacaccacgc gcgaatttag acagacgcag gtagggttcc gcgatgcaga tctcagcaac    187740
     gacccacggg acagtagatc aaggaggttc tatttgtgga gagaaaatgg aaacaattgc    187800
     aaaggtctag gcacgatcca caagcccaaa cttttcggcc atcagtgtac gatggaccgg    187860
     gggattgttg cctaggtact gctggggcag gtgagtattt ggaataacac gcaggctttg    187920
     gcgacagaat ggtaggctac aatccgatcc gtggttgtgt tcacttggtc gcagtcatta    187980
     gaaagtaagt acccctgtca agtgggaagc agaactttgc ctatctggtc agtagaacgt    188040
     tctagaagct atgtatcttc tcctgcacca agctttccgg tgatgattat gctatactct    188100
     cttcgagcca gacaagtcct ctccatacgc tcaattctat cgccagtcta gtaactctag    188160
     cagatggctt gtagaaataa tgccagtgga tcacatgagc ttacgtaaat atctccggtt    188220
     tttgaactaa acccggaaaa ccgattggct cccaggagtg ggttctgtgg gccggcccac    188280
     ctgcggcacc taacctgtat tccaagcacc ctgcccatct cgagaatgac actgaatgca    188340
     gtatcttcta ataaaatatt gtcctttccc aatatcctat atatgagcag aatgagaatt    188400
     tgttgatcct gctccggatc tcgttttttt gggctagcaa tctacaaagc aagtgtagca    188460
     gaggctgttt agataagctt tccatgagga tcattcgtga cagccgcatc ctcccgcatc    188520
     ctctcaccga gggagcattt ccatggcttg tcgaacttta ttttccgggg ttcggcgatc    188580
     gatcgacgat cccggccatg ttctacgatc tctggggaac taacttttgt caaactataa    188640
     cctccgtact ccctcgctat tgtcgtaatt ccaaggaatg gtgcttgttt atattttgat    188700
     aatatgtgta ttcgtacata caacaatcat gcagtagctt gattgctcag ctgccatgtt    188760
     tgccattttc cccgttcgta gcacatcaaa caacactaat tcgtcgaggt agttgctatt    188820
     gctgcttcga gatcgcgatg tagcgcagat accaacaaac tgctggtagc atggatgttc    188880
     cgctcatcgg tatctcagct tcctggctgc acagacacga tgtacatagt tccaaatctg    188940
     cgatgacgat cgtgattctt cacgccgtaa agggcggagt aatggcatcg cgcggcctgt    189000
     gatgtgtgat tagcttgtgg tcaaagggtg gtaaacatta gttcgtacct ggtctcgaac    189060
     ctttcctctt cattgattca atgctgtcga tctggctagt ctcagtggtt aggattgttt    189120
     gaatccattt ttcaatatta ctttgcgcag gccttctgct tgtgagattc gctaatgaag    189180
     ccttatggcc ggccgagcga tgagctcctg ctcggcttcg atggcttgga tggcctggat    189240
     gctcaagcgg tctggcacca atgcgacgtt gcttgcgcag aatatggtac ttttttcctc    189300
     gcagagactc agcgcttcgg tccatctgat attgttcaga atatgcgtgg gagcgggctt    189360
     tccacggcag cgcccgatga gcgtccagcc aggcgagaag gttcttttcc tcccattcct    189420
     cccaggccac ctcgcttcga ggggacatat cgcatgaact agcagtaacc agaatagacc    189480
     ttttcggaca atagcacgac ttgagctcct gatagaaggg aaaagcgaac ctaaatcctc    189540
     tccacgtcct agtaaaaaga taagtaccct tggcccactg caaatcttct aaaggttcaa    189600
     taacattaca catggaccat tctgggggtc ggttcggtga gtctgaattg tgaattattg    189660
     attccgtatt ccaggctccc tcaaaccgtc ggtgttgaaa caatccctag ctataagaac    189720
     gcctaactgt caatttcgta ctccttgaaa ttgttcttga atgtaattac tttacgtcaa    189780
     aatgaacaaa gcactgaatt cccagaccaa gccccaccgg gtactgaata atgtaacccc    189840
     aaacagactt tagaggcaaa acttggcttc gtacaaagtt cgttccccta aagtttaatg    189900
     aatttcgtga ctgattggtt gaaatgtatt ccaaattaag cgacaattgt ggtaattacg    189960
     gatgtaagat agtgggcctt gcaaaccctg atcgcaacct ccggtttgga gaacgacctc    190020
     ttcatatcag cctgtgcgac ttctcttgta acatctggct gggagaattc attatctcac    190080
     cttgacacag atccaactat ggggagaatc cggaaaatcc cgttcactga tcaacgacaa    190140
     agctttcgga gccgattaca acgtgcactg tccctgtcat cctccgggtc cgaggatatc    190200
     tggagtccgc caggatcagc ggaaggcgat accacggagg aagagtcttc tttgcaggag    190260
     aatggctcct ttggcaacca ccaaaacgac atcgcagtgg aggatggcca ggaaagtcct    190320
     ccacactcct ggagtatggg cccgagacca gaagaaggac tggaacaacc cggacaggct    190380
     aatctcgcgg aggactgcaa tatgatcgcc ttacaatgtg ccgcagagtg agtgcgaatt    190440
     tgccccctat aataatgttt tgtgatgcgt ctgcttacaa cattcagcct agatatccga    190500
     acgaagttag ttatgcgact caccagagaa cgaacgaagg ctgactttcc caggctcatg    190560
     caaaaagcat tggataactc taacagctgg attgcaacta ttcgcagtga cttggaggac    190620
     atccgcagtc ggttggcggt cgtggagaca gctatggaga tgatggccaa agaggggaag    190680
     aacagtacta cagaggataa tgcaactagg cgaacacttc ggtcgcagca gtgatctgga    190740
     tcgaaatatg atgtggttgt agaatatatc ccagagcctg ttgtcagcct tgttagctga    190800
     ggtatcacca tcgcattgtg cttcgcgacc aaccatatct cactggggca gactggaagc    190860
     tgtaaataac cgtaaggctg cggaaagtag acaaatattt actataattg cgctgtaacg    190920
     aactgagctc cttggaacga attctctgac tccgccagtg acagttgtaa accgattcgt    190980
     gccattaagg tttctcgagc gcccgggtat catttttatc ggctaccctc tccctggccc    191040
     actggaccct cacgtccaca ttcagtggtg gatcaatttg agatataaat tggctgtcgt    191100
     acgcttggta gagtattcca aatcttatgt tatgacccgc gnttagcccg ctcaattggg    191160
     tttcggccac tttgggcgga ccagaaaaat accgtagttc gtgccagcgt cgtaggctgt    191220
     cgcttgaaat cctattatct gccaagtggc aagaaaagca tatgtgaacc aagcgccaag    191280
     gaaacagcca aatttcttca tgaatgtcgc cgagtcatat tgcctatcaa atgctgggng    191340
     gagaccacgg acatgattag ttagattcgg ttgcttccga cggatcagcg catcatctct    191400
     ccgggctgtg ggccctgccg ctaaccacat tcagcgatca tggaacattc tctctgccnt    191460
     ccaagctgcg cttggcggag cgagtcaaat cgtcagagga tctacgtcaa tatccttcca    191520
     cggcagaaca ccgatcgacg caatctttgt tttctatatt tactgttgtc atgggacggt    191580
     ggtggcgtta ctgaagatta tctcatganc tatccacctg ctagtgcttg tataaactga    191640
     ctagctggtt cctccanagt aaagncagga ccgccggaca cgctgaattt gccatgcttc    191700
     acacaggtga ttagtattgg ttgcttgaaa ctggcgcctc ctgatttaca agggcataat    191760
     cacccggagc ggaaaactga ggcagggcat tgtgacctag agtcccaagc gggccgtcct    191820
     gctcgggcca acttccgttg atgcctcccg agctaggcaa gtaggatgcc agtctanggt    191880
     tctggagggc gtcgatcgtg ttccanaacc gagtagtcgc cgatactagc tcgccatgcg    191940
     tttgatgcaa gaccggctga atatcgtgcc atgagaccag gccctgcatg gtggcgtgag    192000
     atgactcctg cgcctgctgc agttgacaga gctctctttt caagcctctg gttctctccc    192060
     aaggctttgt ctcttgctgt gatagcctcc tgtagtttcg aggtgtcctg ggctttttca    192120
     gcatgcaaac gctgcatcga ctgggaatca tgggctcttt cttcgtctat ctcctcaaga    192180
     gccagctgga cctccttttg gatctggtcc atcacatcta ggcactttcg gtgggtcgct    192240
     tcatggtctt tctttcgggt gcttttcgct gtagaatgcc cctaaaagct agcgtcagca    192300
     aggtgtagtt ataaacgact gatgggataa agtaaaagaa tacaacgaag ctggagcaag    192360
     tgaaggaaaa acagagatta acataccagc cctttgtgat tccctaccgc cttgagaggg    192420
     ttacgttccg ccttggacct agaggctgtg gaccgagcag aataaggcga aggggcacat    192480
     gccctgccag tcccgggttt cgttgtggca gtaccgcggt ctgcatctcc ccgagagggc    192540
     ttttggtcct ttgccatgct gaatccttcc gtctggtgaa tgattgcagg tttagaaaga    192600
     cactgggcaa agcgaagaaa tgattgatcg cagtggcctt cggggagtct cgactttaaa    192660
     agtttaggtg gagacaatca aaagccctga aacaaggtga acgcgtgacc tcccccctgc    192720
     caagcagctg tgtcggcatc agcatcatga gcctgaaagc caagtaccca ttgacacaca    192780
     ggggccccac ggtgcgctag cgcaaaagca caagatctgc gattttattg tgaagaaagt    192840
     gatcgaccgc cgcgcaccgg gatctacgtt gaggtatacg gttgtgcctc agtattgacc    192900
     agagccgaac catccgagcc gctcttggaa acaagaaggg ctctctggcc tcagccatgt    192960
     gtggtgtagt tgtaccattg tcctagatgt aacttccact atttacactg tcccgctatt    193020
     gcaacaattt cggaaagttg ggccctaaag acttccattt cattcggaga agaaaccaat    193080
     ccagaaatat tagggcatgt attatgaaac tagaatttgg aatccaagtt ggaccaacca    193140
     ttgccactgt cgtgctaaat tttccttcgt caaagctcac cagggttcca tagctgacca    193200
     tgagacttct agatcgtgtg gaaaaagcca tagcaggaac ctgggcttag tttccggggc    193260
     aaccatttga ggcatttcaa ctaccaaggc tcttgagctg gggtactcga cgatcgccat    193320
     tttaccccgc gagattgcaa cgctactatc acactctggt aagaccctga acaaaggaag    193380
     cacttgtagg accaatcaaa aaccgcttgt gaatatggac cgatgatggt acggtcctgt    193440
     gataaaaaaa actcggcgat gacccacggg acaatagatc aaggaggttc tatttgtaat    193500
     caagagaaga aatagcaaat tttttcaaaa aggtccagac acgattcacg aacccagtct    193560
     cgacagacca gtaatgatgc aacatacctt tgttgcttgg tcctgctgaa gggaccagcc    193620
     tcacaggtac ggcagttgag gtatttggaa tatcacgcag gtgtccagca aaagaatggt    193680
     acgctgaaag caatccatgg tcgggttctc ctacctcctc tcacaagaaa ataacttggt    193740
     cctccgtcga gtggcgacct gttggttctc gttagtctcg tcctttgaag gatgttcaag    193800
     aaggtatgta acttcttctg tactagcttc cccaaagagt atacccactt cgaatgcgaa    193860
     atctgcgctt tctatgtgct cagattcgat cgccagtctt ataaccctag cagacagttt    193920
     ataaacattc aacggatgga tcagctggga ttatataagc atattttttt gggttttgcc    193980
     tgaaaagccg agaaaccgat tggctcacgg aaatggcaag gtcccactcc ttttccagca    194040
     tccggctcat tctacccgtc ctcagactct ggagatcgag aatattttga atacagtagt    194100
     gctatttcat aatattccaa aagactacgc ccgtagtgag catacctgat tcttctgcat    194160
     tctcctataa ctgttggtac aacctcaacc atgactgatc tagaaagcag gtggagcaga    194220
     actttattgg taaggtttcc aatgagatcg ataaatccta agtatccatg gataatttca    194280
     tcctctcccg aggcagtgtt tccatggttc ctcgaaaatc atttgtcaag attcaagatg    194340
     aggcgatcag tcatgggccg acgatcccgc cctcggtttt gcagtcgtcg tgaaactagc    194400
     cctatgactt gagaatggtg ggaaagcttt ccttcacgtc aaaaataact gtggcatgga    194460
     ttgaaaatca attgtatgcc tcagtcccaa ctacaaatta ctctggtttc gacatagcta    194520
     acttacccgt tagacccatt cagaccactg ggaatccagc caagcataat tctcccaaga    194580
     cgataagagt ccagacgttt ttagagcttc caaggagccc cctagctacg atgtcatgat    194640
     ctcattgcgg gggcagtttt cggttcgaga ggcttttata aaccaagctg ttgatcgttt    194700
     atcctctata cttctagccc tctttgtacc cgttaagcct tattagacca tggatacact    194760
     catgaccagc ctgccaccaa atgttggggc cattctcatg gagaacatct ccatcatcca    194820
     gatcgtgtcc atgttctcta tcggcgcgta caatgcccta gaaacagcga ttgtcacgtt    194880
     cgactcattc aagcgctacc ggggcctcta tttctggagc atgcaatttg catcctgggg    194940
     aattctcgtg cacgccattc ctgctatggc tcgctttatt tctcaggcgt ccaacctccc    195000
     gacgtccatc cccttcatga taggatggta cgccatggtt accggccaag ctgtcgtcct    195060
     ctactcgcgt ctgcacctcg ttttctccga catgagaaag gtgcggtggg ttctatggat    195120
     gatcattaca aacgcttgca tcctacatat accaatgacc gtttttttct tcggcctcaa    195180
     ccgcggcgat gcacgctttg ctcgtcctgc cgcgatattt gaccggatcc aatcgacggt    195240
     tttttgcata caagacttcg tcatctgtgg catatatata tatataaagc ggtgcatcat    195300
     ttcaagagtg ccattacaat ccgcggtcgc gacggccgca acgccattat ccatctattt    195360
     tgcatcaaca tcctcgttgt aatcctgaac gtcttactac tcctcgcgga gtacaagcta    195420
     cactacattc aagtgagctt caagacggtg gtgtacagcg tcaagctgaa gttggaattc    195480
     tctgtgctca accgtctccg gttgctgaca agtacgaacc cctgtatctg ccagcatgga    195540
     cccgaggaca gccgtcgatc aaacgataag aatatttttg gcatggcctc ttcacgacca    195600
     gttatcgcac cggatgtgag ctcgcaatct ggagcaaccc aaaccgatat gccacgttcg    195660
     ttgcgaccaa gcagcatcta tggatacgat gaaacgctan gcgagacatc gagcgagaat    195720
     atgatgcccc ctggagacgt ttattcttcg gcaacactat cagagggcca ctcaaacacc    195780
     cttccgggtg gctcctcaga aaccctgcct gcgctagaat tgagcctgtc gcaattctcg    195840
     ccaaagttcg acgtctgagc attccacgag ggagtactgc tcgtttattt cggctcatca    195900
     acggcggtgc ggggatcttg tgcctttatc ccagacaggc ataattccgt acaaccttgc    195960
     tggttagtag gtggcgacat ccttactgag gcgcttgatt ccaagacttt ttagacggtg    196020
     tgattgatat cgtgcctaag aggatgctgt tcttcgcttg ttaagcnaat gtcgtcaatg    196080
     tcggtcggcg cgataggcca ctcgcaggan gggntagaat gggaaataca tgtacagatc    196140
     agtgatggag tatacaaggg atatgtcatc aaacaagtct cgtactatct gnacgcaaat    196200
     tcgttgtcca acgatgtttg ccaagatgcc tttcggtttc aggccactgg aggtaaacct    196260
     gattgagcaa ccaggccctg cattgaaatt cgtacttgga acaatcatgg aagctgaggg    196320
     aaggcttagc gtaaagcaag gcaattatta tctgactagg cgagtggaaa tcttgaactg    196380
     tgatggagtt ttatttacct ctgattccta aagaatttac atttcggacg atgaattcat    196440
     cgttagtccc ttcagtggaa gtgaatcttc atatccttta acgtgatcaa ccaagtttgt    196500
     aatacatttc cgcagcattt gtaatggaca tgaataataa ggttgatcga ctnngaccaa    196560
     tcttcggggc gcagcgcaga tgttataatt cataggacac gacggaagcc ctcggaggtt    196620
     aatcctacac atnagtgata ggggggaatg actttgtgag ggacataagc tgcaaggggc    196680
     ttggctgaac aatcaggata accctacaag ggtacccaat tgagggtgac acttgttgct    196740
     agcatggaag atagagattc acggcttgga ctctgggtcg cttagagaca tttgaatggg    196800
     tgtaggatga tagtacttct agaaatcaat ttagtacctt tctgacgacg agatcgatga    196860
     tgcagagaac ttactaattg atgttgggaa agaggccaat cttttgtgtt tgagaccaga    196920
     acgaagatct tcccggattt cttcatccga agaangaggt ggatatcggc atcgcattcc    196980
     gagctatant cggaggcctt tttgaaaagg gactttcttc tcctgcgtgc tttttgattc    197040
     gctgcgtcgg ctggtttggt tttaagttta ggttgaacat ccatattgag attcttcgct    197100
     ggctctgacc gagagcggac aagaagtagg aggataaaat caaggaggaa ttgagcgggc    197160
     aattctagga ttcgagtttg ttcgtagtga cttgagacat aaatggtggt ccgtggcgag    197220
     cgccgcactt ttgtgacagg ggaaattcaa cacagggaca gaatgttagc agcattggtc    197280
     ttcatagggg atgttggttg gttaagtcca tcgttgaatt cgtgccagat cgtacaagga    197340
     gtggtgagtc gacccgactc acttaaacgg ggaactccat tttctattcg gatgtgagga    197400
     cattttatca caatgatggg ctcaccactt gttccggtca atcggtagaa tcacattggt    197460
     ctcgtctcga aagccaaatt tctacctgct gcggcgcact ttaagccaaa agaacagcac    197520
     aactaggctg cactgtggtt tcgtgatgga ctcatataac cgcggcagcc tcaacagttc    197580
     aagcgtcctt gcattcatgt gcacttcgga gatatataag cggcagcgaa acctagtata    197640
     accttcagct acatgataac taaccggtat ttgatcacag gaggccatct ccccttttac    197700
     tatgatactc gtgacatggt gtctactttt gcaggcagtt gcattttcgc cgacctatgc    197760
     gcacctgaga atgacctctc ccgaacccta cggatctagt agaaagacac ttgacaactc    197820
     gccacttgct gcagatggta gtgactttcc ttgcaagata ttccccaggt gactttatcg    197880
     ttccgactga agaggcgact tatcggactg ggagcaataa ttccatcaag cttctgggca    197940
     gcgccaccca tggcggtggg tcctgccagg tgagcctcac cagtgatcgt gagccgacaa    198000
     agaattcgga atggaaagtt atcaagtcct acgaaggggg atgccctgca aaaggacccg    198060
     gaaatcttga tgggagtgcc gagtcggacc attctctcca actccacttc gcgatccctg    198120
     acggtattgc acccgggaaa tacaccttgg cctggacatg gtttaatcgt atcggcaatc    198180
     gagagatgta catgaactgc gcacccatca ctgtggctaa tgagtcgccg tcaaattcgt    198240
     cggacaacac acccaaacaa tcgctggatt ttcctcctat gttcatcgcc aacgtgaatg    198300
     gttgcattac cagagaaaat gtagacattc acttcccttg gcctggaagt attgttgaat    198360
     ataacggcga cagcaaatat cgcccgcaag aaggcgaacc ggtatgcacc ggaaatccta    198420
     cattcggccc aattcccatt accgatacag ccgacaccgg cgaggctagt tccactactg    198480
     aaaatgccaa ctcgatgcct tgttcgtgtg gctgccaggg tagctaaact tgtataaata    198540
     tcctgatgag caatgtggtc ctgcaccgca gagatatata gacgggagcg ttcagaccca    198600
     tctagctcaa tccagatcgt ctgtgaagtg gaaaattcca gtctaataat attcacctct    198660
     ctttgttgat tacaaacctg gtttcagtat tatagttcca gcggggagca catctgcgag    198720
     ataatgatag tattttgccc agcgggtatg attatgtgac gaactgaggg agtggtcaaa    198780
     taccactagg acccttcggg actggcttat tcatcgttca cccaattccc cctagtattt    198840
     gtacggtatt ccgggcacat tcggaagtac ggtgttgtaa cacacgccga agcttatttg    198900
     tatagtcccc tgagatcgtt caaccgatct taagacctcc aatcaatcat ctggttctat    198960
     tggacatgtt cagtactagc cagtacatca attcctcatc ctgacatcat gtctcaaatc    199020
     caaacagaag caacgaactc cttgtgttac atagacccta gttaaatagg cgataaacga    199080
     atgcaaacga atgcaaataa attgacaata ccgatgggtc atataagtaa gaactgatta    199140
     taacaacagg tcgcaaattg agtgtagtcg aggggctaca ctgagcctac tatatttgtt    199200
     cgcttgaaga gcgtttgcaa actaccaccg tcggaaccat gctccatcta ccaatctgcc    199260
     gtacctggct ttccttatgc accaataata atatactgtc tgaacagcac agatggaaaa    199320
     taggatcgcg ggttccttct cgatttggta ggcctcaaaa aacagccaag caaaagccaa    199380
     tgagtttgtc cttcagcaac gagcatagta agatttgata ccgtgatagg cagtcttgtt    199440
     ggctatactg accaacaatt tcaactctcc ctcgcatgaa tctcgggtaa acatctcatt    199500
     ctgtcacatt agccgagaac atgatgagac agcatgaact tacctgcaag atttcctcga    199560
     cggagatact ttccagttgg caaggtaagt tctgaatctc cgcttcccac tcgtatgtac    199620
     gatttttcaa catcaatttc gtgacaacat cggctagagc gcataatttc atcgtcgcag    199680
     gattcatttc cgattcttta atttcgcagc tattctcgac gcccactatt gaaagtcagt    199740
     ttttatcaat tttcgcaata tccgcggata cctcactaat cttgacatca ccagactgcg    199800
     taagcaggat tgtttccggg cctagggtag cgagtgctcg cccgagcccg cgcagatatt    199860
     ggattccttc taacacctat cccatgttaa tttcaaatgc acctgcaaga gattttaact    199920
     gactcaccgg tttgacaatt ccaacgagtt cgtcggtggt gatcgagcag ctggaggcta    199980
     aaatgtggct gactgacacc tctgttggtt cccagatcaa cgtgcacgat acatcatgat    200040
     gataacattc gagcaatttt aggaagcttg gatggatgac ttgttccatc agctctagga    200100
     aacctgtggc gggagagaac ggtttttcaa gttgttggat atgcaccaac ttgccttttt    200160
     ccgacttatt tcgggcgaat atcagagaac gatcttggga tgaaccagca gcaggctcga    200220
     aagtatccca tgggttctga ttcagttgtg ggatgcttgc acttgggcga tccgggtgtg    200280
     gctccattga acctggtgtg atcacggcgg tggccatttt ctgtattgtt gggggttgga    200340
     tatgcggaga cgccgttgag tttggactca gctgctgatt gcagaaggcc gactcatcaa    200400
     gccacacggt agaaggccgg gtgtgtttgg tctgagcgcg gttcatcatg ttgtgttggg    200460
     tttgcagcgt gaaaaaacat agcgaggatg gacaagggtc aaagaaccat ttatagctcc    200520
     aagatattat tttgacacat gaccttcgtc ttcgcaatgt cagtccgttg gtaacaacat    200580
     aacgacgttg gatctttaag tgtggtggtg aattgccgca attatagtag gttacggtga    200640
     acctctgttg atcgggattt ccatcaccgt caattgaagt gtggaaagtt gaggtgcggt    200700
     tgagcggcat cagaaaatag cttataattt tcagtttatt ttaaaaggtc tactttcaac    200760
     atgttcagat gctgttcccc ttgaatatcc aacattgtgt tttccttttt gctagagtct    200820
     cgctgcagaa aaggacaaca ggaggtaaaa ttattcctgg acagagacag atatcgtgag    200880
     ctagccctat tctgctcctc cgtggaggat gttgagcaaa ttaaatggtt cgacgttcat    200940
     caattatttt gacaactagg aggagcagat agcataaagt aagccatcga gtggtcgatg    201000
     accacaccac atttccagac ccctcagccg gtagggtagg tccgattcgt gtaggggcag    201060
     gaatatgagc tgttgtgata gcctccaccg tacccccagt tggcagagtg aatgttggaa    201120
     ttatcaaagc taagggcatg gcggcgttgt tccaggaggg cgtttgggtt gtcttcatgc    201180
     tttgagtgga cgccatttcg tctccgacac atgcgccgac agtagggtgg gtcgtaatta    201240
     tatcacgtgc aaaactctcg gtacttgaaa ttgtcaaccc ataaacatag caatgtcggt    201300
     aacgttggtt gatcaacgta ctggttttgt acgtgaggca ctgtttctgg cgtcacggta    201360
     gtcgttggga ctttggtaga catgtcattt ggcccaggct agatttgatt cctctatcga    201420
     aaacacctgt ctcctagcta tgtcctgctc cgtggattag agatagtgcg agggaatggg    201480
     gtttgcgtgg tgggggcttc ttaccgtacg cactggcaaa accggctaat tcccaagaga    201540
     agcgcgtttt gggtgatctg cctgaggata gaactcagat atttgagtag aaaggggggc    201600
     tcacaaaggc ggttggccta atatttacgc tctctcatat ttcacttaca ccttagcctt    201660
     taaataaatc atgctggcac taggatcacc aactacccga aacatcaacg ttagttaata    201720
     aatagcttca acggtatccg gatcatgcgc aataatatga attgttactt aacacgtttg    201780
     actacccaaa gtttctcaac atggctactt gaactaaatc ttgttgcact caattaatgg    201840
     cataatttaa gagcttggtc tgttagcaca gcttccgtca ccgtatggca tgtgcgtaca    201900
     tagcttccta tagctgtcat attgaacaat ttctttgata tttcggggaa tcacagcata    201960
     ttgatctggg gaatcgatag accaaaactt gagatattaa atttctcgaa acataccctg    202020
     tctataagct tgtttgctaa caacatccaa catcaggtgg aaagttcgtg tatcatattg    202080
     tgttttggtg gcaaaagaaa atatagccgg cttctagctt ccttgaattt ggctgatact    202140
     attgctttgc taatacagac ttctattcat caagatggcc atttctaaaa tttgatgatt    202200
     tttactggaa gatgagatag actcgcagga agtaagagta ggatttaaca atcaacatgc    202260
     cagcaaaaac caaagtaaag gttctttcga ggtacataaa caatagtata tatttactat    202320
     ctacagggtt atggttcaat ttcttttgga aagatgaagt atatttggca gaatgagaag    202380
     tgtcaatcta aataaaagca tgctatctat cggtctatca gcaatcagtc taaccattct    202440
     atcgagcgcc atttaggcga tcttcaatct actgaccgcc gagggcttcc gtacgaaaat    202500
     ctcttttacg attgaacatg ctatctttct gggctcggac caatttcctt agataatagg    202560
     gatacatgat gaatattgga tggaaatcgg aaaactgaac aagaagtgat gctgtgagac    202620
     agggatggac gagaggacta ttgggcgcgc ccaaacgtcc acatgcagac tctttgtgag    202680
     agttcacaac taaaccctag aagcaaaagg gcttccgcaa taccggaatg agagttagaa    202740
     taaaaaagga aaagatggaa aataccagtc tcgatgcaac ggtgatactt ctgaccaggc    202800
     tcttctccgt gctgaaaacc ctgatatcac gtatcaagag cggtggatgc tcgagaacgc    202860
     cggatatcct catcttcttt cctgacccgc tccagcctgt agaacttgta aagcgcaaga    202920
     agtgctgaac aactcagaag agttgctcca gtaacagcag ttgttataat agccatcacc    202980
     gaccaatccc caccttgaga tgtacaaaca ttgatgacag tggtcagcag cccagcagca    203040
     gcatgtaggc ataggggtct agtccaggat tagagttgga tctggctttt catacctctt    203100
     tcacttggga tttgctcact tacacaaata ctttgttgat cagccagggg tagtttcccc    203160
     tgagctttgg gaaatgcatc agccacatga gagccgcaat gccactaaca aaaagcaagc    203220
     acgcaatagc gagtaacggg gggttctgta tcatatgtag aactgtgcga ccggcctcgt    203280
     tggcttgcaa cgtcctttca acctggttta aggtctgcag tgaagtgaat gtgccgggaa    203340
     tgactagata gccggccagt agtgcccagt tggccgcacc aaccgtgata ctgaaccgca    203400
     tgtccatgtc tgcttcttcc ctaagcattc tggcgtagat agtttcattg gcgaggtgta    203460
     tctggttggc tctacacagg ccgggggtca catccgtagc tgagcaaggc ggaacaagca    203520
     caggttcaat ttcgcgaagt ggcgtctttt ccgatcccat tttcgctggc gtacttgtat    203580
     gatcgttcca caacaaaggc accaaaggag ttttagtatt accgtaagaa ggcaaatcaa    203640
     caaagaatcg tgtcagctct ttaaatagtc catatgaaag gccgctacgg tacgtggtcc    203700
     aactaggtct agaggtccta gtataggggg agacgcattt ttgccttgcg gtgagactta    203760
     cgcggtccgg gttccgaagc caaaaacgaa tggcttctaa cgaaagcgcg aaagttgctg    203820
     cataattggt ttaagcgagc gtcatctgcg aatgcaccgg cggaaggaat ctggtgcttg    203880
     acatattttt ggttcagagg ggattttgag gcgagacaag attatgccaa cttcaacctg    203940
     agcgtcgacc accattaagc cactgcctgt ccctttcaga tgagagcccg tatataaggt    204000
     tcccaatagg cccattctct tgccaatctc tcaatcactc aatctctcta atggctgcct    204060
     ggcttgacct cgtcaaagag aatgaatctt gggatttagt tgataccaac cgcctagaac    204120
     aactagtgca ggaattaccc aatccaaaat atcaatatcc atccctgctc tacttttacg    204180
     gaaattcaaa ccgcaataaa gccttgcggg ctctgttccc ctacaacaac attacacgga    204240
     aaggccccgc aggcttgatc cgtctccatc tcagcaccaa gaccgcccat acacagaatc    204300
     ctatattgtt tgctgaaagc ggtctatgtc tcgaacaaag cttgggggat tccaagtggc    204360
     tcaagaattc aacgacaagg catcaaacct tctcactagg gggtgcagac gggacgttga    204420
     cccctgcaag gctacagcaa gaggtcaaga ggcaactcgt tttaccatgg acccagatcc    204480
     tgtgtttatt cctcgattcc gtccctgaca tccaatccgc aacaaactta ttacagagac    204540
     cacgtcgaca gcttacaatt ggcgatgagg ttgttcccgc tcccctgcag gtagtcatcg    204600
     tcttgaccaa cagtcaacat gtaacagaag ccttcgcaca ggaatgcgct cagctccaaa    204660
     agctcgatac tgggacagtc acgattctgg acctgcgtcc acgtcacggg ctttcagata    204720
     gtgtcgtttt ccagccactg caaacattga tcgttaagca gctcagtata gtccaggccg    204780
     agcacatttc caattgtcga cgcttctcgg cgtctcatct gagcgctttc tggagcacgg    204840
     aggtacaaac ccacgaatgg ctcctgcatg caccaccatt tgatcttttg gaaagagccc    204900
     gaagggacta tgtgaggaac aaaacgatgg acgattgcct tcgagaggtt atgcaaacat    204960
     gcattggcta cccaaaggag gactttgatg accttgtagc ctcggccttc ttgatggacg    205020
     cctatccccc tcaaatgcat ggtatgacca taattcttga ctcatactct cctgaaccca    205080
     actaagaagc taacctgtcc aggattctcg cctaccgtgg tgttcgctga actttatgag    205140
     aagcgatgcc taagtatttg ggacaataag ttcaaatacc atattgctgg cgtttcatcc    205200
     cgcttcgtgc accactttgc gcaattgagc gcagtaaaga catcggcagc cattcgaaaa    205260
     gagacgttgt gtcgcttgta tcgccagtgg ggtggtcttc gctccaccac tacttgtttg    205320
     gtctgtctga gtcgaccccc ggagcatatg ctcccgtgca agcatgcaat atggtgacac    205380
     tttgtgtcgt aatcttcggg aaagccaagt cgtctcgggg agtaccattt cgaggttgct    205440
     caatgtccca tctgcgaaga gaggtccgac gtcaccgttc gccaactgcc tccaacgaag    205500
     ccccctgtga ttctcacttt agatggtggt ggagtgcgcg gcctgatcca actgggcctt    205560
     ctacgggttt tagaaagtcg cattggcatt ccgatcgcat ctttgccgga cctgtgcatt    205620
     ggaaccagtg taggtacgta cgccgagtgg ccgagtcttt tattgtggtt gatatactaa    205680
     gaaacctcct ctaggcgcat tgacggcaat tgacgttttt ctcaatcaat cttcggtcac    205740
     gcaatgtttc gatgcgttcc cgcacctggc gcgaaacatt ttttgtcatt cgtccaaaac    205800
     cccaattcct cgctgtatcc ggtggtttgc ctcggcgttc aacttgacca cagatggcct    205860
     ttataattcc gaaggtctgt cgaagatttt gaaagcagcc gttaacccat ctcgtcgcat    205920
     gttcgatgtc gccaccgcca atcctgcggg ttgccggatc gccattgtag caagccgcac    205980
     atctgatggt aaagcctgcg tgctagccaa ttaccgagga ggaagtccac gttccaccaa    206040
     taccgcctac gagtttctaa ctccacacaa cgaccgacaa aacccttcct tacttgacgc    206100
     gtaagtgacc gtttgcagcc agttgatttg gacagtggta gtcgaccttg ctaacagtta    206160
     gcgtttgaca ggtcgatatg cagtggtgca gcgcccatgt gagtccaaac accatgagac    206220
     atttcaacac gctgacattt tctagctact tccaaccaaa agagttgcca ggcctttgcc    206280
     tgcaagacgg tggggtccgt gcgaacaacc cactcgccat tgctttgcga gagtcgagca    206340
     tcatctggcc catggcgaaa cgacacgacc ttctcctctc tgtcggaaca ggcttctcca    206400
     catctccccc cagtcatcca acgggcatac tgggtcgact ctgggaggga ctcttccccg    206460
     actgttccgg gccatgatgt actctccatc tatggacgga aagcaagggt ttttggaagc    206520
     tctgaattac ctaccccatc tgtcgacgcc tgatattttc cgactagacc aggcaatcga    206580
     tgggacgctc cctgaattag acgatgtgtg ctcgctggaa gcgatgtcga atatggattt    206640
     tgcagttcca gctgagctcg tgaggaccat tctcgcgtcg gcaatgtttt tctttgagtt    206700
     ggatgaaact cccatccagg gtaaggcttc aattcattgt cgggggtctg ttctttgttc    206760
     aagaccaaat cctgccgaga tcttgcagcg ggtgcttgtc gagttccccg gcgccagatt    206820
     taagtctggt caggatcttg atttaggaag catagatcta gtcgaccttt gccggttttg    206880
     tggatacttc aggaagcgcg ttgattttcg ggtcaccagc cttgacgaaa tggtcacaat    206940
     tgaaattgcc aatgatacct ttcgcgaaag gattggtggt ttccccaaat cggcgcagga    207000
     attcctcgat gagcaaaagg cttacgccca gtttggtcgt gcagatcatc agaatcaaga    207060
     atggccgccg cagagatctt gttactgcta tcgtgggtca aagcgattag tccacttcct    207120
     ggagcctgct ttggggcaga aaaggcggcg tttatgaact gggtgaagtt gtggtttggc    207180
     gctcaagtca gttaataagt agaatacaaa atctagttag gtctcgacgg gttaccccga    207240
     tgaaatgcga gacgcacgga ggctaggtgt actctggcaa tatcaacaac aattagaatc    207300
     atatgattat cctagataga agtctgaatt cgaactgcgg gatatgatct gtctatacct    207360
     tgtaacccgt ggacacgtgt tatggtcgcc ctcgtttgtt gaaatctgaa agtgcgagta    207420
     ggtggcgggg cgaagacaga agttcgcccg ctgtcaaaga accatacgac gtctctataa    207480
     taccacccct tagtatggca atacacttgg cgcctgggaa cattggtaaa attcctagag    207540
     actaacttgg tactatgccg gtgctggtct acggctaaga gtgcgcggtt cgtcaacgtg    207600
     gtgagaatgt gaggcaagcc gttcagaaac tatcttagag cacaaattga ctgtttcgcc    207660
     catgaaatgg actttccgtt cttaaaacgc tagtaactcc cgtcctctat gtacgtcggt    207720
     ttcagagagc cgagacgtgg acagtccatg accgatatca accctttcca acatcgaact    207780
     cccggttact ctcgcgacaa cacttcaagc atctacagtc gatccacgga cacagccaaa    207840
     gatgctatcc ctattaatac cataccaact accctacaaa tcaagccatc tcttcctgag    207900
     ataaatttac tggaccacca aatctctatg gcgagcggat ctaccatggc cttggaaaca    207960
     acccggccac gactgagaaa atccaagacc ctgaccgaaa tgtcggtttc cgagatgaag    208020
     gccgaaagaa tgcagcagca ctgtcaccta gacagaatta aatctgtggc ttgagcattt    208080
     tcacggaact tgaaagtata ggagcaattt caggattcat tctttatatt cctactcgtt    208140
     ttacgaacgg tgcagttcgc catgcgcttg atgttgtagg taggatgcgc ggacgacccc    208200
     taagtacttt tgaactccgc gtgtaaaaac tgtttcactt tagagacgaa gtcgtcttca    208260
     acgctctgaa gcactctcct gacagcttcc ggaagcaaaa ccaaccgccg ggctaaatga    208320
     tcggggttgg cttcacccaa agaaatttgt aagcgggcat tgtgttttag ctgggctctc    208380
     agctggtcga actctgaaac cgatgtcttc acgaactttt gaatgcgaca aagtcttttg    208440
     gagctttcga agccagcgat gcatttcgaa aatttgatgg cggcgcgaac catcttaagg    208500
     aatgttttcc gatcgtgggg aatgcggtgc acagctgcgt ggcgaatgct actaatcacg    208560
     cgacgccatc ctgtcaacgt gctccaggtc aactgaaaac attcgtcctt gacttttcct    208620
     tgatggactt ccaagagacg aaagaatttg tgcaactcta aggcctctgg gcaagtccat    208680
     ccggctgcga gagactccga tggaagccaa cgctgaagga agcagaaggc atgagtttcg    208740
     agttgtcgct gtatggcttg caggatctgg tgttgagcgc aaaagggaaa gtagcgagcc    208800
     aaaaatccgg gtagtgagat tatgctttcc atcacccctg tccgaagtgg ttagctaatt    208860
     agtaagcacg ccggttgtca aattcggtga caaacataca ctcatgtagc aaatctttcg    208920
     ggaccataga ggtgactaag ttgtgaattt tagcctttgg gggttttata aataatgacc    208980
     taaactaatg aagcgacatg tagcctgtga gctgctgaat tcccctagta tatatcattg    209040
     ctaaatgtga gaacctagtt gactgaggtt ggggtaccgt ttaagtgggt agaatgaatt    209100
     caaaaattcc tcatgtttct gagtaggcga tagcatcaaa ttgctgcggg ccaacgagtt    209160
     tagattgtga cttcaacagg ggtcggtagc tctctccctc atgttatata tatccccaaa    209220
     accacaattg tattgcaagg ctgcctacaa aagtcaggta tataacatcg aactctttcc    209280
     ctcattcccc ttcacgatgc atatagcgtt tctaaaaaat attacagatg atcgcactgg    209340
     gggtcttcat tgtgggcgtc ctactggtta caattccagt ggtatgactc tttctctcgc    209400
     cgtccgagtc cgacttatgc taacaaggtc actccgtcca ctttcattcc gaacccacct    209460
     catccgcttg tcctcagtca tctgtcttga aaggagttaa agcaacacaa agctctggaa    209520
     gtgtcaaagc catcgaagcg aagactgcct aacaggagag accttccact gctgcttcca    209580
     ctcctgttct gcactggttt cctcggctcg cgatttgtca agagccactc ttaatgaaac    209640
     gatagctcga atcaagcgcg ggtccccaga agggctgttt gccgggttga aatgatactg    209700
     cagagccaga ctttgggttg cgtccattgt ggtgctgaca agttggtgga agctctcaaa    209760
     acacttgcaa taaaaatcgt tctcaagtcc cttggagtat agaggatggc ggtttaaaga    209820
     aaccgggggg gcagaacccg tcatcgacgc gggatgggtc ttggaaggac attgttacga    209880
     tctggtcatt cgatctgatc ggtagtgaat ataggaagga tacttctttg cccaggtgat    209940
     atcagacttt ttatagcaaa atacatacat tttaatttac taatcataga tctgcatctc    210000
     gaatttagtt aaggctctca taggtaaatg gtcaccccac ataccttgtg taaccccaaa    210060
     aacttttacc gatcaaccac accgtgtaga ggacatacag acatacatgt agcatcgccc    210120
     agctcgcacc tagcaacgtt ttctccacca ttagcgtacg cccgtgtatt tgctaatacc    210180
     ctcacatccc ccgaatctac atacataaca attttatcaa ccaaaaactg tcgattacca    210240
     taggtcacag gtcccggtgc aagttccacg gggggtccta tcaattaccc gacctaaatt    210300
     atttaatgta atgtgaatta acaaccctcc ccccaccact tctcttatat cattgtgcat    210360
     gcaccttcaa tgttaggcgc agggcccacc ccaccatctt ttattattct ccctaattcc    210420
     aaggcatttt atgaaattga taaaaacggt gaatacatat atgtattgag ctagaataat    210480
     acttgaaaat atagaagctc tataactgta ccgtaaaggt caatcaacaa catttaaatg    210540
     ttaggcctgt atggcgaaaa tgtccttaag tactccaaag gctcttctgc tgtattagtg    210600
     atttcagtac tttttatatt gcactcgatc atatcacaga ttgacggtcg ctaagttcgt    210660
     ggctatgtat ttacatgtaa tcaatttgcc tcaccccacc ccgtcgatga ctctgcttcc    210720
     cccgcaccta gtatgagttg gcattgaatc gcataaagga ctactgtact gtcctacgaa    210780
     ttcggctact cgggctccag atgatcatcc tatttaaccc tgaagacagg tttagaaccc    210840
     aactcagctg aataaagtga ttagctgtca ccatctgtgt ctactttgga tgcatattgt    210900
     tcgcctgcac cgtgcactga tcgtcgtttc agatcgactt gtacggtgtc caaacgctac    210960
     atagtactag atacgtatta ccactcgtgc caataattct tactgatcgg caatgcacat    211020
     cagcgaactg agactacctt agctaacttc aagtttgcct attcatttgc accgaaggct    211080
     tctttagaag agaaaagatt ttcccatcac cagcaaaggg tggcaccatc cggcgacaaa    211140
     ttgttcccca gtaatgaagt cagtcattca gtcacaagga acactcgtgt ttagtcaata    211200
     tcgatgaagt ggttggaata ttattcgact gtaccaatta gttaactagt gtgataaatt    211260
     ataactacaa taaaaagaat aaaaaaaata aaaaaatgct tttacataat tatatttcta    211320
     aattacaatt agatgctcca acttcttggg gtttattttt ccaagatagt gcatcacctc    211380
     aaatggaagg tattgaagaa ttacataata atataatgtt ttatttagct attatattat    211440
     ttactgttat atgaatgatg atttcaatga taagaaattt tttagctaat aaatcaccta    211500
     ttgcacataa atatatgaat catggtactt taatagagtt aatttgaaca atatctccag    211560
     catttatatt aatattaata gcatttccat catttaattt attattttta atggatgaag    211620
     ttatggatcc tgccgtcctg ctttctcttg caaaacccca tctctagggc ggccaagctc    211680
     tcatcaccct gatcaatgaa gaaattattc agctgtcgga gatgggcgct aaagtcaacc    211740
     tgcagccgcc aacggaagag gacaatgagc atacagcacg aacgcatagc ctagcacgcg    211800
     aagcaacagt agagaacagc gaagtcaacc ccccgccatg ggcgcgaacc cagctccggg    211860
     catcggcgtt gcgatgggca cgggccaatg ctaaacagca ccggaaggac aacttccaac    211920
     agtcgaccac aggccagtta cacgccagcc ggattcggct ctcacaggac ctcacaagaa    211980
     gatgctatat gattgcctga atcgggagaa ggcgtcttta ctagcccaac tccgcacagg    212040
     gcatgccaga ctcaacgggt atcttcatcg aattggcaaa agtgatagcg atttgtgcga    212100
     gtgtggcatc gagcgcgaaa cggtccagca cttcctactt cgttgcacac ggtggaacaa    212160
     acagcgttga gagctgattg agacggcagg gcctcatttt ggcaacctac cgcggatgtt    212220
     aggtggaaaa gcagagagtg tagacgggac aagcgagccc aacggaagag catggaaacc    212280
     cgatatcaag atcgtcaaag ctgtcatcgc gttcgctatg gcgacgcaac ggttgctttt    212340
     tgaaggatga agttgaatga tggctgcatt acaaaagatc gcgcagtggt caatccacca    212400
     aatgtacata ttcaacggag cagtgcacac tagctagggg gttgcatacg acctaaggtc    212460
     gtgaaaagcc tgaggaatca ataatataat aatcgacggc ccgcccgccc ataggcaggg    212520
     tggaagtaac tcagtgcgaa cccatggccc tcatggcctg tggcgaggtc tatcaatatc    212580
     tcacggaagt agtacgaagg cttccttgca atcctaccca catgataaat gtaccaatca    212640
     ccattgattc tatttcgcaa gccattctag tcccattctg atcactcggt gaggttggca    212700
     tacagcctca atccgacagg ggtagtcgat ccagtgccga atgattggct taagtaaact    212760
     tagtcatgtg gtggctttgt gtcttccgaa gtcaaagtca tcacttcagg cggcgattat    212820
     aaccactcga ccttactcta cttcagttct tatatcccag agagcgcgag ccaaagtatt    212880
     tttaccacag agacaaccat gttgctgaga gctttggaca agcaagcaat caagaatacc    212940
     cgatcagctc cttcaactaa gcctcaacaa ctacgaatta tatttgcaac caatctcccg    213000
     tagatgaata tccacgacga tcaaagtgac ggccattgcc gtttgggaag tgctgtccta    213060
     agttcatgca accaaccatg ctctgctgct aaaagaacac gatataaccc caatttgggg    213120
     tctagcaatg ccacctgaaa cgaatttccg tggggtgata tcctcgcagg agtgctagtt    213180
     cgctcgtagt cgtagtagat accccggcca tccttccaaa agcaaccatc acatgagcgt    213240
     tgattgacgg tagaaaattt gctccaggat ctaagggcta gttcaagggg tcccacagcc    213300
     attctgattc ggtgttgttt cggacacgaa aaactttaag tggctgcctg ttcgaaaaga    213360
     gacatgccca ggtgtcctcc acagtgcggt gagcttgacg aatatataat tgattctcaa    213420
     agaacggtcg aggtacgggg cgtagagcat ccggcaattt tttcgcaaca gctgcttggg    213480
     cgtgatgtgc tagaagacga tactgtagta atgctagccg acaggtttta gtttaattat    213540
     agactgcccg gggttagcgg acccaccact ggacctgact aaagatggat actacggggc    213600
     aaaaaaaaag cgtgactggt attctcaaga ttttactcaa tatccacgtt ccaaaatcag    213660
     cgctttcttt ctggaatgac gacactccca ccgattacct ccgagagctc tggcctttta    213720
     cctgatagga ttgtgcagga cattgatagc tcgaataaag attgtatttc atcaaatgct    213780
     caacgctaca gagaaagttt tcgtgaggta tggaatcggc cgactgaata ccgaacggat    213840
     gttcaacaaa atatgaagtc gactgctttg gcaagaccaa gatcatgaag tatgaagata    213900
     tcattttcaa cagcacgaaa acgcgaagga aaacaagtct cacaggcgtc gaaaaagtga    213960
     aatctgctgc gacctaagcc agatgcacag aagagcaata aacagcatgc tgttcgaccc    214020
     cgttcggttc ttgaattttg aattttagat gcaccttttc gtactgaaaa gactgggggt    214080
     cgccggcctg ttattaggta cactcactgg catgtatagg ttcatttttt tgcgatgaag    214140
     tagatgcgtc gattggaaat ggctgcacgt atgttgtata gacctgtcac aaccgaactt    214200
     cgtactggaa agtgtcaatc tcgctggcga acactgggcg gaatggcttc cagcaaatta    214260
     cgtctctccc accgatatac ccgacgcaga taatcgccca gctgaagacc tcttcagcgc    214320
     tctcttttcc gacgctaaga taaagacatc aatcccgaat tcgtccccct caagttcaag    214380
     tatggggcgt ccttcccgac tctggtttct ttagctccga cccttcccgg gaaataccaa    214440
     aaccccaacc tcatgaaggt gtcgaaactg cctcttccat tcagatccat ggtttctttt    214500
     tttgtagatt tctagcgaca gggttcagtt gtgggaaacc tgatcctgga tagctttatg    214560
     aaacaatcat ttttcaatat tacctcttgg atttttgtgc ccgtgtacta gaaagatatt    214620
     ggaaagatat ctcgaagagg atacgaaagt gaatcaagat aagttcacga agatacctcg    214680
     gatgtaagta aaggatgctg aggatactat ctttatgttc acggaaccgt caacattagg    214740
     tctattgggc aatcagcata aaacctggca aacaagggtc agcaattatc ccacaaaata    214800
     gcctagtcta acacgggcgc catatcgttt ctcgcgataa ttggccaata gcgcttttat    214860
     cccacaatcg atctgatgtt atcccctgtg ggacggagac ttccgtgtat cctccggtcg    214920
     actggcagat atcggagtgg accgtaaaac aggttctgtc ttgaaccttg gctctcatcc    214980
     ctgtgttata ctccaacccc gacgatcgat gatgtcatcg atttccctgg aaccttgtct    215040
     tgataaatta taggtcgcac agctatatac tgcttaattt gaggattgac cacgcactat    215100
     ttgaccaatt gatcctagtt aagcgcaact acgcaccacc cttgctgtct ggcaattcat    215160
     tatctgcctt cgatagttaa gagacgtttt caagccgaag tctgttgcta cattatatta    215220
     aacgccgggt ccagatatga acgacaacag aaccatgaac aaccgcacaa taaagaaaat    215280
     agcatttcag cgacgataaa tctcggttag cgatcaagaa cgggacaaag ttcgtgaacg    215340
     aaaccgcgtc gctgcaaaca agtgccgcca aaagaagaag agagaacacc aacaacgtat    215400
     ttcactaccg agtcacccca tccaacttcc taaattcaaa tgcatttatt tcaaccaaaa    215460
     cgccattaaa ttaaaataaa aagattcatc atctgtctgg acatgcatct ctcctatggc    215520
     cctggttttt gcatagctcg catgttggta atgctctcgt tcgtggctgt aaaggtggcg    215580
     aaggccttct tcgccggggg ggtataggta cttctattgc ttccaccggc cgcataatta    215640
     atgcagatgc ttcgtgaact gtaaggcctt cttgtacagg tatctgcctc cgggtctagt    215700
     tcgcttttgc ttctgcttct cgttcgcggc gcgtaagctc acttctttct ccggtaatgc    215760
     ggcggattgc atcgtgatct ggcagctttt aagacctggt ttatagcgca actgagcggg    215820
     ctcggggggc ttcttgatct tatacgaagc aatcttggat cgacgaagct tgtttttgca    215880
     attgtacata gttcgagggc gtttttggat cccaatcact accccggcta gaaagggggg    215940
     ggggggtggg ggcgggtgtt cgaagccgaa tatcaagctt tgcaattact ctctccggtg    216000
     agaaagggac taaaccggct gctccaaagc tatttttaac agtctcagat ttaaaagcct    216060
     ctattcgtgc aagagagtat gcttcgagga agtgaaattt gtcgatatga ttgattccgt    216120
     tccgcatttt catttcaacc atccggccgt atgagcgttt taacaccgca aaacagccga    216180
     tatcgagagg ctgtaaaagg tgagaggagt gcggaggcat acagattggt ataatcttat    216240
     ttccttcaca gatttcatcg aacctcggag ttaaatgact tccgtggccg tcgagtttta    216300
     aaagccgata ccgcccccac cccccctcgc cttcgtacgc gaagaagtag tagaaataaa    216360
     gagcttttca agccagcgaa gtccaatcca tccattagga ctaacctcaa ttcgccaatc    216420
     ctccgggagg ccgtcgaacc aggattcaat aaaactttgc cttaaaaaat cacatacgga    216480
     gggaggaccc aaccagcagc attcgtacac tcaataaccg tcacccattc tcgatttcca    216540
     ggctatacaa gtgctcgcca actatagaat tcgcttctcg aaatcacccg tgtagtagca    216600
     gtttaagcct atagcgaaac cggtctcatc aaagttataa acatcgtccg ggtcgacccc    216660
     aaactgtaag atagattttt caataagatt aaaccactcc cctacgattt tcggatcctc    216720
     ccatttcgca cgctcgtaat tataacgttt cgagaatcga gaggagggaa gaggacgtcg    216780
     tttaaccaat ttcgtaaccc aattttcgcc aaccgaaaga accggggtag atccgcgctt    216840
     tgcaagaaga ttcgccattt ctcgtacagt agcaggccgg gggctgctcc acgtagatcc    216900
     atagagaatc catttttcaa gagattgctc ttcaatttta gtcagtttat atgagttagc    216960
     acgtgaaatc gcccgatttt gaacaccctg gaggcggcgg cggagggtag cctcgggcac    217020
     actaaaatgg cgcgccgctt cacgaattga agggattttt ttagttctta aaatctttgt    217080
     atagctaaca agatcctacc ctcttgctta gttgaatttt tagaggatcg agaacgaatt    217140
     ggtggcatag tgggtggata aaagagagag ggttaaatta attgacgcgt tttgggtggg    217200
     gtgcgtcact cggtggtgtg cgtcactcgg cagtgaaata cgtcagtaaa tactagtggt    217260
     gacgtatgcg atctgcttcc ggaagctaat tttctcgcgg aggccctcgg aagagatggg    217320
     tgctggcgta ggggttaaga gggtggaagt gtgctaatcg gtttaataca tcttcacttc    217380
     ccggctgcca ctagtagggg atgatattgt tgtagtccag aggtatattg attgtttatt    217440
     gtgccagagg gaataacttc tcgaaaatat tgtgtttggc taggtgcgtc ttcatgttgg    217500
     tcgtcgatgt tgccctcgcc gaatctgtgg ttttccagcc acaataaatg cattgaatct    217560
     ctcgatcctc gagtagctgt cggcttcgcc taggtcgcca ttgcttgccc ggaagaggac    217620
     taactcgaaa ttggttccaa agccattgat tcagtggctt aatgcgggat ttgctgtgcg    217680
     atttgtatgg ccgtatggcc tctgcaaagc atctagggcc cccctgatgg aacagatgcc    217740
     gaaggagtag gtagattgag atgcagctgg ctagcggagt cttcaggacc aatcgattct    217800
     aagcgaccgg gtggcgaatc cagtcggggt ttctttctga tatgatcttc ggtatcgtct    217860
     tcgtcacttc caccatttaa gaagtggtag tctattctct gagaccgttg ggggcgtggt    217920
     ggcaattcga cagatgagct gccggagcca tcattgtttg aagcttgcaa ttcagcacca    217980
     gacattctat taccgtcatc gaaacacgtc cttgaaacaa acttgtcaga ttcggacgcg    218040
     acttgtcact tggataaaca aactgcacgt gatatacttt ctcttattgg gtgagagttg    218100
     gtcttggcga cgggccaata ttcgtacgaa tattcgaacg aatattggcc ttgcgaatac    218160
     gaatattcgt agaggtctgt gaactacgaa tgcgaatgcg aatatctcaa aatgttacga    218220
     atatgtattc gtgccgaccc ctagctacgc ataaatatga accctcgaag tggagataaa    218280
     aggcgtcaga atctgggttc cctgaaagct atctggctcc taatagcggc ttctatgttc    218340
     ccacaagctg taccaaagcc tccgggtgca agagaacgtc tagagccaag gtatgtgttc    218400
     ccagggccga tagccagatt gggcgaagaa tgtctggcac ttacaatgtc atgttttctc    218460
     cttggtatac atttatgacc agcccggtct aaccacaatt atgattaggg atagaaattg    218520
     atactgagtc tccagaacgg agctaaagtg atggtagtaa ccctgaggaa tcactagata    218580
     gaatgtgcag tataacgtgc ccagatcgac aatgacacat gcaccagttg aaatagctct    218640
     tctagcgcag ctcactccac agtctgtcgt caaccctaga cccgtgctca tatggatatc    218700
     taacatacaa gtccactgag agtggtattc gttgagctgc actcaagagc ggaaaccgca    218760
     acctaaaacc atgcacatca tcggacgcgg agaaaaagcc ccacattttc cgtaaattca    218820
     tgatgcagct gagtcacata gttagcacct gcctgacaac tacagtccgt gccgctgcta    218880
     tgcgacgact agccgttcga tttgaaacaa atgcgaacaa atcgcgctga tgttctagcg    218940
     gctggctaca gtaccagcac cccttataat gctaccaggg tacatccaat gggcaagccc    219000
     aagtcgccct tgatcaaagc aaagaacggc gaggcagacc atcaagaatt aagatacatg    219060
     aaagtctgtc taggtcgctg cagtttcagc acccgaacct ggacaactct aggccaaagt    219120
     atcctacaaa gaaaaaaagg ccggggagtg tccagatggg ataagcaaga agagccttaa    219180
     ggttgggact ccaactctta agtgcagatc agtattttta tccacttcac ttgcattttt    219240
     acagtaaacc caagcgagtt tgacgttaag cggctaacgc ggcttctcca acagattgga    219300
     aacacatgtc ggaatgaacc aagttacaat agagtgattg ggattccaaa gctggtatgt    219360
     ggccctgtcg atcatgagct cgttacatcc cacattcgcc ctacgggttc cgtgagtctc    219420
     ttaacataca taaagccccc gtctaagaga aatgtagccg agaggcttcg ttaacacatg    219480
     gtgcgcaatg gtacagtgtc agagtttata atcagcagca gacagatgat ccaggaaagg    219540
     atcaacatat tccatcttag tttctgacct ggctccaagc atacctctca cgggcctttg    219600
     gaatgccttg aaaataaaca ttcacatcat ggcctgcaga atgttgcggc ctctggtgtt    219660
     gcatgaatcc gattcgttca agatcaacaa ttgcaataaa ggcagcattt tccctgctga    219720
     attgttttaa ctatatctct tttgatgccc actgcagtaa gtatacgaat tccagcttta    219780
     taaaacttgt tcgcatactg accgcgactt ccgtacatta aagatgggct ttttaacgtc    219840
     aaaacaatgg cagatgggat cactttgccg cattcaacca gatgtcaact aatcctgcta    219900
     ctcgtttgga ttaattttcc aattgctgtt actggtggtt ttgttgcatg gtcgctttct    219960
     cagggcatcg gaaatggggt cgcctggttt ttgggttggc tgctgctatc aatctgtatt    220020
     gccggcatat tgatatagta attcctcatc cttttgttac tccgccatac tccaggacgc    220080
     acttgtacaa acgcatattg acgtgttcga tagattttaa gacgtggttc ctcatcaggg    220140
     gtgcaatgag aacggggtac gtttaggcgg tggtacacac gaaccaccag tagagttcct    220200
     gcacgtcgta attgttgcca gccacttcaa gcagacccat ccacaaggcc cgtcgcctct    220260
     gatatgatgt attgaatcga caggaaggag ccgttcagat atcaccgcgg gtattaccgt    220320
     gaatgtcaat tattaattgc ccagtagatc gttgtatgtc atgtgtctgt attgaaccaa    220380
     agaaaaggtg accttttagt tatttcaatg cttcaagaaa tcttagattt gcgccttgca    220440
     agtaacttag gaacggtctg tcgggaatcc gtatgaataa tttgtggaaa ttgaacaaga    220500
     cgaacaccat gattaggttg attgtaacag tatctttgga attcgattta atttccgtgc    220560
     agttaagggt tattctgtgc ctcattcaac aaaatcttca gctagattat caagatgtat    220620
     tgccctttca tatccgaaag aggcgagagg cataatggtt tgcgcaatcg actaagtatt    220680
     ggccaataca atccgcgtag gtttacttcc tttaaactgg tgccacggaa ggcaaaggcc    220740
     caatgcgccc ttcttgtaaa tgacattcga gggaactttc atgttgaaca ttccgcacac    220800
     aggagacacg ccaagttgcc tttccctaca taggtgccgt gccgtcttgc cgttgcacgc    220860
     taatccagat aagccaataa tttggccacc aggctcaact cgcttcaatc tggaatatgc    220920
     tgtcgtttga aacagtgact tgatcaagag ccaaatttat ggcgagcgcc tttcacatgg    220980
     gtcctacatt attagtgcca ttctgcctca cgctgagtga gaccctgcta ccgccgtgta    221040
     tcctttgtgt cgcgggcgac atggcagaca ttccacgtca tgccacattc cagctagaag    221100
     atcatgattc catgatagaa tggaattgag accctgtagg gctttagtgt ttgtgtctgt    221160
     ttgtcgtcta tcgcacgcgt gtataaaagg gatgagtttt ccaagtcttg tgcgtttgat    221220
     tgattggtat ggtgtaagtt cgactgtaaa aatggggaaa ttagcccaag atgtgaacgt    221280
     ccccatctca ggaccagatc gaaagtcgat tgaaaaaaac caaaacttct ccacttctag    221340
     tgagttgatc cagtgagcgt acgatatctg ctcacacggc aaaaggaccg cggcagagca    221400
     gtagacgaaa gtctcaccaa cgatgtgtgc atcgacataa ggtcaataaa actctgtcat    221460
     ccaaatatgt gcccgagtta ctgcgaaaaa agcacaaatc tcgcaagccg accggccggt    221520
     atgctcagac cttatatcca acagcaacgc cgtccgccaa ccggaaaaga gagaaaagct    221580
     gcgcgcaaga cgcatctcca tgcttgcgcg caagtctcaa aagatattcc tcggggacag    221640
     gattggtatc cgaaggccag aaggaaactt tgttttccta agagaggcga ggaactcaga    221700
     aagagagaat catcaaggaa aggcaaatgt ccggtaaaat ttgttagtgg gattggactc    221760
     gtgtctgaac aagatctgcc acgtctacca tgaaatacag tatttattgg gctatcgtca    221820
     cggctctcgt gccttctacg tatgccctat catgggcaat taggtaacac taagtttgct    221880
     gtctgctaat aacccgcagg ccaagagtag atggatggac ggccgctgtt ctggaagaat    221940
     ttcgggtcga gctatacgtt gaaccagaca gaagctgtga atcgcgtcgc tgttgttgtt    222000
     ttcatgcttc cgtcgtggcg cacgactttc aaaatcgttg tgatgcttcg gcgaaatcca    222060
     agacagcttc cactatcttg gtccgcgaaa cattgtcaat cttacctcgt tttcttctcc    222120
     tggatcccca gtagggctga catgctactg aatccgtcgt caacgttcgg aataaaagta    222180
     tgattctatt tatcttagcg cgtttcttgc ttctcggaag acgctttgca aggaaattca    222240
     ggacgaagta gttttctacc cgcaacgatt cccaattagg tttttacaag tgtcccgtgt    222300
     ctaggtcgca caagaacgat acatttactt agtgtttccc atcaagatcc acattgttca    222360
     tttttcgatg gtgggttgaa ataacatatt aggctacagc agaattcgaa ggcagtttac    222420
     cctccaagtc caactgcaat atacatgtac cgtaccaagc tagcgatatc acttattatg    222480
     ggatgccgga aattcgcata gtacagatag tccgagtaag aggatgcaat actacactta    222540
     tagctgtcgt caacgataca atacaggctc taaagctcaa cactgagtct gcaatcattc    222600
     aagtccctcg tattgcacat gtgtttcaac tcagtctaaa tgatctgctt gggaagataa    222660
     aggcttcacc gaagaacgac aacgcggagc tcgagtggaa agaggatcgc gtacgagccc    222720
     tacaagcgag agattgccga cacactaaac aaggttagtt ctcttactct ctagttatac    222780
     gatgatcata cttatatcta tatgttcaag gttcacagtc ttgctatcta catcaacgca    222840
     agccctcaac gcaagccctt aacgccgcgg cgctttctac aatcttcaac ccgacgagcc    222900
     aaagctcgtg cctatccagg atgtacgaac gagatggaat tcaacatatc ttatgcttcg    222960
     gcggagactc caagcaacta ttgacacatt ctgctcgtag tacggtcagc ctcattttgc    223020
     actacacacc gaggattggc gacaaatcga ttatctgcta ttcatcctac agcccttctt    223080
     caaatacaca accgtcgttt gtaggactaa agacataagt attcacttgg tctttagttt    223140
     ctataatagg cttttcgatc atcttaaact tggaagcagt tgatgcttgc tttcctcgct    223200
     tgaggctgcg taagagaagc tagcaaagta ctacgctatg accgataata tcgaaggcga    223260
     cctctacgca attggtacga tccttgcgcc agcaaacaag ccccagttct tctcaactaa    223320
     ggactgggag tccgatgatc cagagaagga ctataaaagg atctatcgtg agagtctcga    223380
     gtctttcttt acctcgtact acgagaaacg tccggaagga aggctacaaa atcggacgca    223440
     aaattgtcaa tgacaacaat gacagacgcc gatctactat ttgaagactc gcaagcgtca    223500
     ctgcctccgc aacagaacga gcttacaaat atatccagat aaatccgttg gagtgctcga    223560
     aagaagcggc actcgcgttc catttcgata tcatcgtgtt atataatggc ccgaagattg    223620
     cgactggaag gccaacacag acatatgcag tctcgtcgag tctctctgga cgcagagcct    223680
     tgagtatcaa ttctgcctcc tcgatcgact ttgaatcaat aacaaccgag tccgataccc    223740
     agaattcggt tgaccagcta ctgaaataag gtgggacctt ctccagtaca caatgctgga    223800
     agtgaaagtg gctttcccgg agactctttg cttatttcct ttttttcgca ttggcaagga    223860
     taatcttcag gtttcctgac tgcgctgtct ccagaattcc gatctgatag tcatgatgtt    223920
     ccaggttagt cagctgtgct tgagggaaaa cttgaacaac accattctcg attgatatga    223980
     attcttctcg gctatctggt ttgtttggtg ggcggccttg cggaaggatg gtggaaggga    224040
     gtctgatgtt gatactctga ccacagagct ttgactgttc ccatttccaa acgagctcct    224100
     cggtctttga atatatgaaa ggggctttcg tgaccgggtt ttcgagggga ggccaacacg    224160
     agggatatgc tgcctgctgc attcagcata tttatacatg gccattggaa ttcataatac    224220
     atacccattc gcacgccgcc aatgcgacag aaacggatgt tggagtagct gtaacatcaa    224280
     gtgtagcatc aaacaatctc tctcaggaag agcttctggt agcaatccgg gggtggatac    224340
     gtcggagtta atggacatac tcaaattgct accatcctca ttacggtcta ttgaattgga    224400
     atttatcgag ttccctttcg atgaatcctg tttgactggg ctcttggaga ggatgcggga    224460
     ggaactgaat tgggccgaga gagatcaact aaaaccgacc gtcacaatcg ctatgaaagg    224520
     ccatcgcagg tggccgggga ggtttattaa gcttacagac gaagtggcaa gctttctcta    224580
     cggctctggt ggaaatcctg tggacggagg agatacatgc ggccccagaa acggatgggg    224640
     gacgaaccat gacctttttg aagcggagta tactcggccc aacgtcagta tcccggatct    224700
     taggaaatta ggaatcgttc gttagggata ggagccagcg gacctcgaac atagggccta    224760
     gaaatttgac attgacttaa ggtcattaat accatcggtg tattcaacaa accctatata    224820
     tgccaaaatc aggcattgac gtagtaagat ttcctaaaaa taggggtttg acgcctggcc    224880
     tctatgaagt tttgtagacc acctaggatg aacaaatggt ccctcaacat gcgcagctta    224940
     gaagttttgt cgacagcaca gaatcattga acaaaagtgc aatcatccga gtacggagta    225000
     ctccagattc cttcttctaa ctcaaaccat caccccaagc caaaagtcca ctcgcattaa    225060
     acactctcct actcttcaca atctcctact cttcacaatc tcctactctc cacaacattc    225120
     tttaaatact gtactcaaaa ccccaacacc gtctcgcaca cccgcctccc aaaaacccat    225180
     gctctttatc cactgccggc ttaagcgtac tatccgccga acaggtgatc gcttaggcaa    225240
     ggtaattaaa gtaatgcgct acatacacag agcggttccg gcctaggtcg atgcgttagg    225300
     gctctaattc agaagtggtg gtgtagtaga ctcgccggag gaggtagagg tagtagagtt    225360
     aatggaagac ggagggaatt accacagaag tggcctttag cttggaggtg cttatattcg    225420
     aaggaataaa gtagcctagg ccgtctggag attcggttat tattacatct tatagtacct    225480
     aggtaggtgc taagataaag aggtgtttaa aagtaaataa ggacgtacta ggcattaatg    225540
     tatcctatgt cggctctaag acgttccctt cccgcggggc ttccttcgag aaagaggata    225600
     gatatattaa tttgcctgct atttggggcg ggctttggtc aaacattacg ttgccttggc    225660
     tggcctaaac tgattcgatg cgttcctgac tgcataatcg gcctcaataa acaaccgtac    225720
     ttgcaaaagt aatgatctcc gatgtacctc aactttggtc agacgacaga cactttttat    225780
     tcaatatttg ccacctacag gcaacctgaa gcctcttaga aatctcagga tgattctata    225840
     aaagcctctg ttatccttcc tcgttttgct tgactacaca caacaccaaa tcaagcgggt    225900
     aagaaataca agacacgaga cgcagcacac aagatatttt cgaattttag gctcctataa    225960
     ttcgtctaaa gacaaggaaa atgcgtttct ccatcattat gatcctcgct agtgcctatg    226020
     cacgcggatc tctcggtggc acccttgaga tcattgatat tgatggtcaa tgcgcgatat    226080
     ggtcctatga caaccatggc tgcacgggat cttcggaatt ctttagccaa ctttacggag    226140
     atgactgttc aagtaagcaa atgccgggga tgggaatcag aaaaaggtac taacaaattt    226200
     gtagatttgc gcgtcaagac cggcacccct caaggttacc ctgtgagtgg cgtgggggct    226260
     tgtggcacga aaaaaaattc gtcagttgca tggattgagg tggaacatac tggcctggtc    226320
     agcttcttca attaccaagg cgacaagtcg gcatgtacat tggacaacgg actcaagcat    226380
     ggcagccgat gtattgcttc tgacacggta ccctccacca aggcgtcctc cgctttgacg    226440
     acgccgaggt cttcgtcatc agtgtcggag tcatcctcga ctacctccca gaccgcacct    226500
     tcttctgatt gttccgcgga ttgaggaaac atgtagaaca agtggcaaag tgacatcact    226560
     ctcgggatgt accaaacata ccttcactac tttgcaggta catagaattt tttggctttc    226620
     tcttagttat gttttcaatg tttgatttta tttccttttt gaacattata tgtattgagg    226680
     ccacatcgga aaaacaagag gacagcaatg caattgagtc aagttgaacg ggtcttctga    226740
     tgggctcatg ctgattcgta agttatggtt cgattttgca caatgttcta tcatttcagt    226800
     cggggagtag taatagcctg tattgtagct atgctttatt ttccaatttg ggcacttctc    226860
     ttgaagacct ccatcgatat gatagtattg gaaaccttgt ccaatccgac gaaaggcaaa    226920
     taagtggacc ctcttttggg aggattcggc catggtaatt gaaaaagctc tttaaagttg    226980
     ctggttactt tgttcttttc ttcctcagcc cagggattgg actcacatat agaatgacac    227040
     ttcttgagct tctcgatggt ctacgagctt ggcaacgaac aggttaccga tcacgggggc    227100
     ccgagaaatg caaataccaa tagcaggctc aagaggtatt ttattacctt aagaatctgc    227160
     caaaatccag ttccgaattc ggataatttg cttcggttgt ctgcctgctt gtcctagcgc    227220
     attttttagt ctttcgattt tctttgttat cacttggacc gaggaatctc atacaacgga    227280
     tcgccctgtt gagagttggg agtaagtagc tatgtcgatg gagaaaccgc gcttgagatt    227340
     tgcaagttgg gattgggttg tatgcaactc cctgcactgg tattggactt ctagcacccg    227400
     cacataaggt ggtgctcaga cacgcgtcgt cccatcggag tgctgcctcc agtatcaagc    227460
     gaaaaattat tctctctagg ggtactttgg tctgaattca ttttcatatg gccttcaacg    227520
     ccggaactta gaagatgaac ctttccttgt tttacgcaca ctttctgtct ctgtccgtat    227580
     aaccagcaac tagatatcca tagcggtatc cagatacaaa catgcacatc ttcatcatca    227640
     ccattaggaa acaggtcacg cccctgtaga tggttccatt ggtgctagga acatatctct    227700
     tgaccctggg agttctcttg ctcccggaag cctctgaaac gtttctggga gcaaagaaac    227760
     agcctctagg agccacgtag cccccaggaa acccaatgta gcttctgggg tctgctatca    227820
     ccaccacggg gaatcaaagc cgcgttcctg ttgacgactt gttgattcct ggggcgatga    227880
     tttggcctcc tgggggatcc aatgacgcag aattgtgcgc aggtccggcg aaggtgtttt    227940
     gtgaggcttt cgccgatctc ggaaggcaag ctattgactt taggactcta aattaagctc    228000
     ccaggggctc cacagttccg agatcttgtc aatgtattcc cagagccaat tccgtattca    228060
     gacaggaacg aaaagtgaag atcccagggg tagacctcgc gttcctagaa ttagaaatag    228120
     ccccgggacc taaagaggat ttcctagggg ataaacagcc cttagaaatg cttttgaagg    228180
     ttccagggtc aacatagtga tttctacagc caattcaaca agcacagaga tctgtcagtt    228240
     gctccagccc cacgagttgc gttttctgtc aacaatctcc gccatattcg acgcggctcc    228300
     agtgagctca atccgtgtcg ttttgtcatc gctggtaggg taactatgtc agattcgaat    228360
     tgagcgacgc agccagtaaa ttttgactaa ggtctagtgg tgtccagcac ttgcaaagat    228420
     gaacggtcgc cttgtaatct gaattctaaa caatcgggat ctcatttctc gctaggcttg    228480
     cttcaaaaat ctatatcaat gctatggcga aagttgctga tcactatgcc gagtgtcggt    228540
     cccgcgcact cacgtctgat tggccgtcgc ttgttctatt tccatcttac ctcgcctgca    228600
     cccctacgat cacccaagca gagtggagag tcgtgccgac cggcgaagcg ctgcagaggt    228660
     ggacgggtct cccggtatat gaggcccaac tagtctggct gagcgacggg gcccactagc    228720
     gggagacgac tcgcttgccg tgtggacgga atgtgtctcg gcatccgacg aggggattgg    228780
     taaagggcga atcaaggcgt ctagggctcc gtcgtttcga ctgcagtcat cagtatcctg    228840
     gtcgttgcag aaacaaggtc gtccacactt accacacaca gcatgacgtg ccagatcctg    228900
     tatctcgcct ttccaaccac tcttccgcgc aggctaggtg agaaagcgct tggcactgac    228960
     cacaacgcaa gatcacgctc tcatttgcat ggttttcatc ctcggtcagg cagaacacac    229020
     agtggatgct gtcgacctct tcactcgggg tgagactctg gagcgtcaat tcttggaaac    229080
     cagcccagat attagcgacc gacgccagaa tagccggttg ggccggcgaa acgcgccatg    229140
     gaacactgtt cgtccgcagc attgtggaag tcacaaatgg attgaatggc tgcactggcc    229200
     cggggtttgt tggcaggcgc accggcgggt cttgtctgag cccgcgaggt ggcgggtcag    229260
     tgttgtctga tgcagggcgg cgcctggagg ctgacgatgt ctgacgctgg ccgggatgta    229320
     caatgactga tggagaagcc attctggagc catgtggtac tcgcgcctgg ttacggcggc    229380
     ttcataccac tgctggccaa cttggtcggc ctgccgttgt cggtgccatc tcgcgcagag    229440
     gaagtctctg gcgacatcac agagtttcgg ctgcaacgat gacaagtcaa acggctctct    229500
     ggcgagagtg gtcaaccttt gatggccgat cttgatgtct tcaactttga tcgagttctt    229560
     gcatgggtgg ccttttttgg tcatgccgca acaggagcca ggaccgccat tgcggctgac    229620
     ttctatctca caaacaagaa acggattcca aggcagcatg gtagtcattg aggtggtcgt    229680
     caacaaaggt agaaaatgtt tcggattgtg gtggtgttgg gcaatcactg cggcgttccc    229740
     tcgccagctt tatatgccgt cgccgcgggc tccttaccta catggctgcg tggctgctgg    229800
     catgggacgc cttccttgaa acagtcggta cgtcgaagaa tgcattcaca cgcagtatgc    229860
     gccactacat ggctgatcag tggcctgcga gaagggatat cattccagat cactgctgca    229920
     atcagctaca cttgtgactg ttcatcgcga tgaccatgca ttggcgaaca gactatctac    229980
     tgcggttatc cgcaaagtcg acaaatgcgg ggtgaaattc tgggttgcct atggaatttc    230040
     gaagtgcgtg ataggttatg atctactctt atggcgctag atgtgagaag tgggtaccaa    230100
     gatagattcg gtctccaggc tatcgacata accaggaact gatttggcgt tcccgggagc    230160
     tagacgccag agattcttca acgccgccca aacattcttg tcaaggcttt gatgctgccg    230220
     tgtggttgct acgcgcctca gcggagtgac gggctacact tctagctgac cacagaattt    230280
     agctgaggcg agatatatac ggcgtccaac tttcggacct caccctcatt tacatttcat    230340
     ttgcttccta gctccaatcc tgtccaatca tggtctgttt caactcgttc ttactgggtc    230400
     taccgatgag ctaatgcatt gcagtcaaac atcagagacc tccccaacga gctgttgctg    230460
     tgcatcgtgt cgcatttgga tggcagtgca ttattcgccc tcgccaaatc atgcaaagac    230520
     tttgatttta gactgcagcc cagcatctgg aaatacaaca tcagatttca gaacagcaat    230580
     atgttgcacc tggccgtcaa atacgacaac gttggccttg cggaggcttt gctccggcac    230640
     aacgccaaca tcaatgcatt ttaccgaggc aaaactcctt taatgcgggc gctgaaatac    230700
     tcttccgctg gtgtgcgcga actcttgctc aatcatcgag acctagacat caacgttcaa    230760
     aatcaagcgc gggagagcgc cctgtggtat accatccact acggaacttt ttccaccgtc    230820
     aagcgcgttc tagaacaacc caacgtccag gtggacgtca agcacaaaca cggccgaacg    230880
     gcgctccacc tagcagtctt cgcaggcaga atagggttcg tgcatctgct actttctagt    230940
     ggcagcgaac ctgatctaca ggacgattcg ggccactcgc catgggactg ggcatgtcgc    231000
     ttcaatagac ccgtgatgga aatgattttt tcaaacgatc cgatggccaa ggtgtttctt    231060
     ggtaccaaat catcacaaga ggctgagcta cctcttcacc aagcagtggc ctatgggtca    231120
     gtagaggctg tcaaaagact tccttctcag gcaaaagggc ctgaatttgg acatccagaa    231180
     ccggaatggc tatacgccgc tccatctcgc cgttcaaaac aaacgcttgg aaatggtcaa    231240
     tttgctccta agtcaccccc ctgccaacgt gaactgcaaa gacaaagatg gcaatacgcc    231300
     actttggctg tctacttact cgtcatacga cgagataacc gacaggctat tggccgagaa    231360
     agacatcaac gtcaattttg ttggaggccg cgggagattc gaggcgccat ctacatctct    231420
     acaccacgcc gcggccaggt tcgataccgt gctcatacga cggctgcttg cggtgccagg    231480
     gatcagtctg aatctctgtg ttggaggcca ctctccaatc tccgtggccg catatcacgg    231540
     acgcgtgaac acggttgctt gtctactgag tatggagggc gcggagatta atggaatgga    231600
     tttaatagat ccgcctattt gtcgagccgt tgcacatggc catctcgatg tggtacgact    231660
     tttagtgcaa caagacgcac gtctgaacat caatgaaagc acgatcgcaa ctcacgacac    231720
     tgctctctgc atggctgccc gtagcggtga cttggaaatg gtccaggcac tactaagcca    231780
     tgattcggat tgatgtgaac ctcaggaatc aatgttctga ggatccatta attttggcgg    231840
     tcaagggcgg gcattcctcg gttgttgatg cacttgtggt caatcccaga ctgaaatact    231900
     tcagtttgac aaaatccctg gaactaacaa ggaacgattg catccagagg gccattcgaa    231960
     gcagaatgga agacgccaac actccacaaa gattgttgaa gcggtctccg gggagaaggt    232020
     ttggtggtct ggaagagctg gcgacatcga cttcgggtag ctgtcgtgat gcaatgcggg    232080
     gtggccgagt taatcgacat tttctccgct agatacactg cccacattgt cactgcatcc    232140
     gtagtttttt gtttacaata tatcggggta atagaagcta tactggatca tgcgggatta    232200
     ttcgcagaac attccacgaa ggctacgcta ttccagatgt aagctgcttt ccatgcggta    232260
     attctctctc aattacaatg ttgtcatatt actgccaagt tggaaaagaa atcatgaata    232320
     tgcaaccctt cacccttctc ttgcgttgtc caagaaccct ggtacatgta gattgaatct    232380
     ggacgggtgg ttccaatcat caagtacgca agtcagtcga acccgagatg actccagagc    232440
     ctgctcaaag aagcgcagcc gagacagctg cttgtcgtgg tgcagctgaa gtccatccct    232500
     ctctttagtc aggtgtctgc tagcctcctt caatatctga ttgctctgct ctaggttctg    232560
     gccatcgatg tgtttggaca cgcacgactc ccataggcgt cgatagagtc cgacaagacg    232620
     agccgcggga aaggcggact tgggatcgtc gcgttcgagg tctgctagca ccttcagaat    232680
     aggttgaaat ggctcggtcg ccaaggtatg tcttgcttct gctccctgtt gcgagggaga    232740
     gagctgctat ggtcagcaag agcattggaa gctgagccgc tctacttacc agtggaggga    232800
     catgatcaga agcctcctgc gaattgtctt tttccgaagc gattggcaat gcacaggtct    232860
     gttgttctcc ttctttttcc cggtctggcg tactattagg gatatccatc ttgatcgcag    232920
     gggaaagtcg agtatctggg caatagcatg cccaccaatt cttgaagggt tttatcaact    232980
     agcagacata ggtggttatg tactcagtct cagtatcacc atgaaagtca atcaacgcag    233040
     tcggcttttg tatttcagcg ctcggttagc agcccattca attatggtga tggtgatcaa    233100
     tctcgtagtg ttgatggttg gtgaatgtgc ctcatattag tggctactgg tgatgaaccg    233160
     tccaggagat atatattcaa tcacaacact tttcccatat tcgttgaaag cctcagaaat    233220
     cccaaaatca gttagagtaa aatctacagc actgaaaaag aaaagtaaaa aaaaaaaaag    233280
     aaaaacaaga tatctatttc aacgctggtc acaagttcaa aagttgactc aagtcaacaa    233340
     cgtaaggtca agcctcaacg ggttgacagg tcgaataccc gcgcacgcgc gaccgtggcc    233400
     cgacgctttc cgcagtctag acggacagag ccacacacag ctcagacaac caacactcga    233460
     gcgaggccag aaaatttcca tgttttttag atgaaaatgt gagcgctctt ggtaacatca    233520
     aagaacgaac agcttccatt gcctcagtat taggaccgta gattcaacag tgagccaatg    233580
     tttcttagcc gactcacttt gactcattct ctacttgatt ctaacatgtt ttctcgagga    233640
     ccctctaaaa tcacaccaag gaatttgctg caaatagttg cggcagaact aaggcataaa    233700
     ttgcaacaga cctcacttag gatagcgttg tgtccttgag cgtttgctcc ataatagaga    233760
     cattggatca ccccccagaa ggcttggcta tagccccagg aaccacgtat gattctagaa    233820
     attaataacg ctgtcaacag gaacatgtct ttggctcctc aaaggggagg taaaagggcc    233880
     cagaagctac gtcgggtttc ctggggtcta tttgactcct agaagttgct tatatgctcc    233940
     cagaaaccgc actaaagttt ccgggagcaa gagaaccccc aaggcttgcg tttccggggc    234000
     tgataaagct gccaacggga acgtaaccga ttttgtgaga gcgggaatgg agagtgtaca    234060
     agttacgtac gatttcctgg ggcaatgtga tctttgggca gctagcacgt ttctatgttt    234120
     ggctttacgt gcctaccgag gttgatggct atttatgcag agaacatcgt caaccatcac    234180
     ctgtctttta catcaagcca ctcagaatac tgctccaata ttggccatta tcgaccggct    234240
     agtcagatca agcgatgaac atgctttgat tcgaaacagg aaattcaata tttaaatcat    234300
     cccggtaact ctgcagtaag tccattcctt tccatgaccc tagccctttc catgacccta    234360
     tccgtcgcac ctctaatttc tgtggactcc acctccctta ttcctgaaaa tcatcataaa    234420
     aatttgccgt tgcttttatt cctaatactc actgcctcgt ttgtcacagc cctactatag    234480
     taggccgttg gaaccgcctc tttgactgtt ttgtagcttg gtgcgcgtac tctgctaatg    234540
     accacgtaag tcgagtacga caaagcgcac aaacgacaaa gtgaccagta aatatcccgg    234600
     aagcggcctg gccaatggat ccataataca taatcttgta atatggaatt tggtccctgt    234660
     caaaaagctc aaaggatgcc tgaaatacgt gaacgcggct ggcaatccaa gcccctaagg    234720
     agagcacgat catgctcacg acgatttgaa tgcaaccgta gtaaaaccga gcggtgcatt    234780
     tctcttgtag ccactttggg tagaccacaa ggacaaaccc gaagatggaa aacagggctg    234840
     aaaccagggc cgcaatcacc atgccatcga cgacgttgtc catgaggctt tggaatgtga    234900
     tgtccaaaat agagtcgctc ggcgtcacga ggtcggatct agcacggtct cgcaggagga    234960
     ccgcaaagtg tacagtggcc gagcggagac tggcaagggc tagccaggtg acggtaaggg    235020
     aaataatgag taggggaaat aatgacagcc gcatccgata catggccgcg gaagtattca    235080
     gaggcattgt gtccgcaaga acagattttc taatgcagga aggtgaggca ggtctcgttc    235140
     cagggaacag tgaaacaaag taaagaatag cagcagaatg atgaagcagg tcaatctcgg    235200
     agcagggtga atttatatgt acaatgcgct cttcacacaa atgctgcctt aacaaagaat    235260
     ggcccagttg ataatgagcc gtgccaggtg cctttttcat gctctgtttc ctcagcggca    235320
     atcattatag gtagattacg tacatgggtt ggccaagtgg cagatccagg aaataaaacg    235380
     cttgcccagg aatagatgcg gatgcggccc cggcccttag ctcatttttt tcacttgcga    235440
     gagtatcatt tgctctgcat attgattggt gtttaaaact tcacacatcc taggatccag    235500
     gcacaaaatt acaaacaatg gtgacaaatt cgaaggcatg gctttcaaca cgcctcaatt    235560
     agtttaggca ccccgggccc ttcactttct gctaccaacc ggatcttcta aagtgactgg    235620
     acaagcctaa agggctataa attccttggc ccctactcta cattatatga taatttgaga    235680
     actactcaat agtcgagcag gccttgcgtt cgaggcgacc tgagaatttc ttcctctttg    235740
     ctcaattcca cgtttataaa cctctgcgag attctcattg gttcttggcc aagatcgttt    235800
     gggttctcct ttacatcatc tcaagctctg tccctcggag cccgattgcc gcgatgggga    235860
     taaagcctac ccctggctgt tcagacatcg gccccgagtt tgatcgcctg aaggccgaca    235920
     gggcaatata tctcgatgca aaacttgtgg cttttgtcga aaaagctcat tcatcgcttc    235980
     agtcacgagg acgtttcaag caacgggatt gctacaagag gtctctcctt cattacgctg    236040
     ctatggggaa ctgtacaaac ctccttctat atctcctgca aagcaagccc gatgttgatt    236100
     ctcgtgacca gtgggggcgg acagcactct cctgggctgc ccaatacggc tcattggctg    236160
     tagcgaatat tctactggag caaggggcaa acctcaatgc ctcggattat gagggtggca    236220
     caccgttgac atggctgata cacgccggca accctgaaat ggtagacata gcggcaactg    236280
     aggcttacct aagagagagg ggcgcgaaag aagtcaaatt gagaggcatc aagtgggcct    236340
     gggtttgggt tttgagttat tctcatttac tccgatacat tcgccctcgt atctgaggcc    236400
     cccgatgaca tggagaaagc cgattctata ctataccaat acgtatatta gatgaacgtc    236460
     ataactgggg cagctggaaa gcactgcggc gagaggttgg accatccgat ttcacactat    236520
     tgttgtcttt ctttcatgtg aatttggact tgttgaagta gagataaaaa gcaagcaagt    236580
     ttatttgagc ataatgaata tgcggatatg tatttcatta gtaaaaaccc tagtcttgcc    236640
     tggcgatcca gagctgtaga gtaagggtac acgtactcgt ttccacttta gcccgtagcg    236700
     gggctggcac attcaacccc gagctgtcta ctagaaggct ttgagttcat gattatttgt    236760
     actggccata tccttgaccg tttcaactag tactaggtct tggaaatttt gtttagtatg    236820
     gcaaagggcc tgagcgatgt ttgggagcag gataagacga cacattgatt gtctattcta    236880
     ttgtggctgt aaaagcaagt cagcttgtta cgtaataaat aggatgtcat aatgtcctag    236940
     tgcgggctcc gcctactagt gactatgcca catatctctg acgtagggta gtatgcagct    237000
     ttagagctag tctaatcttc tagctgaacc ataatggtag agattctgta gattctccat    237060
     aactcttggc attaacagaa tagataccac tctgttccac ggaatggctg taaggctcct    237120
     gagagtgaac gtgacaagct cacaagtata cgtaccgcac tcctgcgatc tgtcaaaccg    237180
     tttggaggaa cagacatccc attcctacta acgtaatgtc tcttcagggg agcattcagt    237240
     atcgatgcag tccttaggag ttgtaaaatc tgcgtgagga tttaccatgc ctccgttaga    237300
     tgtatgtgtc cagtagttga gggcctcagc tcattgaggt cgtcggcgga cgacctgaag    237360
     gacaaatttc gacacgatca attagttgag ggtgccgatc acgcagagta acggctggcc    237420
     cactgttgag catcacacgt tgacagactg aaaaaaagcc gcagcttgtg acctgatatt    237480
     gggagtgttc agcgagacta acggacaggt cgcataccct tcagttctcc ctgtaactat    237540
     ttaccctttc gagaattggg atctaacaaa agtggagaaa tccgtccaag cagcaaaaag    237600
     aagcaaagga tatcgccatc gagcaaggga gggaggacat taggagaagg gtctagtaat    237660
     gtagcagatg tgaagggcca atgctatcct gggccattcg acgggagact acattcttgg    237720
     ctgactaagt ggaaaggggc tccccacgga tcacgtgcca acggaaaaac acttttaccg    237780
     agtatgcacc ctcctctttg agcttcaata caagggagta tgaccaacaa catcgccatg    237840
     gggtttctca cctgtatctt cccttattta caataaagat gagtgggaac agccccccag    237900
     actacaaggc gcttttcctc aaggcagagg aggaaaggaa acgagcagag gaggaaagga    237960
     agcgggcaga ggaaagggag aggcaggcag aggaacgcca aaggcaggca gaggagcggg    238020
     agagacaaca gagggaacgc aaccggccga cgatttttcc agagttcatc cgactttgcc    238080
     acgatctcct ttggaggcca ctccgagcgc aaacaccatc tcgctccacg acaggcaaaa    238140
     tccccgctcc tatcggaaaa cactgtcccc tacgactacg tctgtggact gactgtgagg    238200
     ataaacagcg ggaaatttac gaatctgtct gccgctacct gcaaccgact gaaggggatg    238260
     cacgagagtt atttacgtca ctggttgcgt tggaagacca cggccgacga tttgcacgcc    238320
     gaccgattaa cagcgaacag gacctggaga cttacgaacg actcgccgtt gaagaccacg    238380
     tgcacgatat cgccgctgag ttgtgtaaaa taccagaggc tcgtgaggag ttcgggttgg    238440
     gcaacggaat atggttcgat aatcacccca acgctctgga cgacgataat gaagtcgatg    238500
     ccagtcaacc atcaaccaca aagccttcga agccggatca attttgcatc tatcaaaggg    238560
     acggtaaccg gcgtaccttg ctcaccacgg tcgagtacaa acccccccac aagctctccg    238620
     ctgcgaacct gcggttagga ctccgaccga tggatttttg gcgagaagtg gtccaacccg    238680
     atcgtgttcc gacggaggag ccagagaaat caagatatca cgccgagcgg ctggtcggat    238740
     cagccatcgt acaagaattt catgtgatga ttcaagaggg tttggagtat tcatatttga    238800
     cgaacggcct gatggatgtg cagctctggg tgccctatga cgacccaacc accctttatt    238860
     accacctggg tgaacccggt atatacggga tggcgggtgt tgcaggggct ggaattccca    238920
     ggactcgaat tgagaggacc ctgtgcctct gtttgatgag ttttcgtgct cctcttcgtg    238980
     accaggcgtg gcggaatgcg gccaaagacg ggctaccgaa atggcgttcg atccttgata    239040
     gcgatcgcgc tcagatcgta ctagtggaat taccacggaa cctggacgtg gacggtgcta    239100
     actccgaatc cgctaatcct gagcagtcaa cctctgagta cctcacatcc tcgtctccca    239160
     tcaccagcgg ccctcgagtg accacccgag cggcgacaac atcgaaactc tggggggtgg    239220
     tctcgcgcga agccgaggtc taccgggtcc tccagcgtgc ccaaggatcg gccgttcccg    239280
     tctttctcgg ggcgatcaac ttggcccaaa cgtacttcct ccacggcgcg gggaggatcc    239340
     gtcatatgct tctgatgggc tggggtggcg agagcgtggg ccatactact cccgataaat    239400
     ctacccagcg tgcgatctct cggtcagtga aggagatccg tcgtttcggg gttgtccacc    239460
     aggaccttcg cccggaaaac atcttgtgga atgctgagct ccagcgagct ctgatcattg    239520
     attttcatct gtgcaccttg gatcgtcgac cgctggacag acggccaggt acactcaaac    239580
     gattacggta tggttctgca gaacatcact ccaagcgcgt gcgtgtggtg tgagtaaagg    239640
     ccactggagc tgcgagaacg acgtgaaaag tcaaccggcg ctacgcatag cctacacatg    239700
     aacagcggca attgctgggc ataatcctct attcgtgccg gtaccttaag gacccattca    239760
     ttaaccaaca agagatcttg accacgaagt ctgctcggta cgagagtcat atccgtagcc    239820
     actccccatc cgtggaaccg tctccctgtt gccactatgc ggttggctca ccagcggaca    239880
     ctccctctcc accggcgtat ttggtagcca tatcgtgcca tgttatctct cgcggcgttg    239940
     ggtagtgcga ggcctgcgtc ggtcagcgag ctgctactaa ctgatggcca acacttacaa    240000
     gctgctgtcg tgatagaggc cattgcgcac aggagttgaa aaacagaatc tgcccgttgc    240060
     gcttgagccg tatcatcatg aagacgtcgg catcgcattc ccgacagtac tcgagggact    240120
     tccggaggag gctgttcctt cggcaagcct gtttctggcg aatcgacttg aggctgttgg    240180
     agtggcgtgt gcggatggtc ttttgctccg cggccattac atatagatcc ggattctttc    240240
     actggcgtct ctggattcga gaggatatct ggggatcgaa tacctctgag aagcgtgaag    240300
     cgtcgatgcg gatccatagt ttcttagaat cgaatatgaa agaagctcac aatgtaccag    240360
     actaggtgtt gaatggtgct atggtatgag acgaggtgcg atggggtgcg atggggtgcg    240420
     atagctgtcg agagacggtg ataacacttt ggaagtgcga tggagtcgtc cttcaggcgc    240480
     acatatctaa ggaagaaaat cagttgttag ttgtgttcag tctcgtggag tatcttgcat    240540
     acaaagagtt ctcttgcttt ggtggtctgg cacgggttcg ctggaatata ttctataagt    240600
     gagagcccta tccaggtaga agtcacgggg cggggcgtac ctaaatcacg tgtatatcct    240660
     agtttcggat atgaaacaca gcagcctaga gaggggttgg atggtcggtt tatccaattg    240720
     atgtcctttg gttggggggg tggggggtgt agtactgaag agtacacacc agaagtgcta    240780
     acgtctacgt gtccttgaac ggaatattgt agcctggtca aactaacaac ccgacggatc    240840
     gactgcaacg gacttgattg cgctttgtcg gaggaactat gaaagggttg ccagtctaca    240900
     tcgccatgag tggcatctca cgacaaggaa cgaagtggga agcatcagtc gtgtcaatat    240960
     atgcaatatg aacactaagc catctcggcc gtcatgtgca ttcaatcgca agaatatatt    241020
     cctatgtgta tatcaatatg aatttagtag tctcaaaaaa actattttaa gagcgtatcc    241080
     gtctgatgaa tatcctcttg tgaggaaata cgtcatgtga tcacaggttt ggaatgggtg    241140
     ggcagccaag agggaaaatc tcatgtgtat cgccctctga gacatgcctg taaacaggag    241200
     catccaacca agactggggc gcttacattc tgattaaccg gctgtcctac attgacagcc    241260
     gcccactgct gaccgccgtg tagatctgac gggaattcaa ccttgatggc ggtcctttcc    241320
     tgacggcggt ccagcctgga cgatggtcca ctcctacctc gtccacctct aattgccgtc    241380
     ctactgtgac cacagtgatc tcctggcggc cgttctacgg tgaccgccgg ttaaactagt    241440
     cgacagccga attatagtag tagatcgaga gtaggcatgt gtaaagaaat acacttcgcc    241500
     gttcatggta tgaaggcggt gaggtcgagg gcagaagacg tggagcacac gtcgtagtcc    241560
     gattcggcga taggactccc cacaaggatg tttcacgggc ggcgatgggc tgctcctatc    241620
     tacaatggca taaagatcag taatagctcg tgatttgggt cacgaaaatt tacacaaata    241680
     actgatatag cgcagcagaa ggcgcgatat accaatcgcc tcactaggaa gaatggactt    241740
     ttcaggcttc tatgcggcga agctggcaat cagttgttca cgccctctta ttggcccgct    241800
     cctttgagct atatactttt accaagggta tgctgtgtgg cctgaagcga cgagaccagg    241860
     actggcgttt cagccatggc tttatacagc actaatgggg tgctgtatcc tcggggccac    241920
     tctggtgcga tgtcgatggt tcactgtcat tcattagctt gtatatcggt aagttactcc    241980
     attacttaca tgttctgttg gcaagaacga gggatgaaga gacgacaaag agctgcggtc    242040
     cttgcgctcg tttattgtgg tcgattgtcc tcggttctag atctcctcga cttcaggatt    242100
     agtagaattt tagaaaggtc aggctacgac tcacatacct gcgacgtgga tattcgcgct    242160
     tttgccttgg gaatacacgc agggctgtac agtagatcag ctcagtcggc tggggcggag    242220
     agacatcaga catcttcgca tagacgttta gaccagccag cctaagtctt gtctctttga    242280
     tcggctgacc ggttggcaaa gtggatttgc tgagaacaac atatttcaca gacactgtct    242340
     ggcttgctgg tccatgttgt attctataaa tgtcagtaca gtacaaattt cagtactggg    242400
     tcgaaggtaa gaacttatca agtgcctcag acacaagcct gcttgacttc gcagagtcaa    242460
     gtgaataaat cgtagagcaa attgccgggg ttagaggacg tatttgtagg cttctcggct    242520
     tctgtcactc ataccggtag gaagcgttga ggaacacacc tcttgattga ggtctgttga    242580
     gacccatggc ttctttttgc cacaacgatt tgtggtgaca tttttgattc cttggttgct    242640
     cagtgagaga ggcgagtaag agtggtgttg gggaaaaggg atgctgagcc ggtcaagcaa    242700
     cgttggctga ctgctgaatc cttcacggcc ctcttaactt gagtctgtgg gagatattta    242760
     gtctgcaatg acaggcctgt atttcttgtc ccgatcacct cacctgtgag cgattcaacg    242820
     ttgagttacc gaaaagcgct tacagtttca tttctagaaa tcatggacac ttctttttcc    242880
     cttgcctcta gtgttgtgtt ggttgtatta gctgggtccg tccgtcgaga ctgcagaaag    242940
     cgaggaggtc acggtacgat gtgcgggtgc ttgacccgtc aacccgttga agcttggcca    243000
     aacgttgtca acgctcaatt tcgaacttgc gatcatgaag atacattctt ttattttatt    243060
     ttattttgtt cttggaactt ctctttttgg tggatgtgag ttctacaatg ttctgtttac    243120
     cgagtttctg agaccttcaa cgaaagtgga cgaggtgtct gattggaata tgcctcaatg    243180
     ggcgttcata tctggccctc aacatcgtga ggcttgatcg ggttccccga ccgactcgtt    243240
     gagcactatc cctaccatca aattgagtgc caaccgcctg ctggaaatgg aaccaactat    243300
     tcaaaagctg actgtgttga taatgtggtg atcgtaaaac ccaaaccata gccacctgcg    243360
     tctgcatatt ctataagtga ccaccaatgc atgatggaca caatactgcc cagatcttga    243420
     ctttcttctg cgggcaaaat ggattcccca aacagcttag ggctgttgaa gatacgatat    243480
     tcgcaagaat cagcaatatc ggttatcgta tcggcaactc ataaaccttg ccgataatta    243540
     tcgcatatcg tatcggcaca ctttcaagtc tgccgatacg atattcgcga atattcgccg    243600
     atacgataat tatcggcaga ttttctaccc ataataattt ctaccttcta cctctcatat    243660
     ttcaaccaac catgcagacc cttaattaat gaatgcgtct cagcggagtg gtttatccgc    243720
     cgcgtgccct cttatttcct tttaaatcca ggtctacgtg acgatctgaa ggtggatagg    243780
     agaaggatag gaagttctac actgtttatg catacatata tatgtaaata tatatctctc    243840
     tcttcgggta ggatttcagc caggaacggc tatatgcatg cacactatgt taactactta    243900
     tacatatcat ctaacagcat taagatcctc agtgtctctc ccttcataga gaatcgtcgt    243960
     actccaagca cgtcccgtcc tgtattgaat agtctctcaa ctgaaacttc agaggctggg    244020
     attgctaggt aatccctggc agcagcagcc atccgagggt attccttctt atgcaccttc    244080
     caccaatcac acagccagtt ttgatcctcc atatcactta cttcagcccg agcgctatca    244140
     aaataccgat caatatcaga aaaccgaggg ctatcttgag gttgtagtct ttgtaacatc    244200
     cggctaccca ctttttgctt cttatgacta ggctcacata gctctgtcat atccagtggt    244260
     tcagtggccc caggatattt gcggtgaagg tcatcacgca gagtttgaag aatgttcctc    244320
     ccagcgttct cttcaaccaa ctcatttagg aggagagctc ctttcacacg aggatccaag    244380
     accagtgcag tatagtatag atcagaggca tccatgaaag tatagtactt gatatatttc    244440
     ttgatactcc caccaacagc acttgcaata tcctcagtaa gatctgcaaa atcttccttg    244500
     cgctcagcca catcatgtag taaatcgtgg agctcgtagt atattggcaa aacgagactg    244560
     atctgtggtc ttttctctga gacaaacaat gtaaactcat tgaatctcga gagaacattg    244620
     tggacatgga aaagccgtgt ccattcatct gatgagaagg aaaggaagct agtctcatag    244680
     tagatgaacg tctcaagctg tcgctttgac tatagagagt attagtatta agcatatata    244740
     tagaacgaag gatcttgcct ttaacgcatc ccctaacatg cgaaaggttg aattccaccg    244800
     tgtatcgaca tcatactcga taaacttatt ggataagttc atccggttgc aagtatcgtt    244860
     ccatgattgc cttcgttgtg gactccgttg aatccagaga gctaagaccc gaagctttgc    244920
     aagtggttca atagcctgaa attccaatga ctggtgttct cctttatcaa ggctattaca    244980
     gacagaagta gcttcttctg tattaccgga cttcagagcc agtagaatat cttcacgatg    245040
     aggttgatga tgtgagccaa gcatcttata taactatcca aaccacagaa taaggaattg    245100
     gtcccaaacg ctttttgcag gttatcgcat agttctaatg ccattcgctc attattacta    245160
     gcattatccc cagtaattga aagcagctta cgctcaagat ccagttcaac aagtagaact    245220
     tgaatagctg cagccaagtt ctctccacta tgggggccat ggagctcttt gaattcaagg    245280
     actttctctc gatagtcaaa gtcttctgta agccaatggc caatgacacc cagaattggg    245340
     aaatggttct tgctagtcca tacatcaagg gatagagcga ttgtttggca tgtagtcgca    245400
     agctcttctt tcaacttagc acgttgtaag ttgaagtctt ccagaagacg ctgtcgaagt    245460
     gtatgtcgag aggtaagtgg gagtgaaatc cctggtatat ccttgaataa ttgctgaaat    245520
     tctggggact caatgacttg gaatggttat ttgctgccaa taacccaacg aagaagatta    245580
     ttctcaagaa gttgttgagc tgtaatcttt cccttatttc cccaaagact aataagatta    245640
     ggcttcggag ctggatcagg gatggagaca ttcggtggca gaacaccatg cttctctttc    245700
     aaatgatgcc gaatgttggt ggtagagcca tgccgtttgg agtctgttgt agaccagttg    245760
     cattgtgtcc catcttcatt ggcgatagca caacaaatct ctcgatcagt gaccatcttc    245820
     ctttggctcc tcttctcggt ccattcgttc gggaaatctc ttatcaagag atgtctccac    245880
     atccaatcat tcttttggcg tggatttgag cttagcgaac tcgtggctgg ttgctgggag    245940
     gcggattctg aaggtaaaat ttcgtcgaaa gattcaacaa gagagccgat cttggtaccg    246000
     attgctgatt gactatcgcc aaagggtggg gatgatggga ccggctcttc ctggctagaa    246060
     atccagtctt caggtccatc attcaaagca aagtagtcta gacggttccc acgggtttgc    246120
     atggttgaag tatgagggat agaaaggggg aagttggaac tcattaccta tactaatgat    246180
     actacttaga aaagtctgcc tactagtcct aatttggtta atttggaatg acatgtgata    246240
     gtctgccgat aattatcgta tcgacgaata ttcgcgaata cgatattcgc aactcaaaaa    246300
     cctcgccgat aattatcgga tatcgtatcg acaactcaaa agccttgccg atatttatcg    246360
     gcagcggtaa gataaccgat aatatcggca atttcgaata ttcgcaacag ccctagttcc    246420
     aggagtgggt gaagctgcca acaggaacat gactttaatt cctcgaagtg gaagtaaaag    246480
     gccccagaag ctacttcggg cttcctgggg tcaaatagac ccctagaagc tgcttatatg    246540
     ctcccagaaa cagcactaaa gtttccggga gcgagagaac ccccagggcc aagacatgcg    246600
     ttcccagggc tgataaagct gccaacagga acgtaactga ttttgtgagt ggggatgtag    246660
     agtgtacaag ccacgcacga tttcctgggg ccatatgatt cctgggcggc tcacatgttc    246720
     cagggtcaat ttctgaagag tttacggcaa tcaaggtaga tggatattta tacagagcac    246780
     atcgtcagcc atcacctgtc ttttacatca agccactcag aatactgctc caatgttggc    246840
     caatatcggc cggctagtca ggtcaagcga cgaacatgct ttgattccaa ttaggaaatt    246900
     caacatctaa atcatctccg caactcagca gtatgtctat ccctttccaa gaccctatcc    246960
     gtcgcacctc taatgtctat ggactccacc gtcattcttc gaaaatcatc atataattct    247020
     gcaattgtcc ttgttcgtaa atcctcgctg cctcttcgtc acagccctac tatagtagga    247080
     tgttagaacc gcctctttga ctgttttgta gctcggtgcg tgttctctgc tagtgacccc    247140
     gtaagccgca tacggcaaaa cgcacgagag acataatgat cactagagat cccaaaatgg    247200
     cctggccaac ggatccataa tacataacct tgtaatatgg gatgtggtac ctgtcagaag    247260
     actcggatgc ctgaaatccg cgaacgtggc tggcaatcca acccgctaag gagagcacga    247320
     tcatgctcac gacgatttca aagcaccagt agtagaaccg agcggcgcag ttctcttgta    247380
     accaattcag gtaggtcaca aggacaaagg agatggaaaa cagggctgaa accagggccg    247440
     caatcaccat gccgtcgacg acgtcgtcca tgaggttttg aaatgttagg accaaaaaag    247500
     agtcgctcgg cgtcacgagg tcggattttg cacggtatcg caggacgacc gccgagtgta    247560
     cagtggccga attgagactg gcaagggcca gctaggtgat ggtaaggaaa atcatacgag    247620
     gcgcattcga atcatggcgg cggcaatagg agagatgttg tgcccgcaag aaacagattt    247680
     attgagtgta aggaattgag gcaggtgccg ctcaagggaa caaagtaaag agcgggaggt    247740
     ataaagatga aggtcattac ccccgggtac tgtaaaactt atatgtgatc ttcacgcaac    247800
     tctgcctttc caaataatga ctcagctgat actgagctgc gccacatgcg ttttaattac    247860
     caggtgcctt agtggcagcc aaaataggct ttgactagat aagaatgttt caagttgaag    247920
     caatattcct atgcctaagg cagatggccc gggcagatgt gtctgatctc tcagtacggg    247980
     tccccggaaa tcacccgttt gttccttgga tttactttcc cgatactata ttattaacct    248040
     ccttaatatg tgtcgtggtt gcgcatgaga cctttcaaat tcggacgaac atcgacggaa    248100
     gatttctgat accgacgtag ttcgccttgg tctgtttgcg atatatcact ccgctgtacc    248160
     cgaggaaact gcggtttgct gttgattgga aatctaccca acagtcccca gaagatgtag    248220
     tcatctcttt tctatctctt ttattgagct tgtgtttaac agccagtgta ggatgtgtct    248280
     ctaagccatg gaaaaaccgt cgctgttagg tgaaccaacg cggccgatta ggaaacgagc    248340
     ttcgagtggg aaactgaacc aagtcccagt tcggcaaaga aacgacatgg ctcagatggg    248400
     tatcttctat aggcggaaaa ctcacatgct gctggtgttc aacggtgttt aaattcaact    248460
     tgtggacgtt gattcaactt tctggcatca ttcaccaccc gtacatcgcc aaaggtgctg    248520
     gaatgagaac actcaaaaaa tactatcatg tcggcacagt accagcgaat tatgaccaca    248580
     ggacctaaag cctccagagc tcctggaagc acaaaacaga ccctcggcca gtcggaactt    248640
     tatcgtggca gcgcggcgcg gctgaatcat cgccctctaa caacccccaa gccgtgagaa    248700
     attgaactcc cttccacacg tcctattcat gagcaacaat ggtttggcag ccatgttgct    248760
     cctgggaata tgcttcgaat caattgggtg ctcgagaacc atgtggatac ggccactgga    248820
     ttaaaccatc cttgattcga tcgtgggtgt acgtaccact attgtagtca catattgaca    248880
     tccatattcc tcctaggagt cggccctgat aataataacc cggaagatat tgtctgtaga    248940
     tatggtgggc atgaccactt cagcctcaaa catttaaaag gtcataattg tcccacggtc    249000
     gatgctctct tgtccatctt ttgttccaat aacctgccag tacaacacca tcaccagcga    249060
     ggccaatcaa tcatggatca caacctttca caggttccaa agaagtccaa taccccagac    249120
     acagaaggtc acaatggacg tacacgccaa actggtatcg ttattttaga tccccttctc    249180
     gaggaatcca tcggctaaca tacctatttc atgaaggcaa tgaatcggct ggaaacttcc    249240
     gtcgtgtcga tggtctattc ttccacgaga atcgcggccc cacaagccag gttttactac    249300
     agactgttga ccagtccact ggctccgtag ctacagaggt agttacttcc gtcgctacgt    249360
     ctcttgctag cgcaggggcc tctacgttgt ctccaagcgt cataaagact gaaagccaag    249420
     acctgccccc tctggacgga aaaaagagag cagccgaacc ctcaaccctc ccacgaaagc    249480
     gacgccgact ttcacactcc acctctcaaa taccgggccg ctcacaactg gtgcatcaaa    249540
     agagactccc aagcaatata aaaattagta gaaaaatggt caacgataca attcaatacc    249600
     tacaaacgct atccgaccgc atcttgatct ccgacaccat ttcccccagg gagtggtcca    249660
     ctatgcatct cgccacccaa ctactacaga gcaggtacga agagatcatc gtgagaaaag    249720
     agatggaaac agacgctgtg tccgattttg attccccacc aacacagcca gaagagaagt    249780
     gccgcaagtg tgctgctgcg gacgaggagc ggctgtatga ctgagcctcc tcttccctct    249840
     aatcttgctg gctatatttt gatagcataa ctggtccttg aaaattgagg agcaacatac    249900
     aacaggagga caccctcatt tctgtcactc aagtcgaatg tcacgcgaac aaatgtcttg    249960
     tctgctcgag ctcccctata caaatactgt cgcatgctct ctgtcccttc catatgacta    250020
     ctaccgtcaa taagtcacca gaagattcgt atcgaccacg gcttctttct ccctttctcc    250080
     ctagattccg tgtatcaggt cattgttcga tttgtctaca tgatacaact cctgaactcc    250140
     gatcagccta taccactacc cgaatcatac ctgtggctaa gcgtgcaacc tttcaaatac    250200
     cttcaagtgg cgtaggctgc tgacatcgaa tgcgtgatcc tcgttgtctt cggatgacat    250260
     ttagtgtctt tccaggcctg gaaatccaaa agacacagga acgctgatgt tctgtcttgc    250320
     ttcctggcag atgagcgtac ctccgcagac aatcaggctg ttagcacaag tccacctgca    250380
     aggagaagga gacgcaaagt cttctcattc ttagcctaca atttgacatt ggtcatctca    250440
     ggtacaaatc gagagcgtaa gatcggtgca caggcaagcc aatgaggctc gctacccaag    250500
     aatcacctcg gacatacagg aatctgcatc atgaggctgt cagaagtgct gtggtttacc    250560
     ctgtttgata agtggtgcat aaatataatt cttatgcacg cattttctat ccaagccgaa    250620
     gcattatgtg caaagaccac ttaccctgac tgtcactgca gctgcaggtt agtcaagttg    250680
     accgcgctta tcctttatct gttcatatcg tctcgtaaca tatcacgcac ttgtcaggaa    250740
     atccggattc cctacatccc ctacctcgac ggcttttttg agaataaatc atatattcgt    250800
     cgagctcacc gcactgcgga gaatacatgg gcatgtcact gttcgaagag gcagccactg    250860
     taaagtcttt ggtgtccgaa acaacatcga atcagaatgg tcttgggacc tcttgggcta    250920
     gcccctagat tccggagcaa aatttccacc gtcaatcaac gctcatgtga tggttgcttt    250980
     tggaaggatg gccggagtct actacgacta cgagcgaact agcactcctg cagggatatt    251040
     acccagcgga aattcgtttc agatggcact gctagaaccc aattgggttt caaccatgtt    251100
     ctcttatcag cagaacatgg ttgattgcgt taacttggga cacgacttcc caaaaggcaa    251160
     tggccgtcac ttcgatcggg gagattggtt gaaatataat ctgtcgttgc cgaggcatag    251220
     tagaaggagc cgatcgggta ttcttgattg cttgcttgtc caaagctctc aacaacatgg    251280
     ttgtctctgt ggtaaaatta ctttgattct tgcgctctct gggatataag agctgaaata    251340
     gaataaggtc gagtgactca caatcgccgc ctgaagtgat gactttgact tcgcaaggca    251400
     caaagcctac cgcatggcta attttactca agccaatcgt tcggcacctc atcacatgct    251460
     tctacacgtg ggtcttgggc gtattgcttg gtcatagttg agccagtgga tatactatcc    251520
     ctatcggatt gaggctgtat gccaacttca ccgagtgatc agaatgggac tagaaatggc    251580
     ttgcgaaata gaatcgacag tgattgatac atttatcatg tgggtgagat ggcaagaaaa    251640
     tctccgtact acgtccgtgt gacattgata gacctcgcca ctgcccatga ggcccataga    251700
     ttcgcactga gttacttccc cctgcctatg ggcttgcggg cggttgaccg tagccccgtg    251760
     tcatttaatg ggcccatggg tcgcttacta atgagcactt cagtcacatg aaattttata    251820
     attttataat gtttagccac gcacgtatat gtcttatagt gctaagtatt caggttattt    251880
     gagtagaaat gtatgcaatg gatgtgttca gctataacca aacctagtaa aagcaatgga    251940
     ctatccagtg taagtgaaat tgaaagtgtg atccgaaatg catagaaatt gtgatgcgtc    252000
     tgcattgcgt gtaaatatat atattatata tgacgacaaa acatgctgaa cctacaaaac    252060
     cactcacaat ataatgccta ccagccgcat cagtgtattt attataagca cgacatatta    252120
     gttatactac atactaggat tcacctttat tatgatcaat tatctgctat actagtggtt    252180
     atgggggtag gtgacaagtg atagatttcc caaatgttga accccctatt caggaaactt    252240
     acataatctg agggtggcat ggaccgatgg caaggtctag acgttgacac cgcccgacca    252300
     ttcaccacca tgctcaccac cacgctcatc aacacacatc aacacacatc aacactcaca    252360
     tcaacactca catcaacact cacatcaaca ctcacatcaa cactcacatc aacactcaca    252420
     tcaacactca catcaacact cacatcaaca ctcacatcaa cactcacatc aacactcaca    252480
     tcaacactaa cggttcaacg caacaagcat tccaagacaa cactctcatc tctgtttgcc    252540
     tacatctgaa tgaaagatgc caatttctat tgtagcgagg aagctattgg atcacaagct    252600
     gccaagggaa agggatgtga aatacgtcat ttgatactga agacgcttca gttgttagtt    252660
     taagattttg gctattgaat tggcgaagat ctaactaggg ctccttctat gtatccaatg    252720
     atgacccttc ggaacaatga acagacgatg aagatgttgc gcaggtcttt gcttctccga    252780
     atactcttgg aacactcgaa tactggtccc tagcaccacg aagaggtgcc tgcacgggct    252840
     agaggctctt gttgttgcag atgtccctgc gaggcgcttt gttgacgcag gacctaggct    252900
     gcggagaact tggtaatgca gcggtctcct gcagagaact tggtaatgca gcggtctcct    252960
     gcagagaact tgttaacgca gcggtctcct gcgggtctca cttgtcatca cagcgtcccc    253020
     ctgcggagtt cacttggtaa cgcagcgccc ccctgcgagg attgttgttg acgcagacct    253080
     atcctgcgag gtagtcttgt tcacgcagca cctccctgcg aggcatattg atgacgcaga    253140
     cctatcctgc gaagcacctt tttacactcg cggggctcgt ggcagcgaga gagcgcaagt    253200
     cttacatcac tgggctcgtg gcagcgacag ccgtggtcac ggaagttctg aagtccttgg    253260
     tttcgcagca ccccccctgc gaggattatt gttgacgcag acctatcctg cgagacacag    253320
     ttggtaacgc agagcctatc ctgcgagaca cagttgatat cgcagagcct atcctgcgag    253380
     acacagttga tatcgcagag cctatcctgc gagacacagt tgataacgca gagcctatcc    253440
     tgcaagacac agttgataac gcagagccta tcctgcgaga cacagttgtt gacgcagagc    253500
     ctatcctgca agacacagtt gataacgcag agcctatcct gcaagacaca gttgataacg    253560
     cagagcctat cctgcgaggc gctttgttga cgcagggcct atcctgcgag acacagttgt    253620
     tgacgcaaag cctatcctgc aagacacagt tgttgacgca gagcctatcc tgcaagacac    253680
     agttgataac gcagagccta tcctgcgaga cacagttgat aacgcagagc ctatcctgca    253740
     agacacagtt gataacgcag agcctatcct gcaagacaca gttgatatcg cagagcctat    253800
     cctgcgagac acagttgata acgcagagcc tatcctgcga gacacagttg ttgacgcaga    253860
     gcctatcctg caagacacag ttgataacgc agagcctatc ctgcgagaca cagttgttga    253920
     cgcagagcct atcctgcaag acacagttga taacgcagag cctatcctgc aagacacagt    253980
     tgataacgca gagcctatcc tgcgaggcgc tttgttgacg cagggcctag gctgcgaaga    254040
     acttggtaat gcagcggtct cctgcagaga acttggtaat gcagcggtct cctgcagaga    254100
     acttgttaac gcagcggtct cctgcgggtc tcacttgtca tcacagcgtc cccctgcgga    254160
     gttcacttgg taacgcagcg cccccctgcg aggtagtctt gttttcgcag cacccccctg    254220
     cgaggcatat tgatgacgca gacctatcct gcgaggattg ttgttgacgc agacctatcc    254280
     tgcgaagcac ctttttacac tcgcggggct cgtggcagcg agggagcgca agtcttacat    254340
     cactgggctc gtggcagcga cagccgtggt cacggagact ctcaagcccg caggcaagag    254400
     agggacacca tgacacatcg gagtgtgaga accgaagtcc tgattttttt tgggctggga    254460
     atccggctcc ttttatattt tttcggctac gtctctacca aggaaccagt tgcgcagatg    254520
     gtagcgagaa tcactgtctc gttaataagc gttgaagcga tttgaacgac gttgaagggg    254580
     tgtttggaga ctttgtggcc tacagagtca agcctcgacc tggaataatt cctctcaaaa    254640
     ttgtgcgttg agtgtggtga accactttca ttgactattg agaagaaagt aatgccgcga    254700
     aagtaagatt ggtacctgtc atcgaatttg caattaaatc gctcaacgcg cttgcattct    254760
     acatgtcccc attttaacca cggttaccat ttcttaatgg gggttgaagt gcttcgacag    254820
     atgccgaaat aatgggctgc agactttgtg gtcgacggaa acgctgagct gtacctgggg    254880
     ttggccggat gacattttgg tctcactaga atcaaccctt catctctagg ctcgcgccgc    254940
     tgactttcat ttctactctc agctgactta tgttgtcttt actaaatctc tactccctgg    255000
     gcgcgtaggc cttggcatac ttgcaatctc aggatgaaga ttgtctttct ttggcatgat    255060
     agccaaaaag ggcccagacc tttgaaaagc tcagacaaga aactgggtct agtttccagg    255120
     acaaccatgt gaactggtgc aaccaaggcc cacgagctag gttctcttga tcgccacccc    255180
     ctcgcaagat tgcaacgcta ctatcacact gatgagaccc tggagacgaa tagcacccga    255240
     cgggccaatc aaacaccacg cgtgaactta gacagacgca ggtagggttc tgcgatgcag    255300
     atctcagcgg cgacccacgg aacagtagat cagggaggtt ctatttgtgg agagaaaatg    255360
     gaaacaattg caaaggtcca gacacgatct acaagcccaa agttggccgc tgtcagggtc    255420
     agatggaacg ggggattgtt gcctaggagg tactgctggg gcaggtgagt atttggaata    255480
     acacgcagac tttggcgaca caatgtaggc tacaacccga tccgtggttg tgttctcttg    255540
     gtcgcagtca tgagaaagta agttccctgt caagtggcaa gctgaacttt gcctatctgg    255600
     tctgtagaat gttctagaag ctatgtatct tctcctgcaa taagcctttc cccgatgatt    255660
     attgctttct ttgggccata acaacacttc ctctccatct ctccaagtct accgctattt    255720
     caataactct cgcagacggc ttgtaaagaa ctatgccaat tatggacaaa ccacatgagc    255780
     ttaaataaat gcctccgttt tactaagacc gattggcccc ggacaagatt taaatgtgga    255840
     ccggcgctcc tgcggcccta aactttaatt tcaatcaatc tgcatatttt gatcgtgatg    255900
     ctgaatttag aaactctcta ataaaatatt ggccctaccg cagtaaatct atcctacata    255960
     ccagctgacg gagattgtgg cgattctgct ctagttcttt tttcttttgg gctgcaaggc    256020
     ttaatcacag gcagcccaga aagaaggtgg gaaaaatccc aggcttgaat tcttcattac    256080
     agccgcattt cctcaccgag cgggcatttc catggttcac ccaaacaagc tcttggattg    256140
     atttgcggtg ccgctactga tcggcagtcc cactcgtggt tccacggtct gtcaaatttg    256200
     atttccttgt gacttgggca tgggtcaaaa gcaaatcgga cgcttcactc caaagatcac    256260
     cccgctttcg acaaccaatc caattaaatc cacacatttc tttgggttaa tttagaaccc    256320
     agggattttc agtttcccag attccccttg ctaccctgtc ctatctgcct aaggaaaact    256380
     catagtaccg tgaatccttt tactctgtac gcagtatttt gcaggccgca tgggtcatgc    256440
     cctggtttag aatgacaggg tgaaactgtg tagccgggcc tgttcagagg caccacgatc    256500
     atgctcgaat gttcaccttt gactttcgga cttcctcact attgttgtaa ttccaaatag    256560
     gggtgattgc tccatcttat atgaactcca tggggtgata catagctcta atgctgaggg    256620
     atctattgtc gagtaatcgc tgcctcttat ggtaataaca tacaccagga ctatttcatc    256680
     gagatggttg gtcactgttc cttcgacctc gcagtttagc gctccagccg atgaaatact    256740
     gctaacgtgt gcgctctctt cgctggtatc tcagtttcct gaccgcacaa gcacggtgca    256800
     catagtccca cctccaggat gaagcccgtg ttcttttagg ccggtacgac taaaacccta    256860
     aggtgcctgc ttctgggtgt gtttcggcag caacagaaat cggtctttca gaccttcgag    256920
     gcgcactctt ggcaaagaag cttggtgctc ttgactgcgt tcgacggcgt tctgaatttg    256980
     ggagtctatc ttccaagaac ttcaatagac ggcgaagctt ctccacgctc gaaagtccac    257040
     cgatacagag agagaatcca atggcgacgc gggtcatgcg gaggagagat tcacgatcct    257100
     gtaaaagacg gtggacagca gcgtgtcgaa tgccggaaac caatctttgc catttttgga    257160
     tggtagtagc ggcttgacgg caagagctgc accgtatctt gtcccgatgt tccaccaaaa    257220
     gtctgaacag cctgtttagc tccagttcct ctgggcatgt tcatccaacc atgagagact    257280
     cctccaagag ccatttgtga acgaattgaa atgcatcgaa ttcgagatgt cgctgtctgg    257340
     ctcggagaaa aagattttat gcgcagaaag ggatatttgt cattggaact ccgagaagtg    257400
     agtatagaat ttgtaagact gttgttcgaa cccgtcgatt agtcggcgcg ctcctaaatt    257460
     tgtagcttga acttactgaa gatggtatcg atcttccccc ggcacactga gagcagtgtg    257520
     ttagtaacaa cctccaaatt gggaagactg gtcgagttct tgccgcttac tcacaggctg    257580
     agataaccaa gaagatctga tcgaagtgcc tcctgccata taccgactaa ctgtgagaga    257640
     aacagttgta gtctcgggct ggccttgttt gttggtcgct atatcattct gattccactg    257700
     catagaggca cttggatgcg atcgcacttc acacgattgg ccgcggcgcg gaaaattctt    257760
     ggctgtcaaa gcttggtctc ccggcagctt tggcacctgt acatggaatg ttccttgtcg    257820
     ctggcgccaa ctttggcacc ttggacgtgc catcctggaa aaaccgagaa gacgatgggt    257880
     ctcttggatg ggagagcaac tggaatatta atcggactgg agtttgacaa ctaaagtttt    257940
     cgtgtgtctg tgttataaat tacaatttaa atcccgcacg gcagcttgtg gaacaagtca    258000
     gacgacaaga tcaatcttta ggcaatgagt gaccaaaatg aaagaccata ttgcaaaaca    258060
     tgctgtccaa agatgctcac tgttgcaatc tatatttcat tccatcaaag atcctcggct    258120
     tgactatttt gtttagctga catcgtcttg gaaagagact cgctttctct tgcgtcgctc    258180
     agacagggat ggctgctgag cgataactat ttgtttaaga tcctccacct cgctcttcag    258240
     aatttcgata tccctagcca atcctttctt gattagtcgt ttagtaacct tgctttccga    258300
     ttttctgcat cgttccatct gctcctctct cttggataaa cttttgaaag gtcctggctt    258360
     cacttgccct gtagatctag acatggttga ttagaagtgg acaaaggaaa tgcatagtgt    258420
     tcaagttatt tactgaccgg ttgttcgcaa gatttgtagg ctggtacagt ccgcatggtg    258480
     acgaatcgac cagttccgtt tctcgatcgg gtttgcgtag aggcttgctg ccatgacggc    258540
     ttccaaattg atcatccttg ccaggcagtg cgccttcaca ctccgtttga gttgaccccg    258600
     aggattcaga ttgacattca atcgcaactt catggtgagc gcttttttct gctctagctt    258660
     catcttcaag ggttttggcg agcatggcag agtatttgcc tggccaaagg gtagaggcct    258720
     tggtcacgcg gtttggcatt ccgaatgtga tatcgattga aagaaatttg aaaaaaatgg    258780
     ttatatgtac gctgtcagag agtaaactgg caataatttg tggaaggaaa ggagtaatat    258840
     atgagtcgag ggtcatggat aatgtgcaat ttattggcgg aagggtaaaa gatccatgga    258900
     accatttttc cgtgctatgt attctttcgc aaaagaattt ttaaaaaaat tctcaacgca    258960
     gaaatgaagg agagggtgct tcttggcaaa gagggcaaac cacgggtaca atcgagacca    259020
     attcttttaa acactagtta attcaacttt gtttaaatat ctgaacgccc atcaacgagc    259080
     tggtgaccgt cacgaatatg tacgcaagtg gtctttatga agagacgaag atcaagtggc    259140
     atgaaaggcg ccagattttc agcccagaaa aattaggact tgtcctcaca ctatgatgca    259200
     tcctaatgtg cctctcttgt ctgcagattc caatctgcag gcttgggatt ctccgtggcc    259260
     acggctgtcg ctacaatgag cccagcgatg taagatttcc gctccccgca ggacaagctc    259320
     tgcgttatca actgtgcttc gcaggatagg ctctgcgata acaactgtgt ctcgcaggat    259380
     aggtctgcgt caacaataat cctcgcaggg gctgtgctgc gaaatcaagg acttcggagc    259440
     ttccgtgacc acggctgtcg ctgccacgag cccagtgatg taagacttgc gctccctcgc    259500
     tgccacgagc cccgcgagtg taaaaaggtg cttcgcagga taggtctgcg tcatcaatat    259560
     gcctcgcagg ggggtgctgc gtcaacaaga ctaccccgca ggataggtct gcgtcaacaa    259620
     caatcctcgc aggggggtgc tgcgaaaaca agtctacccc gcaggatagg tctgcgttat    259680
     caatatgcct cgcagggggg tgctgcgaaa acaagtctac cccgcaggat aggtctgcgt    259740
     tatcaatatg cctcgcaggg gggtgctgcg tcaacaagac tacctcgcag gggggcgctg    259800
     cgttaccaag tgaactccgc agggggacgc tgtgatgaca agtgagaccc gcaggagacc    259860
     gctgcgttaa caatttctct gcaggagacc gctgcattac caagttctcc gcagcctagg    259920
     tcctgcgtca acaaagcgcc tcgcagggac atctgcgaca acaagagtct ccgcagggac    259980
     atctgcgaca aaaagaccct ctagcccgtg caggcacctc ttcgtgttgc tagggaccag    260040
     tattcgagtg ttccaagagt attcggagaa gcaaagacct gcgcaacatc ttcatcgtct    260100
     gttcattgtc ccgaagggtc atcattggat acatagaagg ggccctagtt agatctctgc    260160
     caattcaata gccaaaatca taaactaaca actgaagcgt ctccattatc aaaggacgta    260220
     tttcccattc cgttcccttg atagcttgca atccaatagc ttcctcgcta caatagaaat    260280
     tggcatcttt cattcagatg taggcaaaca gagatgagtg ttgtcttgga atgcttgtag    260340
     tgttgaaccg ttagtgttga tgggagtgtt gatgggagtg ttgatgtggg tgttgatgtg    260400
     agtgttgatg tgagtgttga tgtgagtgtt gatgtgagtg ttgatgggag tgtggatgtg    260460
     agtgtggatg tgagtgtgga tgtgagtgtt gatgagtgtg gatgtgactg gtgatgtgtg    260520
     ttgatgtgag tgttgataag agtgttgatg tgagtgttga caagagtgtt gatgagcgtg    260580
     gtaatgagcg tggtggtgaa tggtcgggcg gtgaaggaga tggtcccacc ctcagattat    260640
     gtaagtttcc tgaatagggg gttcaacttc accttctgga tttatcggtt atttatgtct    260700
     gtcactgtca cctaccgcca taaccaccgg tatagtaggt aatcgatgct gatagcgatg    260760
     tatcctgtta tataatctat taaatatatt gctttattat aaatttattg gtgagactag    260820
     tagacagtat aatctaagtg gatttgtagg ttcaacatat cttgtggtca tatatatata    260880
     tatttacaca ctttgtactc gcatcactat ttctatttat tttagatcac actctcaagt    260940
     ctcattcaga ccagactcaa cagcccaccg ctttgacaag cttggttcaa tccatctcgt    261000
     ctgttatata tccttctacc caactaatcc gaatacatag tattatgtga cctgtacgtg    261060
     gctaaaacat tttaaagtaa atgcgtgcgt gaagggcttg ttaacaagcg gcccatgggc    261120
     caaccaacgc catgcccgcc tataggcagg tggaagtaac tcattgatgg gccgtgtcga    261180
     ggtcgatcaa tatccccaga cgtaacacgg aggttttctt gccatctcat ccacatgata    261240
     gatgtatcaa tttgtattga ttctatctcg caagccgtct ctagtgcatt ctgatcactc    261300
     ggtggatttg catacagccc ctaattcgat cgagctggtc gaatgcaaac gccagactgc    261360
     cctccgttgg ttcaactctg aataggcaat acatacgctc aagatcagac ctaccagaag    261420
     catttgatga gtcgccgccc gaaatgtcat ttgttggctc aactaaacat cgtgatgcga    261480
     tagactctgc cttgcgtagt cgaagtcaga gcttcaatcg gcgattgcaa gtcactcaag    261540
     cctactctat atgtaggatg gctatatcct agaaccatcg cgagagtgaa agtggattcg    261600
     caacaaagaa aaccaagtta tcgagggtat tctttggccc aagattatcc gatcggctcc    261660
     tgcatttggg agtcaccgca atattgtaag taaccccccg gttggtaact acaactcata    261720
     gcgccagccg tctcccatgt atcaatatcc actactgcgc ccaaaccgcc gatcgttgct    261780
     ttctggggcg tagtacccgg gtacatgcga tcaagcatgc tctgctgccg agagaacaca    261840
     gcaggatggc tctgagtggt gttgttacag actaaaactc atattcacaa aggatctgct    261900
     tgaacagcga tatgctaaat gtcatccagg gcgcggtgag tttgacaaat atatacttaa    261960
     tgctgaatag tcgatgctgg gtgtacagaa accgacgagt ccctggcagg agctgcttgc    262020
     gcgcgatagg ttagaaaacg acatcaatag acagagacac gcggccggct tgactgacct    262080
     gcagtttcag tggcatccaa gacatatgcg actttctggg tatttcttgg ggtttgatag    262140
     agaaatgggt gcttgggatc caaatatacc aaacacctgt tccaaagaga catttctgac    262200
     accgacttga tgcagctccg catatttccg cttggttcgt ttccgctctt tcgtataaat    262260
     cgaacacctg agcaatgcgg agtaggagat gggacggtat cggatggtat ttctggctct    262320
     ttagctggct gggctgtgcc tcggtaacgg tcttgtcttc tcggttggta gctagtatga    262380
     ccgaaattaa cccctaggtc agaaacgaag ggagttttgc ctcgccttct ccttgcacgc    262440
     ggctttggac taacnacatg gccaatagtn aaggtaggct cccctgccat taagcaacgc    262500
     gagacatcgg catttctcgg tgcctgtcgg ataatcaggc ttgaaaannc gccggatgcc    262560
     atccgataac aacgtggggc cacccattgg acgccagtaa tcnaattcac gagggttatt    262620
     ctttcactat tctttcacgg tgttcgaatg ccgaangaca cacggtgnta taagccattg    262680
     gaatttggcg tatgtatcgc gtagacgcat cagcacatga cctgatatac agagtcgact    262740
     gagaagaagg gcgaaggtaa aggcgatcan aactttacat tggctcatca tcgatgccac    262800
     caatggtcat gtcgggntga tagagcatgg aatcgcatcg ggatcgggga gtccgancag    262860
     acaatgcact tgcgcgcttc aatccgactc gagtgacgag accaagaggg cacctcctat    262920
     tgtacgatcc gagtcagcaa ggcttgaacc actgggacaa gttgttatca cttaccagtt    262980
     cataaagatc gcagtatgtt tgcttgaaac gagacgatca attagcttga tgatcatatc    263040
     atcttaccta caagatcact tacaattgtc ttcatcgatg tggtcaccgt tcatgccatg    263100
     ttgacatgat gttgtatcca gatcgtcgca gtctgcggct gtcgcttcga agaagccacg    263160
     ctgggtgcac cgggcaactt ctgagagcca aaggcgcgtg atgagcccac ctgtgataat    263220
     aaattgtaga gtcgtaatgg gataagacct cgcgatgtag tcggatagag gttcatacac    263280
     tccgccggtc atggtatgaa ggcggtgaga tcgaaggcag aagacgcgat ggagcacgcg    263340
     tcgtagtccg gttcggtgat aggtctccgc acaagggtgt ttcacgggca gcgatgggct    263400
     gctcctatat acaatagcat gaagatcagt aatggcgttc atgatttggg gcacaaaaac    263460
     ttgcagaaat aactggatat agctgagcag aaggcgcgat atatcactta ccttaccagg    263520
     aagaatggac gttctatgcg gcgaatttcg caatcggatg ttcacaccct gttgttggcc    263580
     cgctccttcg agttatatac tatacctagg gtatgctgtg tggtatgaag cgacgagaca    263640
     aggtttagtg tatcggctat ggctttatac agagcactaa cggggtgccg tattctcggg    263700
     gccactctgg tgcgatgtca atggttcact gtcatgcatt agcttgtaga ccggtgagat    263760
     aatacatgac tcacatgttc tgttggcaaa acctagggat gaagggacga caaagagcta    263820
     tggtccttgc gcgcgtgtat tgtggtcgac tgtcctcggt tctagatcgc ctcgacttca    263880
     ggatcagtag aactccagac aggtcaagct aaaattcaca cacctgcgac gtggtattcg    263940
     cgcttttgcc ttggggatac acgcggggct gtccagtaga ctagctcagt cggctggggc    264000
     ggaacatcag acatcttcgc atagacgttt ggaccagtca gcctaagtca tgtctcttcg    264060
     atcggctggc tggttgcaaa gtggatttgg tgagatatct tccacaggca ccttctggct    264120
     tgctggtcca tgttgtattc tataaatgtc agtacagtac aaatttcagt actgggtcaa    264180
     aggtaagaac ttatcaagtg cctcagacac aaggcctgct tgactctgcg tggtcaaatg    264240
     taaataaatt gtagagcaaa ttgcccgggg gtagaagacg tatttataga cttctcggct    264300
     catcctgttt cacaagtgct ctgcttgcgt ggagggacac tcctaactga ggcctgttga    264360
     aacccgttct ccttttcacc gcaattattt ccagcgacag ctgcttttga ctttaaatgc    264420
     tcagtgagag agactagtaa gagtggtgtt gagaaaaggg atgctgagtc ggtcaagaaa    264480
     tgttggctga ctgttgaatc cttcacggcc ctctaattga ggcttgtggg agaaatttaa    264540
     tccgcaatga catgctcata tctcttgttt ttgatcagcg catctatgag cgactcaacg    264600
     ttgaatcacc gaaaagcgcc tacaatttca tcccgagaaa tcatagaatt ctttatactg    264660
     gcctcgcttt agtgttgtat tggttttgag ctgtgggtct gtcgggtcta gacggcagaa    264720
     tgcgaggtca cggtagattg tgcgggtgct cgacccgtca acccgttgaa gcttggccaa    264780
     acgttgtcag cactcaattt tcgaacttgt gacgacgaag agacattagt caagattctt    264840
     tttccgtttt attgatttgg gcttcttttt tgggtcacta taagttttac aatgttctgt    264900
     ttatcgagtt tctgaggatt tcaacgaaag tgaagatgcc cggttgaaat gtgtttcact    264960
     cgatgagcgt tcatacctgg cccttaacat agcgaggctt tattagtttc cccaccaacc    265020
     cattgatcac ttttcctttt atcagattta ctactaatcg cccactaaaa tcaaaaacga    265080
     attccttcaa aagctgcttg cgtttattga ccaacctagc tcggtgatcg taaaacccag    265140
     tgcatagtta cctgcggctg catattctat aagagacacc aaggcatgat gggaacagta    265200
     ctgccatctt taatttctcc tgcggacaga atggagtccc caaacagctt gccaggccag    265260
     gaaaaagaag aacagcagcc cagtgaattg ccaatcctta gtgataagga cgataatgtg    265320
     gaaccttctg atcatgtgct tccattggta agtgaaaccc ttcggcttca aatcctttgg    265380
     ctgaccatcg tagacctcga cttcgcaaca cgaagaagta acaagacata ctttggcgac    265440
     cgagcctttt caacccatct tgaaggtgct agcagacctc gaacgtgacg atcccaagtt    265500
     tgccttccca gcagcccgac tcgttggatt ctatcgacgc ctatgggagt catgcgtttc    265560
     caaacacatc gatgtccaaa agattgacca gagcaatgag atcttgaagg aggctggtac    265620
     acacctgaga aaagagaggg acggtcttca gcttcaccac aagaagcagg tagnnnnnnn    265680
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    265740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngatggga cggtatcgga tggtatttct    265800
     ggctctttag ctggctgggc tgtgcctcgg taacggtctt gtcttctcgg ttggtagcta    265860
     gtatgaccga aattaacccc taggtcagaa acgaagggag ttttgcctcg ccttctcctt    265920
     gcacgcggct ttggactaac aacatggcca atagtaaagg taggctcccc tgccattaag    265980
     caacgcgaga catcggcatt tctcggtgcc tgtcggataa tcaggcttga aaaaacgccg    266040
     gatgccatcc gataacaacg tggggccacc cattggacgc cagtaatcca attcacgagg    266100
     gttattcttt cactattctt tcacggtgtt cgaatgccga aagacacagg tggtataagc    266160
     cattggaatt tggcgtatgt atcgcgtaga cgcatcagca catgacctga tatacagagt    266220
     cgactagaag ggcgaaggta aaggcgatca gaactttaca ttggctcatc atcgatgcca    266280
     ccaatggtca tgtcgggatg atagagcatg gaatcgcatc gggatcgggg agtccgacca    266340
     gacaatgcac ttgcgcgctt caatccgact cgagtgacga gaccaagagg gcacctccta    266400
     ttgtacgatc cgagtcagca aggcttgaac cactgggaca agttgttatc acttaccagt    266460
     tcataaagat cgcagtatgt ttgcttggaa cgagacgatc aattagcttg gtgatcatat    266520
     tatcttacct acaaggtcac ttacaattgt cttcatcgat gtggtcacca ttcatgccat    266580
     gttgacatga tgttgtatcc agatcgtcgc agtctccggc tgtcgcttcg aagaagccac    266640
     gctgggtgca ccgggcaact tctgagagcc aaaggcgcgt gatgaaccca cctgtgataa    266700
     taaattgtac agtcattatg ggataaaacc acgcgatgcg gacggccaaa ggttcataca    266760
     ctccgctggt catggtatga aggcggtgag atcgagggca gaagacgcga tggagcacgc    266820
     gtcgtagtcc gattcggtga taggactccg cacaagggtg tttcacgggc ggcgatgggc    266880
     tgctcctatg tacaatagca tgaagatcag taatggcgtt catgatttgg ggcacaaaaa    266940
     cttgcacaaa taactggata tagcgcagca gaaggcgcga tatatcactt accttaccag    267000
     gaagaatgga cgttctgtgt ggcgaatttc gcaatcggat gttcacaccc tgttgttggc    267060
     ccgctccttc gagttatata ctatacctag ggtatgctgt gtggtatgaa gcgactggac    267120
     aaggtctggt gtataagcca tggctttata cagcagcaac gggctgccgt atcctcgggg    267180
     ccactctcgt gcgatgtcaa tggttcactg tcatgcatta gcttgtagat cagtaagtta    267240
     ctccatgact tacatgttcg gatggccaaa actagggaca aagagacggc aaagacgtag    267300
     tccttgtgct cgtgcgttgt ggtcgaatgt cctcggttct attggaatcg catcgacttc    267360
     aggatcagta gaactccaga caggtcaggc taagattcac atacctgcga cgcggatatt    267420
     cgtgcttttg ccttgggagt acgcacagag gctgtagaat agactagctc agtcgactgt    267480
     ggcagagaga catccccgca tagatggacc agccagtcta agtcttgtcc ctttgatcgg    267540
     ctggctgctt gcacagtgga ttggctgaga acaatatctt ccactggcac tgtatggctt    267600
     gctggtccat gttgtactct ataaatgcag tatttcagta ctcgttcaaa gggtaagaac    267660
     ttatcaagtg cttcagacac caggcctgct tgactctgcg tggtcagacg taaatacatt    267720
     gtagagcaaa ttacccgggg gtagaaggcg tatttatagg cttctcggct catcctattt    267780
     cgcaagtgct ctgcttgcgt ggagggacac ctcctaactg aggcctgttg aaacccgtgt    267840
     ctccttttca ccgcaattat ttgcagcgac ctcttttgcc tttggatgct tagcgagaga    267900
     gactagtaag agtggtgttg agaaaaggga tgctgagtcg gtcaagaaat gtcgactgac    267960
     tgttgaatcc ttcacggccc tcttgaattg aggccttgtg gaagatattc catctgcaat    268020
     gacaggcaca tatttcttgt gctgatcacc ttatctgtga gcgactcaac gttgaatcac    268080
     cggaaagcgc ctacaaatct atccctagat gccatggaca tattttcccg accgtgcttt    268140
     agtgttatgt tggttgtgtt aagccgtgtg gctctgtccg tctagactgc agaaagtgag    268200
     gtcacagtag gatatgcggg tgctcgaccc gtcaatccgt tgaagcttgg cggaacgtta    268260
     ccacaatttt tgaagtcgtg accaacggag atacattctt tttgttttgt ttctttttct    268320
     gaacatcttg ttttagtgac tataagtttt acaataccgt ttaccgaatc tttgaggctt    268380
     tcaaagaaag tggaagagga gcctggttga aatatctctc acattaatgg catatctggc    268440
     cctcaacatc gtaggcttga tcagtctccc cgaccaactc gttgaccact atcccttctc    268500
     tcagatttac taccaagcgc ccgctaaaaa ataaaagcaa actctcacct ccgacgttag    268560
     atgcacattc aagggaagct cattctggtg gcttgctgca agtcaggagg ttcattgaag    268620
     atcttctcgt agatctcagt gagaatgcga gcatctgcgc ggagggtggg agatatgttt    268680
     tcgctttgga tgagaaagct tatggtgcgg acgaggaggc gcttgagttg ctctggctcc    268740
     acgagctcct ttagacacga cataaaagtt gcagatagga caagcatatt gccgaattgc    268800
     ctgtgaagaa aacatgtaag ttttgcctct atgtctgtga ttctttgaga ctagggtcag    268860
     gggatccctt acgcatgggc agttccgaag atgttggtaa cgaccaatcg atgtcctcct    268920
     atcccgtcaa aagcctccgt gctcttgata gccgaactaa tacagatata gcatgcagct    268980
     ttcagcttct tcggcagctc gtgtaatcgg acttcaggtg gctgccagtg agtggagatt    269040
     gcggccggag tagagtccat gtcactagac atatacgcca tgctcggagc gcgagcggcg    269100
     ctgtgcagta tagaggggga caactgttgc aaggtaggcg attccattaa ggtctggcta    269160
     aatggactga cacgggcacc tgtatgaccg tagtgtagtg cgtggtagag aaggggtcgg    269220
     tggataatat accgggcacc gtaatacttg gcacgcatgc gggcagcgtt gatttcgttt    269280
     gccggcggat cactttcgtc ccattgcatg ctgtcgggta gactttcacg ccagcggtcg    269340
     aggttcaggc tgagagcttc ttgaacggta aacgaccatt gtgtctggtc ttgcttttca    269400
     accttgtata agtctgtatg tactcgattc aagattttgc gtagatggat ttgggcagaa    269460
     taaaacagca tcatcatcgt ctctggtgcg gtgagattat ttggtagaaa tatcgtccat    269520
     tttcctttcg gaataggtat ccgaccttcc gaacgggaga tgccactcgc tggaatatcc    269580
     agctctgcga gaagatcact ctccagttgc agacaggtcc agtacgcaaa atcatacaag    269640
     tccttcgtag ccccctcatt gagttgctca taccgcttgg ttctcacaag tatctggcaa    269700
     gcccttgatg cctgagaaat ccaactgtgg ctctggaaag ggtgggccaa ctggccggca    269760
     taaagtccag caagcaagcc gcactgaaca tgttctagct catttccacc ctgcagatgg    269820
     cccagtattg cggttgcata tccatagaga gtcaagccag ggatagcctg gtagttcctt    269880
     gtgttccctt gcttatcccg tgtgtttgtg acatctcgcc ttgacaagcc ttctacacca    269940
     ttgttggatg aactgtttgg gaaagcttgg ccgacaggct gggctggtac actatagaga    270000
     ggatccgaaa gcgacgtctg cacggccgct gagtcagagt tggcgggggg aagcacacca    270060
     ttagcatccg tgacgtatgt tgtaattgca ggcggcggag aattgaatgg tgccagcggt    270120
     gcagggatat gctggttgag gtagtcaatc ttattgtccg tgatgggccc agggagaggg    270180
     gcaggagctt cgcaaatggc tccgatggcc aggcacagca gaattaaggc agcatcaatg    270240
     tttttaccga ctcgtggccg tagcgggttg gagacagtct ccataaactc gccacgcaca    270300
     ctcaggtctt catttgactg cctctttttg gctggaggcg gaccatcacg agccggtcga    270360
     gcgtagctgg aaacagagct tggtggtgaa ttgtcggctc gacaatagcg tcggataaaa    270420
     ctatcgacca taatcctgag ttcgccttcc ataaggaatg ggtggagcct aaacatgtgc    270480
     ttgaagtagc tatcatagta gcgcctagca gtcgtagcat ccagatccaa gtttccgaat    270540
     tcgtcgatgt caacattggt gtcctctcct gcaccgttta caccgggtcg agcaccttta    270600
     gagtcgcaat ccattggtaa ttgactgtta tcggcagtgt atgagatctc gccttggccg    270660
     tatatgctga tgagaccgcg ctcttcttcc aaccgcgtga catagtcctc atcatatctt    270720
     tcagggtgta tcagcctctt gattgacggc cacattaata gcttgtgagc tgcagtggtg    270780
     tgctctactg ggatggagag ctctccctcg gcctccttct ggcggtacct ggggtccacg    270840
     gctccaagct gttggccaaa tttcgaaccg ttcacatcct gggtctgagg catcgctgct    270900
     ttgagaggtg agtcctgcct gatgactggt gatggtggga gggccggatg ttcttgcaca    270960
     gtcggatgtg gatgtctaac ctcttcagct aggttgaaac ccacttgctc ttgcatttga    271020
     tcttgccatt ttgcgaaacg ctcatcgatg cggttggctc gctcctccat gcgagtctct    271080
     atctgggaga gccgatctaa taccagctga gtagtcttct cttctttgtg caacggtatc    271140
     tctttgtaga cacagccaag gttgtttact ttgcagtggc tgcaacatgg tcgtccctcg    271200
     tcacactttg cttttcgagc tcgacattga tcacaagcct atatggttag agtgttagtg    271260
     ggaaaatctc ccggaacaag ccctccttct tctagcttaa catacctgcg tagctcgatg    271320
     tgccttcctc tgaggtgctt taagcacctc tcgttggtaa caaccctgac tgtacccgac    271380
     atggggcgta tcttttgcca tttgggtaac ataaattgtg gaatctgata caggaggcag    271440
     acttctcgaa acagataaat gttcagcgtt gttggcccga ttcaggagtg ggtagcccat    271500
     gtgagcgcgg aaaccaggtg agccctcgta cggcgcgccc ttcgttgact gttggaagtc    271560
     ttggtaagga actggatctt gcgcggaatc tgtgggcaca tgtataggtt ggccacgatc    271620
     cttcagtcga ccatacatgc tttctgatgg aagctcaggg ttacgcataa gggggtatcc    271680
     tggtcgctgc agcggaccca gggagatatg gtgcccttcc ggaaaagaaa tgtgatccat    271740
     tgcaattaga gaatccgggg gtgcggaggt gtttgaggct gccaggtgca gccgtcttgt    271800
     gtcgtcgtcg taactaacca tggttcttga cactgggtat atcttgggta cccgatttac    271860
     aatgtgaagc tatttggctt ggtaggtcgg agttcgaaca aatacagcgc tttggaatgg    271920
     aacagaggaa gtgagatata taataaaaag ggaagggatg aatggtgcag tagtgatgga    271980
     cctaatatcg gaaggcgcaa atatcaaacg atgaaatagc ataataaggg cccctgtccg    272040
     cccaaggtat ggaaatttta aggacaaacg ggaaggaaag aagtcaaagg agagcagtgt    272100
     gcatatatat tctttctaca tcaaatagta cctacggcca ggcagtgagt cttgcagctc    272160
     atctaccggg atttggctac atgactgatg gccgctgact aattttcaag gttgtctatt    272220
     agagaggact aatagtggtt tcgccaaagg atcgacgagc ttgcaatcac aatatgtggg    272280
     attctctaac tatttaccca gtccgaggaa gaacccacgg tggccccaca cgagcatcca    272340
     ataatataag tctgcaaatg cactttgcaa acccccatat ttcctcaata aaagtggaga    272400
     gccgcaaggc ttctcctcaa aagtagtcta atgtggttcg aggtcttggc tacaatcgag    272460
     caatacgcca ttacctttca tatgccaaca atgtaccctc ggcctttgtc cctcaaaaag    272520
     gtgcataagc tatgcgcccg gttactccga tggtcatttg tctaagagac caaaacgcgc    272580
     tgacgtgagc ctgttatgta aatctatcaa tgctaggtgc ctgaggcatc aaattactcg    272640
     gtgactcaac caagtcggcc tcagatcgag attagtaaag ctagggcttg ctaactatac    272700
     gcataaaaga aaggggtttc tcattgtacc gtggcgtttc atgagtattt acataagtaa    272760
     ctttccacca tgaccgctct gtggtatacc gcctgcctat tactactaat ctgaccccac    272820
     ccgcgtagca tgactggttg gatgtgaata ccgattccat gcccccatct gatcccattc    272880
     ctccaccaga ttccattccc ccatctgatc ccattcccca atctgattcc attcccccac    272940
     cagattccat tcccccattt gatcccattc ccccatctga tcccattccc ccatctgatt    273000
     ccattccccc atctgattcc attcccccat ctgatcccat tcccccatct gattccattc    273060
     ctccatctga ttccattccc ccatctgatt ccattccccc atctgattcc attcccccat    273120
     ctgattccat tccccccttc aaaccccttc cacttgagtc tattgctctg cgggatgata    273180
     accccagata tcccgattaa gatagaccta tatggcaagc catttgactg gtcggagggt    273240
     ggactatccc tgaaccagct gattgtggcc gaaaattatt tgcgttttgt tcttaagttt    273300
     tttgagcgaa aacgttgtgg gagggagaat gctgataatt acaataatac cccaatttca    273360
     ggaggggaac atagtaacgg cggggagagg aagaggaaaa agaaggagaa gaagcccatt    273420
     gggaaaatac tcgaagatac agctaataaa attagggcaa gtggtccaga gttgacaatt    273480
     tggctcgagt cagattctgg aaaacatcgc aaattgaaaa gagagagcgc acttcaaaaa    273540
     tccttcgaaa agaacgtccg aaacgatact tccgacttga agccgttggt tgcagctaaa    273600
     aagggagaat ggacccagaa cagaaacgaa acattactct ggttggtctg gcgacaggtc    273660
     tctttagcac aagcgctgct tgtgctttac agcttttccg caaatgacct tgacggtttt    273720
     accttcgagg aaataatatt cattatcgag tttgtggcac acaatcagaa ctcgctcggc    273780
     tgtgaagctt tggaagttga agccataaaa ctcatttccg gtgagaactt ccgcctattg    273840
     ttgatccaca cacaatgacc aacatactca gggccgtggc gcagctcaac accgccactt    273900
     gtaggatctg aggaaagact gagcgtccat aatctccctg aaaatggcaa cagaagatct    273960
     tctagccctt cggcagatcc tgaccctaat ggagggtttg atatatcatt agaagagagc    274020
     tcgtccagtg agaatcagcc ctttcccgtc gtctcaacaa gccacacttt tactaattaa    274080
     ctgattggat gactaattcc gaacagaata tcaatttgcc acaaagaaaa gaaaagtagc    274140
     atcgtccctt tcggcatcag atggtctaat taacgataac cctcacgaga gtgccctcac    274200
     agcaataccc agcgtttcgc cctatcctac ctgccgtcca gtcatgacga ctccggcctc    274260
     attggaatta cttggcctgt tcgccgctct cggtggtgtg aaggtgccaa gtctaatctt    274320
     tgagcgattt ttgagccctc agttacgttg gagtgaagat ggagatcctg tccctgcacc    274380
     attacctcta aattctgaca cgccgggtgg cgagcttttc aacagccctg aatctttgac    274440
     cgaatctcta gagcaactac gctcggggtc gtggatttac atggatcatt tcgacaaatc    274500
     ttcgtatcaa agattctccg tatccgaaag cgtaagagag tattctgcgc agcttttgaa    274560
     ggtcaagggt cttcattact ggaccttgct cgcattgcag tttgtctgtc acgtgttccc    274620
     tcgcgacccc actttggagg ccaggtgaga agtcctccat gaacacgcct gcttttacca    274680
     tgggcattgg tcttgttggt acgttgcagc tgatatttta tatagctttc agagacatgg    274740
     caaaattctc tctcctgtca tcgatcatct gattgaacaa agcaaggctt tcgagctgcc    274800
     aaaatctaca aggataacaa ttgcagagat ccttgttgca aaagcgaggg tcggaagttc    274860
     acagtacaat cggcagtcgc tggatgaggc tactgaactc ctcggtgacg aaatcccgga    274920
     ctatatacga gcttcaatcg ttctccggcg aagtatactt ctacggttag aaggggctta    274980
     tcactcatct gagcaagaga tccttgacta tcaaaacgga gccgcgtctt acgaggtagc    275040
     caatccgaga ctacgtgcgt taagtcgtct gttgttgata tcacacctag agaacttgat    275100
     acagctggaa gcctatgaaa aggccgagaa ggaaatccgt gaactcaaca aatgggagcc    275160
     gagcgagggg gcactatggt ccccaatgga actatctgtc aacttcaaga aatggtctac    275220
     ggtttcaaaa atctaccaat cccggggcag attagagtcg gccaagtctc accttgtcag    275280
     atgctattcc tttttacggc cagaacgcct tcgaaacgat acggaattgc ttcctgaccc    275340
     ggacccaaac cgatttcaga tcatctgcag gttatccgat ctactctgcg cagatgggta    275400
     ttgggtcgat gcgcggtcga atattgaata tgaaatcaac tcaatttcga gcgattttcc    275460
     aggaaagttt gccaaggccc ttacacgttt gaaagtgtct ttgttggatg tcgatattgc    275520
     cgagagtaaa tatgatcaag cttcttcggg tattgaatgg ctgaaacaac agttcgttga    275580
     gatctcgccg ccagatatca gttatcagtg gctgcacgta cgctcaatta tagcctctgc    275640
     ccgacttctg cattcccaac gccggtttaa ggaggccata tctgagtggg acctggttct    275700
     ttcgcttgtg agaaaatatt cggacagctt tgaacctgaa ggcttcttct atggacttgc    275760
     tcaactatcc atcgccctcg cacgtctcca aaatgcccgt tccacaacgg acgcttcttg    275820
     catttcctcg ccaagttggc acgctgatac gagacaattt ttcgacaaag cctgtgctgt    275880
     tctggctcgc gaggatgtga attattgggt tcctacgctg ccgaagactg ttatacccga    275940
     ccttttattg aatatacagt ctacggaagc gagctggtgg acggcggatg atttcctcaa    276000
     actacagcag aaatatccct atcttccagt tttcgacaaa agacagcaga gattatcatc    276060
     gaggatgtga cgcgatactt gtttcagata tttgagtcag ttttgtggtt gggggtattg    276120
     ttcttatatc gtgatggcct gtatgattgt tttccctgat ctaaaccaat gaaagccccc    276180
     tagcttatcc tgacttcaga cgaaatttat attacgcttg cacataaatt ggatacagat    276240
     aataatggat acgtcggatt tcaaggtgtc ttcatacttg cccatgcacg tagaagccgc    276300
     acattacgat atcggttaag ttaattcggc ctgttcaata ttgaactgcg ccaaggcctt    276360
     ggtgatgggt ccagaaacca actgcaatct tcacacttct tactggcttt tgacaaatga    276420
     gtactatcac cgccaggaga acaaattgac tagatttgtg cccataccat aggtgacaaa    276480
     ttatccggtg gatgaccccc cttaaccacc ggcaccgatt ttgtcaaacg cgtatacctg    276540
     tgtcactccc tccccgttct ccgcagctgt aaccccatat tggtgggcgg tgacaattac    276600
     gcctgactaa tgatttattc tggtgaaata gttcagctga ggtgtagttc agctgataag    276660
     ccgttcagat ctgtcaagcg cacccttgcc aatcctcatg agcacctttc tcttccagca    276720
     aaggtgatgg ttgacgacag ctcttcagta tacaagggag tttttttaca ggagaaagga    276780
     ggtggtgtgc agaagatgag ggaaagcggg aaagggagcg caatcaacgg atcacgttcg    276840
     aggaatccat gtgccattgc cataactcag tctcccgacc gctgaaggtt gcaaggctat    276900
     ctcgctcgac tactggaaca atacttcttc gtaagggaaa actttgtcca acacaattgg    276960
     gcccgtggtc agattgtatc tcctaacggc aagcacttta tcgcagtgtc tgcaattacc    277020
     tgcaatccac ccaaaaagcc ctacttatta ctcttggaga gctttcgagg cactgcgcgc    277080
     ttcgccccat aagcagtgaa ccggggctcg agaaatacga ggagcttgca aaaacccgac    277140
     tgctcgacgt gagtttatgc tcggcgatgc gatgatacca acgctttgac cgaaagccaa    277200
     gttgaaacag gtatagatca tcccaatatg cgccacgcta ggcctgagaa attttgtatc    277260
     caccgagttg aggctattac caattctccc aaactctccg tcgaatcctc cgagcggggc    277320
     tgcgacatat agaattatag gaagagatgg cccaacgcaa cacagtccca acggagcctg    277380
     tggaaaaact ccgatacaat gctgaacaaa gtgttgactc aggtaccgtt caggcatacg    277440
     atgtgatggt tgaaaggagg ccggccagat gctatttcgg ctaatggact tgtccgagtc    277500
     ctcctccatg tgcattatgg tgatccggcc acgttgttgt atcgtctctg tgaacccaac    277560
     agagaaatcg gcgaggaaaa tcggcactac agcagaacac gcccgtcgcc aggccactat    277620
     ggccttgttt acaaagtttt cgtctcctac gcgtgaccaa cagtggcgga attcatgttt    277680
     tggagacaag cgttgaccat acgacaaaat agtacgaaag ccacagcagc aatcatagaa    277740
     tcaccgccaa cctacgggcg ctagagcttt accttccccc tttcagccgt aagtcgctgt    277800
     ttaaggaagt gctgctctat ttttgctctc tgtcataacc ctactggtcc aagacgatga    277860
     tgtcttcccc tgatactaga cgtataggtt aggtaggaat tgaatccctt gcacacaata    277920
     acccttcaaa tcacctggaa gagagcggaa gttgaacata ttatagctgc ccttacactc    277980
     tagagcgaag aattttactt cttttgccat tgatgccttc taaatattga aggcgacaag    278040
     tccgtaaggt cactgtacat ccagaagaga acgcgactac ctaccctcga cgccgctcag    278100
     atcctcagct tttcctccgg ctcctctttg tgtccacccg ctgtctcttc cgtgcaatac    278160
     atacataccc cctggcgact ttgtgacata tgttaacttc tttgttgtcg cttcgggcat    278220
     tgaatccagc aaacagcaaa caacttttca gatttctacg gaatcgactt tgccgtctat    278280
     cccttatcgg aattatcggc accatgaatc cgaaactaag agacccgtgg aaacctgtta    278340
     ctcaaagtcc ctgccgagaa ccatggtcgg gtgcttggga cgattctgca ttctgcgtcg    278400
     aagagctgac caagaaggct gcatgatgca tttcaggccc cggacctcat ggaggccata    278460
     gaagatgatg ctggcagcga accaatattg aaactctacg gagcatatgg atattttcaa    278520
     agggctttaa tgagctctta aacccgtttt taatcaacct aaataaatcc acgtggatgc    278580
     ggtgctgata acttttctcg caccttcatt tgatactaag ctttggatat tctggaatcc    278640
     tgacaagatg gagtattctc gggtgacacg gtaccaatct cttttgcttg ctcttcgcaa    278700
     tactttgcca tgaagatgtc tttggacgag agacctggag gcgaatgggt agtccaattg    278760
     aacgtaacag acgaaatatc cttgattatt tgttagcttc ccaagcacat ccagaattgc    278820
     aatgtggacg gacttacata aacgaccagc ggatggtggt tccgtgactt gcaccttact    278880
     cccacgatat taataaaatc ctgaaaaatt agaaagagta atgtaattgc catagaattt    278940
     gaaaccaacc aaaactttcg tatgagtttt aaaatggaat gacttccgaa tggtatcgtt    279000
     atccagtagc tcccagcccg attcggagag cagtgcctca atttctgcct ttacggactg    279060
     aaagatttct cctttcgaaa ctttgatatt cacaggagat gccatcatgg ttaaactttg    279120
     ttgaggtaaa gagttcgact ttcggcagac tttgatgttg agcggggtaa atacgccata    279180
     taaaaaggag accaagagat tacctaattg aatgacgtga cctccagaaa gttcatatcc    279240
     cttgtgatgg tcccgcccag aatcctcaac ccgactggct ccagcatccg cgttccattc    279300
     cgcaccattc tcgaccatcc cataagacag caatcccaac ttgagccccc caaccggatc    279360
     cacgggccca tacgtagaat cttgtacgga gcttaatgca ctgaactact catattcagt    279420
     ctcttctgcc gcagaaatat ttcaaaaact cgtctcccct catgtcgcgg ttcacaaact    279480
     tggcgcccgg gctaatattg acgtggcccg cgcgaacggg ggccttctct tctgcaccat    279540
     cttgcgtatt tcgatcctat aaggatgagt accttgacgg ggcaggtaaa taatccggga    279600
     aacgttaaca tacggtgcta acgccctcgc caggcgattc agatccccca agaagcggtg    279660
     tactgtccat ctgtttcacc cgttctctag gtttgaacac agtcgatgca tttctgccgt    279720
     tcaaacttga tccgtcgtcg aaggtacaat gagatcgaac ctatggtggt gtggcctata    279780
     ggccttgcca ttagaggtcg catttgtgga aagtattaat gggagctgag gtagaggaga    279840
     gaagagatga accgctgact gtcagtttta ggtaagtcgg actcacctgg gtcacctact    279900
     ttccaccgtt cctaaagcat ccgaccatcc tagccctgct tgcctcatgt caccattagt    279960
     cctcctacca tcagataaga tccatcccca gttgcaatgt cacttccgca cggtttctct    280020
     tctgctatgc tcaaacttac tgaatcatcc aacttccccc cgactaaagc tcttcgcacc    280080
     tgagtcggaa acgtcttagc catcaagata tgacatctta ctccgaactt tggctggact    280140
     ggtttggact ttatcgtttg attgcaattt gctggtccaa atgataattg tcaggcccat    280200
     cgaactactg acctctccca tctatctctt cgtcaaacga tcgcttgtct ttgctcgacc    280260
     aagaggccgt atagcacaag ggtcagcaca ctactccaat gttatatgct tcgaacaaag    280320
     ggatcctcta cacgactagg cttgaagatt gctcgcttcc aaggctgaaa caacatcatt    280380
     acaaagagcc tgaaccgctc gcttgcgctc ccacaatact gaagcttctt cattgcacag    280440
     ctgtagaagt atatcgctat cgcttgctag caactcattt gacgcttgaa gctgtcgctg    280500
     ctcctcctcg agccgtattt tctgggccga tttgacgacg tagcattgcc ataggcaaaa    280560
     gtacaagtcg agcaatttga ggactggtgt agcgagggag tcattgaggt ttactacttt    280620
     catgaactcc gccgtaaggg taccgcgtgt tctcactggg atctattcag tattagtggg    280680
     gttttcattc cctgccgtgg gggatatgac cgaccttggg ttcgatggtt gagccgtttg    280740
     tgacttgctg tggttggttt tccaacttgg gttcatcttc tggagcttgg gatactcggc    280800
     actgtctctt ggccggccga tcaattgggg aaggcgaagt gggatggtcc attttggtca    280860
     tcaagacgaa ttggatcaga aattatgctt gaggggcatt tatagctgac aattcacgcg    280920
     aggctgctgg tatttctacc agtgcttcct cacctaggat cgaccgcact ttggaaaggc    280980
     cagtgaacag ttagctcaac cgctgacgct cggtctcacc agctgctcag agcaaactgc    281040
     tcaggaataa gcgggattaa atcgcatcta cagcattgac acaaactaat gcaaagactg    281100
     tctcataatg gtagtctaca agtgtacttc cgatgcgtgg atgctataaa ttactttcaa    281160
     atcattgaag ctttgctgtg actgcaaacc attcgaagtg cggaagtgca gataatttga    281220
     ttcgcaatgt tgatgtcaac aggcgctggg aacagccatc tcgtatcaca tcaccagagc    281280
     tacctgaagt agatgtcgct agcccttaca aacgatcaaa tattctcctc ggagaccgtt    281340
     tcaacaattt tttagtagtg ttgtcatcat aaattctgct tcgaatggcc ttctggatgc    281400
     aatagtcctt cgctagatcc agggatctcc tcaaactgaa gtgtgtcagt ctgggattgg    281460
     ccacaagtgc atcaacaatc gagaaatgtc cacccctgac cgccaacatc aatggatcct    281520
     cgaaccattg attcctcagg ttgacatcaa ttcggtcatg gcgtagtagt tcccggacca    281580
     tctccaggtc accgccacgg gcagcaatgc agagagcagt gtcatgggtt gcgaccgtgc    281640
     tttcattaac attcagacgt gcgccttgct gtactaagag ccttaccaca tcgagatgac    281700
     catgtgaaac cgctcgacaa atgggcggat ctattaaacc ccttccattg atctccacgc    281760
     cctccatact cagtaaacaa gcaactgtct tcacgtgtcc gtgatatgca gcaacggaaa    281820
     ttggagagtg gcctgcaacg cagagattca gagcaatccc tggcactgca agcagccgtc    281880
     gtaaaagtat agtatccaat ctcgttgcgg catggtgtaa agatgtagac ggggcctcaa    281940
     gtctcccacg gcctccaacg aaattaacgt cgatgtcttt ctccgccaag agcctttcgg    282000
     ttatctcgtc gcatgacgag taagtagaca gccaaagtgg cgtattgcca tctttgtctt    282060
     tgcagttcac gttggcaagg gggtggccca ggatcaaatt gaccacttcc aggcgtctgc    282120
     tttgaacggc gagatggagc ggcgtatagc ctttccggtc ctgaatgtcc aagttcagac    282180
     ccttttgtct aagacgccac ttgacagcat ctatcgaccc atgcaacact gcctcatgaa    282240
     gaggtagctc ggaatcctga gcatttcggg cacctaaata aacttcacag tcggggccat    282300
     tgataaacat tattttcatg acgggtctat tgattcgaca tgcccaagac cacgccgact    282360
     gacctgaatc atcttccaag ttagggtcgc tgccacttaa aagtagcagt tgcacgaatc    282420
     ctattcttcc tgcgaagact gctaggtgaa gcgccgttcg cccgtgtttg tgtttaatgt    282480
     ccacactggc ggcgcggtgc tctagcacgc tcttgacgat ggaggaactc ccgtagtgga    282540
     tagcatatga cagggcggtg tcgcgcgctt gattttggat attgatatct agatctggat    282600
     gactgagcag cagttcgcgc acagcagcgg aagagtattt caacgcccgc atcaaaggag    282660
     ttttgcctcg gtaaaatgca ttgatgttgg cgttgtgctg gagcaaagca tccgcaaggc    282720
     caacgttgtc gtatttgacg gccaagtgca acagattgct gttctgaaat ctgatgttgt    282780
     atttccaggt gctgggctgc agtctaaaat caaggtcttt gcatgatttg gcgagggcga    282840
     ataatgcact gccatccaaa tgcgacacga tccacagcaa aagctcgttg ggcaggtctc    282900
     tgatgtttgg ctgtaatttg ttagctcatc cgtaacttca gtgagaaaga attggaactg    282960
     accatagtgg aacagcagat tggaactagg aatcaaataa attgtagatg cgggtgaggt    283020
     gtggggtgtg aaagttggac gtggagaggt ccttatatac ttgcctcagc taaattccgc    283080
     ggtcacctag ggtgtagccc gtcactccgc tgagaggtgc gtagcaatca cgcggcagca    283140
     tcaaagactt gacaacaatg ttaaggcggg ttaaagaatc cttagactct agctcctggg    283200
     aacgccaaaa ctgttcctgg tagttctcga tggccctagg aaccgaatct agtctctacg    283260
     tgcccacgcc tcggatctag cgccataggc gttgaagcaa ataccaatct aacacgcatt    283320
     tcgaaattcc acacgcaacc cagaatgtaa cccagaattt gtcgactttg ctgcctactg    283380
     cagtagccaa tatgtttacc aatgcatgat catggcaatc tgcagctaca agtccagctg    283440
     atttgggcag gagtgttctg gaatgacatc ccttctcgca ggccactgat cgaccgtata    283500
     ctggcgcatg ctgcatcata acgcattctt taacgtgtcg agtgtttcaa ggaaggcgtc    283560
     ctatgccagg agccacgcag ccacgcaggc aaggacccta cggcgtggca tataaaactg    283620
     atgaaggaac gctgcaaaga ttgtccaaca tcaccaacaa tccaaaaaat atcctgcctt    283680
     tgacgacaac ctcagcgact accatgtctt ggaacccatt tgctgtctgc gggatccctc    283740
     acggtggtcc tgtgtcctgt tgcggggtga cgaagaaagg cgagccgtgc aaaaactctg    283800
     tcaaggttca ggaaaaagat cggccatcaa aagctgacca ctctcgccag agagccgttt    283860
     gacttgtcaa ctttgctgtc aaggctctgt gatattgcca aaggtttcct ctgcgcgagg    283920
     tggcatcgac aacggcaggc cgaacaagtt ggccagcaat ggtatgaagc agccgtccgc    283980
     aaccaggcgc gagtgccaga gaactctaga gctgccgctc catccattgc gcatccgggc    284040
     cagcgtcaga tatcgtcagc gcccaggcga caccctaccg aatcgcccga cactgaccgg    284100
     tcatctcacg ggctcagaga ggacgggccg atgctgccaa ccaaccccga gctagtgcag    284160
     cctttaaatt tatatgtgaa ctccactatg ctacggacga atagtgttcc atggagcgtt    284220
     tcgcccgcca ggcccgctat tcccctggct ggtttccaaa acttgacgct ccagagtctc    284280
     accccaagtg aggaggtcga cagtatcact gtgtgttttg cctgggcgag gatgaagacc    284340
     atgcaaacga atgcgtgatc ttgcgttgtc accagtgccg agcgctcgct catctatcct    284400
     gcgcggaaga atagttcgag aagcgtcata caggatatgg cacatcatgc tgtgtttggt    284460
     aagtgtgggt gaccttattt ctgcgacgac taggatgctg atgaccatag tcgaaacgaa    284520
     ggagccctag acgccttggt ccgtcccttc ccaaccccct tgtcagatgc cgagacacat    284580
     tccgtccaca cggcgggcaa accgtctccc actggtgggc cccgtcgctc aaccagatta    284640
     tcagggcgtc atctaccgcc ggacccttct acctctgcac cgcttcgccg gtcggcacga    284700
     cgaggattac actagatgtc agtgcacccc aaagcttagc attttcgatt gattttagat    284760
     gtcttagctc tcaatagtgc taggagatga gagttctcgt tttcgtaata cctaatgaag    284820
     gagaccaaaa gaatatatat gtcgatttta gctcaatgga ccaatgttga gtgaagacca    284880
     agattgttgg cagaaaaacc aaaactgttg gtcgggtgtc tcgaccaatt ttcttcctta    284940
     ggaatttgac tatggcaata gatgcattgg cactggaaac gtcgaagcgc ttgtaggagc    285000
     tatgtatccg ctgggaaata cacagaccag agctcttacc gaaggttgag ataaagccct    285060
     aggaaccgca attgacgctc caggagttaa tgaggcagtc aacaggaaca ccactttggt    285120
     tccctgagcc ggaagtacaa gaccccagaa gccacgtcgg gtttcctggg gcctatccga    285180
     cccctagaag ctgcatctgt gctctcagaa atcgcaccaa tgcccccagg aacaagatag    285240
     ctcctagggc caggatgtga gtccctagat agagtcatcc ccaagaatgt gactgaaaca    285300
     tgtatcgaaa gagaccccca accctcacaa caattagtag gaaattgatt atcgatataa    285360
     tacaatatct acaaacgcta tccgaccgca ccttgatctc cgacaccatc catccaggga    285420
     ttgggtcacg atgcacctcg ccacgcaatt gctacagagc aggtacgaag ataccattgc    285480
     gtgggaagaa atagaatcgg acaccgcgtc cgagagtact ttctcaccga aacagccaga    285540
     agagaannnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    285600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnncatt tctacaatgt    285660
     gttttcctta attattatgt ctgaccagat tgttaaattc agaacagttt tgtttttagt    285720
     cggataattt taccattgta gatcttacca gtacgctcgc cataccttga ttcctgtcac    285780
     aaccgaatca aactgatcat gttggatccc ctggtacttt atcttggaaa gagccctctg    285840
     cattaatcac ccgccacata tcgcgggtca attccaatgt ttcttcatcc cagctgcctt    285900
     ttgaatgact ggaattctgc tacgcctgta aaccacatag aagaagcagg aacgacaaga    285960
     tccctcgaat aaccagtggc aggatggcga cgaagggcaa aatggatatt gcgcctcaat    286020
     tatttggttt ggaagtttga ttgatgtgcc tggggcccag ccctcgttac tgccaaggac    286080
     ctagaatcaa gtgcctcctg ggctagggtt cctgtgaggg tcaatctgat gatcgaattc    286140
     tgccaactct atatctagca gacatgatgg taaaagcaaa taaagatagt tgtgaacacc    286200
     gaaagagtta caagtaatca ctgactacct acaagctgca gggcgtccgc tcgtcgcaac    286260
     cactttttta tgaccgctgc aacaagactg gcagtgctaa aggtgagaat tgtaacattg    286320
     actgtcctat atacgcgctt tccacagaat ctattaatat gatgcattct tcgttggaac    286380
     gatttattgt aaatcaacga caatgaattt gtactgcgga taggtagggc tgggctggat    286440
     tctagcaaac aattgctgga taagaatgat gacacaccct gctagatcac tgtcatctgc    286500
     cggagaatct tcttcgaagg ctattgatga gtcgcgtgac aggcggaggc aggaatgagc    286560
     ccccctcgcc tttatccgtt acatcctgct ccaggtctcc tgtaggtggg atttccagta    286620
     tcactgcctc tgcctggctg ttttcatcgt ccccagagcg ctcgtcaacg ctcatctcgg    286680
     ccgaatccca ttcgtcatcg ctgatcggtt caggcctttc tgcctctact tcgaactcct    286740
     cccattcttc gtcactcgcc atatcacgtt ccacccggct gatcgattgc ttccctgatt    286800
     cggatccctc cgagtacgcg tacatcacca aatctcgcat cgtcgactca tccagagatc    286860
     ccccacgagt acggcagatg ttttgtgcaa cggtgagaag ccgttctgtg ccagctcctg    286920
     tagccggaat ggagagtaga tcgcgcgcca gtcgagtgag aacaggccat tcgcgttgat    286980
     ggtctttcca gtaagcgcat ggtgagatat tgagaacccc tgttgcgtgt cagtagtcaa    287040
     caggaaatat actgggcagt tgtacagacc ttcgctaaga tattgatcaa catcatcttg    287100
     cccacacctt gagctacccg ccagaccagc tagtgggtgc agaagccggt caagccccaa    287160
     caattgcggg gaacaagaca gtccattcac gcaagacaag ctcgtgggca tttgcggtcg    287220
     gtattgtagg tgaaagatcc tcagatactc gatgtagcgc tcgggttggc ccaaaccttg    287280
     cgatgatgtg gcctcatcga atgcggacac cttatattgc ggagcaacga aagttccagg    287340
     gccatacatg accccaaagt tttgaaatgt cttttcgtat acttctccaa gttccatctt    287400
     catgataagc gacgcctcag atagtttgcg cttccacaga gctgattttc ttctcaatat    287460
     ccgggttgac tcgtcgagat gctccatcag tatcttaaac acgaaacaga ccttgtggac    287520
     tgtcgcctct ctcgacgcca gaagggccgt agtaaactgg atgaatggca ttatcagttg    287580
     cacaaggtag tcgaccttgc gccaatccgt acttgttaat ttgtactgta aattcacact    287640
     ctcttggcag tattggtcga tatatcttcg cagtctgccg gctcgtttta acatcaggaa    287700
     taccgaattc catcgggact tcgcatcgtc taacggcaag actcgagtcg atgcaggctg    287760
     gagacacaaa aactcatcgc gcttcctagg ggtctcgttg acaaattttg caaatgatcg    287820
     aatctgcgaa agcaagggtc agattttatt ttctagtcaa gagaatggag ggatttcacc    287880
     tttcccaaaa cgtgtgatat ttcgtcgcta tctgatgggt cggtccaacc attggcgtgt    287940
     gatatctctc gcacattctc aaccctttcc ccttctgggg agcttgtgat gttctcgata    288000
     taccgccgaa ggcagagctg aatggcctgt actgtgccag gaaccccaac aaagcactgc    288060
     caagagctga taccaccaga agaagtgagc ttctctctta atgacagcat caggttctca    288120
     tcgaccctat agtcgactgt cacgctgaat atccgatgaa gcaacccttt ttcctggatc    288180
     agtccaagta tttgatcaca ggggtcattt cctgtctcgg acctgcaaat tagctcgaac    288240
     ccaagcagca cctctcggta gctccactct ttatcaaaat aataggcagt aannnnnnnn    288300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    288360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nngctcctca tgggcgagaa gcttgcacga    288420
     ggctcctcaa ttgggcctgg ggtgacagca gaaacggaca cttcctcttt gcttctgcga    288480
     catgagttgg acttcaagtg cttacccatt gtgcttgttc catgggattt atgacgtgga    288540
     tgatgtgggt gattaagcgg cgtgaggcaa gaccgacaaa ctaccttggg tcggccagaa    288600
     ctgagctctg ccacctggtc aaagtgcttc cacacctttg aggaacgaga ctcagccgac    288660
     catctgaatt tgtattttcc gtttttggtc agctgttgtc catactcggt ctccagccac    288720
     cacgataaaa attctttctc ctggtcggag tcgtagagca cccaatctcg gcggcccggc    288780
     gcaaaccgtg ggagttttgc tggggggctt ctgggtcggt cttccagcgt tacaatgcct    288840
     gaggggcgat taaaaagctt caagtggtaa attaagttag aatcagttga ctggctcccg    288900
     gtgatgacat accgaagaca gcgacattgg gactgacgag gatgatgagg cagtctcaat    288960
     cgaacacatc gcgccgaggg gtgtaaagct ggcgggggac gccgccagac taaaggggat    289020
     cgcagccaaa gcaagcgaga ctggtgccag ctttttatgg tagggcgacc gctgcgtccc    289080
     acgaatcagt cagcgcgtca aacattatat accgtggact cctgactaat ccgtccgttc    289140
     ttttgccctg agtgttgaag tcgatgaatc ccagtgacca gattgaggaa ccaccgaagg    289200
     gaattttgag atggtgagtt taaaggtctt caagaatgca gatagcccgt aactgaacca    289260
     ccagcggttc ttgagtctca aagtaggcaa acgttgaaaa atgtcttaca gcatcgccat    289320
     gtattgttct atcgaatttt tgatatcttc actatcttca ggatcatcag gtcatagatg    289380
     aagcctgtgc tacacgaagg gggaatatct tgagcggtga aaatcgatga cgtcaacgat    289440
     tctcgacgta tcactggctc aattaggtat tcaggtgaat caacgtttta gtaatttgag    289500
     ccataagcac tagctaaatt ctttcgcttg tcgttgagac tttgcatgac tctttaggca    289560
     tgttcaaggc atattagaat tgaccctcgg gctacataaa tgggggtcgt acctgaattg    289620
     aaaacccaaa atgtgtccat ctcctgttgt aaattcatct ggcaccggca tttcctacct    289680
     aagatggcca tggaagaaga aaacgagctt tccgaaatta tatcctcgta cagtgagccc    289740
     agtgaatccg aagaacaaga gtcaatctct gagcactcag aggaagaaga tatttcggaa    289800
     acaagtgaag accgcgcatt cgtggtgtcg gatggagatc aatcacccta ctcgaaccga    289860
     tcctctgagt cttcaaacta tagtcagcac tgccaccaca gacatgatga tgacttttct    289920
     aaccctgtaa gttgcatggg aatactgttt ctaatggatg agctgacatc cctaggttgg    289980
     cgacaaaata ccgataagca caattgccaa acgagttatc caccagaatg atagtcctgt    290040
     tgtacaatat ttggtcctat ggcggtcctg ggagcaggaa aggccacaat gagtggtatg    290100
     gcagagaaga catgattcgt acatagtact gaagctgtgc acattactaa tttgccagct    290160
     agtaagctgt ctctgtatta acgcgtgcga agcaatgtca tcgcttttta accgaaggcc    290220
     ttatgattct agtgttttcc ccaaccaaat ttgggcctgt cgccatacgc tggggacagt    290280
     acgtatataa gggcaggcta gtcccaacat ctacatcttc cgcccggtca aacaaccact    290340
     ttatccgcaa ggaagatacg aatcctagga gacccaaccg caaactgggt gtggaagcat    290400
     ctcactgaag cagtccagct ttgtaacttt ctgcttcagc catagtcaga ccctcctaat    290460
     gagcagagta aattctcaac aaaattggtg agatttcaac ggacattgtc atggaaatct    290520
     tattgaacta agcctcccaa tggcgaaatt ctctgcatgt ccatcaggta aagtgatcta    290580
     gatcttcgag cctgttcacc tcggcgattt tgactctcgc catgtgaaag acctattttc    290640
     agtagctttt actcaacgtt gagtgaaagg cttttgacca gcacgatact aacgtatatt    290700
     aaatagtttg tgaacgtttg cggtttgtta ttttcaccag ggtttaaaaa tggaaactcc    290760
     gttgggttcc agtgaacata tcaaagttgt gatagaaaaa cgattgatct tgactggcca    290820
     tgggtaaatt gctttgtact tgttccttga ggggtgttat cccatgtaag gcctcccgaa    290880
     acagttttat aacctgatct cattgccaaa agtcgaccaa attagcgctg gttctgcata    290940
     ttcacatcga cgagaaccag tacccctgga ttgctactcc cggattgcta ctcccggatt    291000
     gctactcccg gattgctacc agaagctctt cctgagagag attgtttgat gctgcacttg    291060
     atgttacagc tactccaaca tccgttcctg tcgcattggc ggcgtgcgaa taggtgcgta    291120
     ttatgaattc caatgaccat gtgtaaatat gctgaacgca gcagggagca tatctctcgt    291180
     gtgggcctct cctcgaaaaa cccggtcacg aaagcccctt tcatatattc aaagaccgag    291240
     gagctcgttt ggaaatggga acagtcaaag ctctgtggtc agagtatcaa catcagactc    291300
     ccttccacca tgcttccgca aggccgccta ccaaacaaag cagacagccg agaagaattc    291360
     atatcaatcg agaatggtgt tgttcaagtc ttccctcaag cacagctgac taacctggaa    291420
     catcatgact atcagatcgg aattctggag acagcgcagt caggaaacct gaagattatc    291480
     cttgccaata cgaaaaaaag gaaacaagca aagagtctcc gggcaagcct ctttcacttc    291540
     cagcattgtg tattggagaa ggtcccacct tatttcagta gctggtcaac cgaattctgg    291600
     gtatcggact cggttgttat tgattcaaag tcgatcgagg aggcagaatt gatactcaag    291660
     gctctgcgtc cagagagact cgacgagact ggatatgtct gtgttggcct tccagtcaca    291720
     atcttcgggc cattattcaa cacgctgata tcgaaatgga acgcgagtgc cgcttctttc    291780
     gagcattcca acggatttat ctggatatat tccgcagtgg acccggcaaa cttcaagata    291840
     accacgggcg aatctgatag ttccaccaac cactcagttt actctctgct ggagcgaatg    291900
     agcggaaaat attggcttgt tagggcaaag ctcacgttta gactcgaaac gtcgagtaga    291960
     gagaaagcgg ctattcttgc tgagctcctg gaagtttctc atgttcaggt cacctcttct    292020
     cataagccta acactcactc ctaaagccgg catgggtgtt ggaaggtttg gtggctcgca    292080
     acgtaactgc tggcattttt ggtttggttt gatcgttttc ttttcccttc ccatttcatt    292140
     gtacgttgcc aacattggga attgaatttt aaaatctcaa acttgtgaca caagactttt    292200
     cttgtggtag acgtaggaga accagaggaa tgcctggcat gataggtctt tagccaactc    292260
     ccctcatctg gagttagttc gcgcctgacg acagccccat aatggaaggg gtcaaagaca    292320
     ttcagttaca tgaccacaag gcctcttgag gcttgcaggt tcagtgatcc cggcacaaag    292380
     gtccagattt agcgagaggg agccagattt aatcgcagaa tatcactata ctacttcaat    292440
     actttaccta gaaggagcca tagaatatag atgctgcgag gacgagtcta gctttgacga    292500
     cttgagatta atttgaaccc ctattcgaaa tgcagctcaa acgcatgttt gccgcaaaca    292560
     ggttgagggt cacgagacag tttcacgttg tctaacagtg tcgcggtctt gttgcgcccc    292620
     atccgctatt tgcactccgg cggtttattt gaatagttcc tgtacccaag agcagaagag    292680
     agaccaggga aacacatggt caacagcgga tcgatattat atacatgcta tttcgcgctt    292740
     tcctcgccgt cgctggccga ggtgttccag gcatacccgt caccaaaatc agatgtgaca    292800
     cacctacacc gatgggcaac ctaagatcca accatttgat atgtcagcag atcacgtgca    292860
     acatcctata gtctggcatc cccaggtgtt cagggaaaga gaaaccatga tcacgcccag    292920
     tgagcaagac caagacccac cgtcagaggc ttttctatac atatgggact atctgtgcca    292980
     ggaaaccact gtaccaccag ctgccacttt gggacacccg accacgttac catgcaggtg    293040
     gtagaacggt agatggttga tcagtagaat ctgccaaggc aaatctatta ctctactatc    293100
     tactcatcta cacaggaaga attcagggat atataaggac acctattcgt atacctagtt    293160
     ggttcttcgt cttcactcat acattgttgc ttgtggttac cttttggata cctgagactc    293220
     tttgcttgat tataacttga caacactcac agatagacca agtcttgagt atagacctat    293280
     tcggcgctcc acctggcatc tttcctcgat acctcaaacg gacctactct gtagaaagcc    293340
     ctgataggaa acagtatggt tgagagacag atcgttgacg ttggaagcct gagaaagcgt    293400
     aaggcaagta cgacctggaa cgcttctaac ctaactgtga ccagtttgca gagcgtatca    293460
     cgaggttgcc tcaacgatat ttctaataaa gacggtcgcc gtctattaga taagcgacca    293520
     tgcaccatgt ggagatgctt ctcagaatgt tgatcaactt caactgttcg aactatgtga    293580
     actcacaatt gtaatataat gcaggaacat gggaaccgta gaattaaggc tcaacgccga    293640
     acgtggtttt tccgagacgc acgtcttgca gtcggcatgc ggcggattgc cactgttacg    293700
     ctgccgatgc agaaaatttt tagccattaa cctgccacac catcccaagt cataaaatga    293760
     ggtttctgat cgttactcac cagtgtcatt tttgccgcat cactctccca agccattttc    293820
     gcctgcctga ataaaagctc taggtcaacg ttgtccaaac agccatttag aaaacaagat    293880
     ataaacccgc tgatgtccgg tattgcccgt cctaaaaagc atgtcacgcc ctgtttcaaa    293940
     gtttgccgag tggcttgcca gagcttccat ccaagataca ttcggtctat gtgggctcct    294000
     tgctcttgta tgctggatat gttgtagcct cggacgcaga ttccgtcatt tgcctttgag    294060
     gttgcagcag gtatcctgga gaagtttctt gaaggcccca acaccaggcg tgctccagtg    294120
     gctagatata ccaacatact tgcaagtggg agtacttaca gccttggtag ttgcaaatac    294180
     cattgtaatc agccttcatg ctcagacctg ggcggatgtg cagaggcgag ccggatgctt    294240
     ggcggtcaca caccttgttc ccctctgctc cgggtttagc ttcagtcttc cggcccacgt    294300
     ctactatgtc gaacgggaca cgttctactg ggcccatcgg tggctaggtc gcatttgcgt    294360
     gctgcattgc cttcttcatg ggtccgtctt aggagcaaat gctcgaaata caagccttgg    294420
     agctcccctc gccatcccac tcctggtacg tgaagcgggt ctgaggacgg cagccttccc    294480
     attcccccgc agtatgtctg actagaagtg gctaacaatg aacaggccgg atgtagtctc    294540
     ctctcgatct tgccttggac gttggctgcg atcctccgcc ggtggccgca actcggcctc    294600
     aaggtccacc atatgcttgc ttcgatcgcc accggcgccc ttttctacca tttgatcgac    294660
     cgggtatcgt cctaccgctg ggtattactt ggtggtattt gcgccggatg tgcctggagt    294720
     gccgggacat gtctgcatac tatgtggttc cacaggtcgt ggcgcatcac ctctagacgg    294780
     gcactcgcgc ggtctttcaa ccagctttta tggcttgata ttgcggttcc catggggtgg    294840
     gaggctcaac cggggcagta tgtccagctc tggatgccac gctcaggggt gaggtctttc    294900
     ttgcagcttc cctcattcta cgtagcttca gtggacacag tgcagaatgc gccaggacca    294960
     ccaaccactc gcacattacg catagtgacc cgaccccgac caggagtgac tggaaggatc    295020
     gcacaagctg cggatcatgc gacgtattcg acgattcatt ttccggtctg cgtgctcggt    295080
     ccgtatgggc atccacctga ccttggccag tacgggaccg tcgtctttgt acttgaagac    295140
     attggactct tccgcgcgtt gccgttcata cgacacctcg ttcaagaaag ccgaagccgg    295200
     aggaacacgg tacgaaggct agaagtcctg tggcaagtta ggctgaaaca tttcagtgag    295260
     tcccccatta cgctcggatg ctttgcggtg tcctgtgctt accggaacag accaccccca    295320
     ttgggtgggg gatgaaatct cgcaaatcct cgagctcgac cgtatgtttg accgaaacga    295380
     ttgtcccgag catagacacc gagatgaccg gggttttgat gtgagtgaat ctttcttctc    295440
     gctatcactc ctacaatagg tcgggctaac tcggtagcag attttgcaat tcactataca    295500
     tatcctagat acccagccag tggaccggat ccgttaccgc aaccgcaatt gcacgcgcct    295560
     gaaataccat tttcatgtca tcaatatcgg caaggagatg gcacgtctaa tggatggtag    295620
     aggcggaacg accgcggttt cgggtatgag cgctctcccg tttatgcact tcggttttgc    295680
     caggctaact ggtattagtg tgcgcaagca aatggacacg cgcagcagta cgccgcatcg    295740
     tccattccag aacgagtggt gattggcgat tgattgacct tgatctagaa ccctcctgca    295800
     agtggtggcc ggacggtgac cctttcatca atggcacatc cgacacgatc gcagcgccaa    295860
     cagaaccctc caatattgaa agagagtttg agcccggtcg gacaccgact gccatgcccg    295920
     ctgcatatgc tgttcctgag cagaccaccc ggctgtccgg ggagaccttg gtggataata    295980
     gacgatcctg gcggagtgac gatgcggtgg ttggagggaa tgccaaccac aaaaagtggg    296040
     tccggcagaa aattaccgaa ggcggcgtct agttagtcaa acatgttcaa gtcacatggt    296100
     atgctttctt catgcagctg ttgaggctca acacgttcca gaacaggctg gaatctgctc    296160
     ttacccgcct tcactaaaca tttacatcaa gctagagtta gtcggtagcc gcaagcagag    296220
     acgaatgaac tttgattatt gatgtgagat atggaatgtt gtggggatat ctgagtaggc    296280
     gggcggtgga ccaacgtctc aaaatcgcgg acgttcttgt tgtgatatga ggctggtaca    296340
     gatcaggaag caagccgctc cgtcggaatt agctccgaag tgcctataca gacgaccaag    296400
     ttgatttcca atcaacttgg ctcattgttg tatatatagg ctcatgtatc cctctgaaat    296460
     aacaagacaa ttcatacctc tgaactacaa cagttctctt tccacgtcac ccatataaga    296520
     tgggttagcg tgcatctttt gtcagttgtt ttacttcctt cagtaatgta cttccctaaa    296580
     acaacaggag caagccgttt actctggtct atctccacta tgcgagattg caaagacacg    296640
     actagcacaa tgtataacgg acattccagt ggttaatact atatgttctg cgttttttaa    296700
     ccctatctcc tcaccttccc actatattaa gatgcccgcg gttaatcaac ttgggacaaa    296760
     atcattctga cgccttggat ataatatctg ctggctgcgg atcagtcatg cagttgtctt    296820
     gagcaaaaac ataggtaaaa gaggtagtta tagaccttcc cgcttgtctt gccatttgca    296880
     agcttctagt tggcgtcaaa tgtaaaagca tatttgtgag ggtgactaac aaatgtgagg    296940
     cctgtgcata tgtctggatt atatttccac tggcttaagc gacacattcg gtgaagaaag    297000
     gacgttattg taaacggttg atgcactaac gttgactcaa cgaccacact ccacagcacc    297060
     aagaaacagc ctacagccca aatgcaagag gcagtttctg agtagacgag tgggtgagat    297120
     agtgcgagga gccctggaaa aagattacgt atcgccggaa tataccttac taacagcggt    297180
     aaaatttcgg aggttattga tattcaacag ttgcaaaact atggggaagg caatgacctc    297240
     gacaatttct tactatcaca acggtcacca tacaatcagc ggaggaattc ctttttcccc    297300
     tttctttgtc cctcaggttt cgtcgaatgg tgagcagatg gtacaatgaa aaatagaaaa    297360
     ttgaccaaag aaagaaattg gttatatcaa gtccgaacgt tgaaaataaa tgttcaagga    297420
     ggtctccagc atgtgtcgga tcaaggttgc attgaacgat ttatgccacc ttaacgttga    297480
     actaactgtt taatcctgta cggcttataa gaaagaccag cgccagctgg taattatatg    297540
     ttttcggccc tgagtctttg caagtgaaca cgatggatgc cccacaacaa ctaccggacc    297600
     aagatagggt agaccgtcag ccgagtgaaa tgcctatgga gaatgacgag gcctatccgc    297660
     aggccgtttc cgatccccag cccccacttg taagctacgc gcgatgacac gttctatacc    297720
     gtggctaatc actacattct ctcgttgcag caggaagcaa tcctaaagaa ccccctggca    297780
     gtcgagcagt ttcaagccat actggagacg ctggcagatc tcgatcgcga tgacccgaaa    297840
     ctcgcctttc aagcggctcg acccgtggga ctctttcgac gtcnnnnnnn nnnnnnnnnn    297900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    297960
     nnnnnnnnnn nnnnnnnnnn nnngtcccaa tttggcaggg ttgacggacg tcgcaagaga    298020
     agagtaagga attgcctatt tcgggttgcc ctgtcctatg ttggcaacat agaaatacta    298080
     caagcggcca cgcagtgcaa gggggattac accgcatgca aagcaggtta tatattcccg    298140
     aggcttttaa caagaagggc accaaatagt cattattcat tatcgtggtc tttactgaaa    298200
     tgagtatacg aacaatcccg cttgattcag atcaatctca ctcgtaatta ctcgatatat    298260
     tatgtacgaa aaaccgtggg tccagggata gcgtcgggag aagcctagtc aacagagaat    298320
     gtgtcgagag actcgaatac ggtagagatt ccgtacgagg ccaaagggac agtcggaagc    298380
     cagtgccggt tgcacggaca gcatgccagg tgagtgtgtc tactagctgt ctgcgtatcc    298440
     gatagagatt ccccatggcc gtttcaaccc gtggcaggaa gaacagatcc tctcctatag    298500
     cctcaccaga tatccggtca aatcgcacaa accgaaattc tatccagtgc acctctttag    298560
     ggaaaaggag cgctgacatg tggaggaaaa tgtcgctagc ccgagtagag ttggtcagag    298620
     gatctggacc tgtccacttg aacccggaca gactgtcgag gttgggatag aaaaggcatt    298680
     cgatcaagga aggctcttga ttttcgtatt ctgcaggatc gtctttgcca aggaaatcct    298740
     gccacagatc attgggatca gtagcgagac agggaggcgg tgtcggtatg ccagaagatt    298800
     catgccagat agcgtgaagg tcgagatcca aatcgtagtc tgtaatatta gcgcaaactc    298860
     ccatcaaaga aacgggtaca gaccattctc gttcaatccg ttcatttctg gtatatgact    298920
     ggccgtcgaa cgctgtaggg aaatatggag gtgtgtaaag cagcgattta acgtgggttg    298980
     ggagggatgg aaaggtggag actgagcagt ttttattcct ctcttattac acagaatgag    299040
     gacaagctag gggaatttat aaccatatgc taagttatcg aatgcgttga atgtatcaac    299100
     agcgtgcacc gttggcaccc gtcaccaaca caaggaaagt ttaccggcag tatagacctt    299160
     atctctcctt aagggaaaac gcaaatagat agcggaaaat ctaagtgcca ttcttccccc    299220
     ccatagacgc tctaccacat ggacactcta ccaaggctca ggctcatcga cagagtaggc    299280
     tcgaagatcg ctcgcttcca gggctgaaac aacatcatta caaagagcct gaaccgctcg    299340
     cttgcgcccc cacaatactg aagcttgttc attgcagagc tgtagaagga tatcgctatc    299400
     gcttgctagc aagtcatttg acgtttgaag ctgtcgctgc tcctcgagtc gtattttctg    299460
     ggccaatttg acgacgtagc attcccatag gaaaaagtac aagtcgagca atttgagggc    299520
     tgttgtagcg agggagtcat tgaggtttac tacttttatg aactccgcct ccgccgtaag    299580
     ggtacctcgt gttctcactg gaacctattc agtattagtg gggtttttta atttcctgcc    299640
     caggggggga tgaccgacct tgggttcgat agttgtgccg tttgaagctt gctgtggatg    299700
     gttttccaac atgggttcat cttctggagc gtgggatact cggcactgtc tcttggccgg    299760
     ccgatcaatg ggggaaggcg aagtgggacg gtccattttg gtcatcaaga taaattggat    299820
     cagaaattat gctcgagggg aatctatagc tgacaattca cgcgaggctg ctgttatttc    299880
     taccagtgct tcctcaccta ggatcgaccg cacttttcaa aggccagtga acagttagct    299940
     caactgttga tgctcgatct caccggctgc tcacgaatca tccaacgata tacgaaaagg    300000
     ggagtaatag taaacgttga aaaaccgtta ccgaacctac tgagggtagt ttgcaagtgt    300060
     acttgtgacg cgttgaatgt tagacatcaa gtagacctcg ttgaaactta actatgacgt    300120
     taatttgact acacaacagt tggaacgcag aaaaacagat atactgcgtt tgacataata    300180
     tcgatatcaa ttgacgttgg taaccacggc tctcgcattg tgatacggac ctaccagatg    300240
     tagatttcaa tagctcttct aggctaccaa tcctacttgg tgactgcacc aaaaggttcg    300300
     atgagtgtta tcatattatt ttgtttcgaa taggcctccg ggtattattg ttattcccca    300360
     gatcccaacg atctcctcaa aactgccgtc ctcccacgta ccacgttgac tgtaagatat    300420
     gaggaaaact tgttcttcca gatttcagag gcttaagcga aagcttcatg aattcaaata    300480
     ttctttctca gtatcagtcg gtcaaagcct cccccagaga tacctaccgc cgcttctgac    300540
     gtggaacgca cacgacgaac agccgcccca tccccagagg cgtccccaaa cgaagctaat    300600
     agatcaaaaa aatgggacga agacacctcg ataagtttgg acccactacc gcgaacattc    300660
     acaaagcaga ctgaaactaa actcttttta gttccacaac ctgtcgggtc gtcgtgcgag    300720
     aacaaagagc cttcaggtgg ccattccgtg cgaaactcgt tcgtgaggga agttgagaga    300780
     tcgcactgcg tggacgagta acaaactttc gtcattcgtg aatcccatcg attgtactgg    300840
     atgcatgtaa caactgcaca attgaagccg cttgtagtct ggaggatgtc ccgatcctcg    300900
     atcttcacgg ctcgggccaa cctaggggta tgtcgctagt ttgacttctt cgccaggcgg    300960
     cctcttccgg ctttgggaaa gacaaattgg ggaaaacggc tgtggcgaca ttgtggcaca    301020
     tgctggttgg ccattgatgt accaatagag tcgaatcatg aggttccgag tgaaccgtgt    301080
     catctttggc ttgatccaac agatgcaaaa atcgggtggc ccacactttt gcccgacagc    301140
     gatgacgtct gcactcaaag caaagtaact gctttgcagc tgaggaaaat tcttgcgcta    301200
     gtggatacac taacagaggg ccctgaagta gctgaaagca caatactcca tttatccggg    301260
     agtcaagcgg cacagtgttt tgacaatgat tcccgtcatc tcctgcccat atgcaccgct    301320
     cacggtgcag gggatcaccc aatacttggc ccaatacaca ttgtagatca gcaggattga    301380
     aggacatgat gaaaaagtaa atgtacaagc gtctcgggtc aatcgcgagg tttgcatgta    301440
     atcagctgga gaagatatta ttgttgagct gatatctgtg atcatgtagg gcgattataa    301500
     tatatataag ttttagaaag tatatagtag gcttttcatc ttgctctttc gccagtacat    301560
     gcccgcgcag aagaggtgtg acttagctag ttcccagcac tcctgatctt gttcctgaaa    301620
     agcagttatt atttcctggg agctctagcc acatttgtcg ggatccacgc gaggcataca    301680
     cataaatgga gatacgatat atgcgggact cacatggcat ctgggttcac tgggatgtat    301740
     acgcgacttc ccccttacaa ctgggcctca acatccgaga aaccggcaaa taattcatat    301800
     agcagtgtag caatagagcc caggggaccc actttaaggg cgaacatgtc gtatccagag    301860
     ccttcggtct tgaagctcat gacccaacac gctcttcgaa atgcccctgg gcgactcgca    301920
     gttttgccag ctatgccatt ccgcgaatgc atggtccaaa tgcacggccc actaaatcca    301980
     aagagtgaac cagaatgaga catccttctt gcaacccact gatcagcggt gtagcggtag    302040
     atactgcatc gcagtgcatt cttcgacgtt ttgactgttt caagggagaa gttccacgtc    302100
     agcagccatg aagcgatgta agtatagatc ccatgacgat ggcatataaa gctggcgagg    302160
     gaacgctgcg gagattgtgc aacatcaata cccattcgaa tcattttctg cctttgtcat    302220
     cagctcaatg tcttctgtac ttccttggaa cccattttct gtctgcggga tccctcacgg    302280
     tggtcctgtg tcctgttgcg ggacgacgaa aaaaggcgag ccgtgcaaaa actctgtcaa    302340
     atttcaagac accaagatcg gccatgaaag gttgaccact ctcgccagag agccgtttgg    302400
     cttgtcaact ttgcagtcaa agctatgtga tattgctaga gtcttcctct gcgcgagatg    302460
     gcaccgtcaa cggcaggcgg accaagttgg ccagcaatgg tatgaagcag ccatccgcaa    302520
     ccaggcgcga gtgccgcatg gctctagagt tgccgctcta tccattgcgc atccgggcca    302580
     gcgtcagatg tcgtcagtct ccaggagtcg ccctgcatca ggcaacaccg acaggtcacc    302640
     ccacgggctc agacgagacc caccggtgcc gctgtcaacc aaccccgagc cagtgcaacc    302700
     attcaatcca tttgtgactt ccacaatgct gcgcacaaac agtgttccat ggcatgtttc    302760
     gccggctcaa ccagcgatcc tgacatcggt cgctaacgtc tgggctggcg tccaaagctt    302820
     gacgctcaag gatctcaccc tgagcgacga gttcgacgac atccactgtg tattttgtct    302880
     ggccgaggat gatgaccttg caaatgagag tgtgatcttg cgctgtcagt gcaaggcgct    302940
     ttcccacctg gcctgcgcgg aagagtggct ggaaaaacga agtgcaggtt ttgggacgtc    303000
     atgctgtgtg tggtaagtag ggctggttcc agttatgcaa tacccaagat gctgattaat    303060
     acagtcgaaa tgaagggcct ttagacgcct tggttcgccc aatacgagtc caatcgtcgg    303120
     atgctgagac acatcatatc cacacagcaa gtgaatcatc tcccgagaga gaacttgcca    303180
     ctatcaggaa ttcatcacca aatgacccgg gtcagagtca gccgcgtcag cggtcagtgg    303240
     gacctcaagg aggatcagtc gagcagagtg tggagaatgg cccccgtcgc tcggctaggc    303300
     tagtaggggc tcatctacca ccaggccctt caacctctgc accgccccgc cggtcaacac    303360
     gactaaattc cactcgaagg gaatcttagt ttgcagtaga ggtgtgaagc gaatgagaaa    303420
     ttagcgaagt gactggcaat cacgcgtgat tccatatgac caggcactcg gcattcggac    303480
     cagcaacata gagcatagcc acgcattatt cccagtacaa gctcgcatca cttgtcaatg    303540
     tgacaggttg aaatatgaac tagtagcttg ctatggagcg ggggattcta gctttgaggg    303600
     cgttccctgt agggcatggt ttagattttg taccacactt aatgacaatg aaattgacca    303660
     agaatagttg ataataagcg gcgaagccga gaatcaaccc ccaaaagata tttctagttc    303720
     ttgaccaaag tcaatttaat tacagtatgg aaaaatactc gcagcagaag tattgctatc    303780
     gtgggtagga tgtggcgtgt ttaggaaccc atacccggaa agagggtata aaatctgaac    303840
     cataccgtat agggaaatct tccaatgtga gccagaatca cacccctttg cgagctacag    303900
     attcctgttc ctcggattta cataacgcta attcattgag agtccgtttc atgaacagca    303960
     atggaaggca aatccggcat tcctgggaag tatctgacgg tggccaatta ccattggaca    304020
     ccttggaggg gattcgcttc atatcgaagg taatcctatc taaatcattg aacttgccga    304080
     tcgtaacata tatttgactc cacaaaattc atatcccttg tgatagcccc tcttagaatg    304140
     ctgaacccga ctagctccag catccgcgtt ccattccgca ccattctcga ccatcccata    304200
     agacagcaat cctaacttga gtccccaacc agatccacgg gcccatacgt agaatcttct    304260
     acggagctta atgctctgaa ttactcatat tcagtctctt ctgccgcaga aatattccaa    304320
     aaactcgtct cccctcatgt cgcggttcac aaacttggcg cccgggctaa tattgacgtg    304380
     gcccgcgcga acgggggcct tctcttctgc gccatcttgc gtatttcgat cctacaagga    304440
     tgagtaactt gacgggacag gtaaataatc cgggaaacgt taacatacgg tgccgacgcc    304500
     ctcgccaggc gattcaggtc ccccaagaac cggtgtactg tccatctgct tcgcccgttc    304560
     tctaggtttg aacatagtcg atacatttct gccgttcaaa cttgatccgc cgtcgaaggt    304620
     acaatgggat cgaacgtatg gtggtgtggc ctatgggcct tgccattaga ggtcacatta    304680
     gtggaaagta ttaatagtga gctgtggaag tacctgaatt ggttttgtcc tcatcgcctg    304740
     atcaacctca gagactggat aagaagacta gcgatatcgt ctctcagcaa gtaactctac    304800
     acgacttaca aggatagttc tggcagaagc atactgtatg gttctgattt ggtagcgatt    304860
     gggcggtctc ttcgccaggt tttggtgctt cctgattgga gcgttgatta gtccgacgag    304920
     gtaacccttt cttcaagtat gtgatagtca taatatgaat ggtactcttt gaagcgagga    304980
     tagtgtgggt agtcagcgct gacaccgttc aaaggaagaa atatgaaggt ggagatggaa    305040
     gaagaccagc ccctcttgga tccagtttag cactagcata attcactgat acaccgtaat    305100
     aacattgtca tggaactttc agtaaaatta ctgagtgggc ctacagggaa agtgctagcc    305160
     gctggggtgt caatatgacc gctagtgtaa aaggaatcag gccgaagccc tcgggccttc    305220
     cagctatcgg gggccagtgg ccaatgatgg ccaagccatc atctgctcac cctaaataaa    305280
     tgaatgacgg atctaacgaa caaattgtgt ccatggtgcg attataagct aagaagatga    305340
     ggcagagccg ggaagatgaa agcaacaact ttcctacctc tggtgtttat tgcgtatact    305400
     agactccaac cgtaagggtg gtacgcctac cgcttgtatg cacgcagaaa ccgccactaa    305460
     gatggctagg ttgtagtggg ccaaggaggc gggcaaagag aaggttcaga ccaaaagctg    305520
     aggtcggtcc gggtcacatc ggaacaacga cgtgaggcaa gagcgcctat catgatccac    305580
     cagacccttg caagtctggt tcctaggatt cttccgcgtg gtaaatgcag ccaatgcgtg    305640
     ctcaaagcca taagccagat ttgtgtcatg cacaggaaaa cagactaccc cttgggatct    305700
     gcgcgcgtct tttgccctca acgcagcaag caacctcatc cctactcatc aagcctgctc    305760
     cataaaccta tttaagggta actcaacctc atgagctacc tgacatttta agttggttca    305820
     ttattgcagc agtatgtctc atgtgggaaa cccatttaat gtcactggct tcgtgttcac    305880
     ggaagtccca acaaactatt ccattggccc gacatacaac ccgctacctt cggagatagg    305940
     ttcaggaagt tctctccatc caagcgttcc acaatcggaa agctggttaa caagatctgt    306000
     gtcctcaacc gtcactccct ctccccggcc aagttcgtca catcgagaaa taagacctcg    306060
     gccggcacca acattgcctc aaccggaaac caaaaatgaa gaaaagcagc gagcccggag    306120
     gcccaccaaa aaggcacgtc gaagggtata tacgcccaac caaccagccc ggcgtaatga    306180
     aatgaggtct gcatggctgg ttcccccaac gttcgtcaca ttggctaagt aggctctttc    306240
     agcacagcaa aaacactgcc catgtcgagt cacaattcag ccactcagga ccagcgctct    306300
     cgctcacgcg attaccctcc atataatcga gaaagccctc cccaagcttc cgtcgaagct    306360
     ctccagaaag ccttgaagac tcaagtctta cactcactcg gggctttgcg caagattgct    306420
     atggaccacc acgcactcaa cctggtccct gagataatag atggttgggt ggcggaaatt    306480
     gaaggagttg atgcgagaaa tatcccaatt gcatccagca tggcgacgca gatgtttgtt    306540
     ccgttcgaaa gattgacctc cattctcacg gaatgcatca cagctacggg cccgatgcga    306600
     aactttacta tcagggatca ggcgatcgag tttttgaaat atatattgac ctatgcggag    306660
     aagtactact tagtccaggg ttcgcaggtc tatcttgata ttggtagatg gatggaaaga    306720
     ctcaccaata caaacatgag gaactgaaat gttattatcc agagggtctg gaatattcca    306780
     gggttattgg tttcttgttg ttggttccgt cattgtagtc gctagctggt tgaaatgcag    306840
     aggtacattg ggaagaagtt tcctataaac accgatccct aagacctcct ctgggcttcg    306900
     ggaactggag tatatttgtc gcacagatgc atcattgtac ctcttcatgt ggcacacggg    306960
     tcggatggat tattttacgg aaagattctg caggaaaaac gtaaatcatt agcctgtggc    307020
     tttcactgtg aataatgact ctgaggctca acagagggtt tttgttacta cttccatggc    307080
     aatcctgtta ttgaatccgt ggcttgtcga aaaggccgcc tcctgcttgt ttgatcaaaa    307140
     tcggcagctg agtagggaac acgtcttcgt ctacaaaaca tcatcagcaa ggcgccaaag    307200
     ttgtgcgact gggtccacaa ccactgaatg gatgcgggca aggggaaggg gaaaggggac    307260
     gctggagggg gaagcgcgga gaataggaag ccgacagttc ttgggcacat catcgatcta    307320
     ggtgggatgc ttaacctatt aatccacagt gagccatttg tcagtatttc attctcttgc    307380
     tgcacggtga aggtgcagta gcataagagt atctgagaag ttgcgttgct cacttgcctg    307440
     tgatatgatt tgtgcaaagc cgttgatgga aaatgtcgaa aacaggtttc ggttatgtat    307500
     ttgtctgccc atgtaaacaa accagtttaa tttcctgtag ttggatatcc gctgttgagt    307560
     cctgggtgcg aggcatgagc ttgaggagag aagaattgaa ccgctgacag tcagttttag    307620
     gtaagtcaaa ctcgcctggg ccaccttctt tccacttttc ctaaagcatc cgaccattct    307680
     agccctgctt gcctcatgcc accattagtc ctcctaccat cagatacaat ccatctccca    307740
     gttgcaatgt cacttccact cggtttctct tctgctatgc tcaaacttat tgaatcatgc    307800
     aacttttccc cgagtaaagc tcttcgcacc tgagtctaga aagtcttagc catcaagata    307860
     tgacctttta ccccgaacct tggctggact ggtttggact ttatcgtttg attgcaattt    307920
     aagggtgcaa atgataattg tcaagcccat cgaactactg acctctccca tccgtctcct    307980
     cgtcacacta tcggtagtct ttgctcgacc aagatgctgt ataagacaag ggtcagcaca    308040
     ccacctcaat gtcatatgct tcgaataaag ggctcccctc aacgaccggc gtgacggttt    308100
     ggtgtgtcct gaaggcgcta gtcagacccc cggccagaag ccctgcggct gcagtgggag    308160
     atagctcgcg cgccttgttg actcaaaaat atgttgagat aagcccccta tgtttaatct    308220
     gtcaaacatc gtaccatact ctgactctat ctcttctgct caaaaggatg ttgctgaata    308280
     ccctcagctg gaatctacgc ctatccaatc ttcaaccacg gtctacggtt cttgcccata    308340
     gaatccatac ctcacaaaac ccgttcctgt attctcctac tccgctgtgt aatagagcca    308400
     ctccgcggtg atacgactga aatatcgaag gggagggcga agggccatat cgccaacttc    308460
     tcgaaacacg ttattccaga ggttgatctt acaaggtcca ccgtggactt agctgactat    308520
     ggtactatgg gagaagtact ctatcacaca ctccacgaag atggtaaaaa aagcattgac    308580
     gtgggaagct aaatcgtgta ttccatggct aaaccgatat ctggatagag tcacagacat    308640
     ctgacatgtt cctggtaagc cagaaagcac atctttctca tgtcgatatt gtcaacttct    308700
     tcaaatgtgc atcccgagga atttctctga cctgactgct tgaataccgc ataggtcccg    308760
     aacaacaagg ttttcatatc tcacttctcc atatcaccat ttggcttatg tgtccttgct    308820
     gacggaagct ttagttaggc acttcatagc tgtcagtccg ggttaggtat aaatctcata    308880
     catttaataa tacctactgt gcggctagac gatgcaacta tctaccatat actgaaaact    308940
     aggatatttc ttcggaatgc aaaagacccg aagacggaac attgtattct tatgatgagc    309000
     ggaaaacatc acaacaagga caagttccaa ttgccacaac atctccctat gctgagctga    309060
     ctttgcatcc tcacccagct catgctcctg gctctaggac tgagcattac gtacacgctt    309120
     cactctctct cgtccagcaa caaaatattc caccaaaatt catttcacca tgaattgatt    309180
     gatccacact gttgatcagc tgggtacatt ttattgacgc cacgaagatg taccgcgtta    309240
     ttccactttc agggaagcgc tcaatgacca cagtgggagg tatagtacgg cagacacaag    309300
     gaattaagtg gacaccgggt cattgtcctc acgctgggag ctggttatag cttggaatag    309360
     ccgaagtagc gactgttgcg ccgacttgcc gcactgtttg aactcgcgaa tatgaggctg    309420
     gaggaacgga ataccgggat gctgattgta gcgcttgcgg tatgaaacga aattgtggct    309480
     tgggtctatg agaggcagaa ctttgggcgg gatcaaagag gtaggagtaa caacagcccg    309540
     actggcgtcg aaagcacggt atgtattaga tccgaccgca atatatttgc aaaggccgtc    309600
     tagtatagcc atcagagaat aatagttgcg tgcctcataa agctcctgtg agaaaacaaa    309660
     ttaaatttca gattcttggt atgttcgata gttggagtcc ttaccaatgt gcaggtctga    309720
     aggtacggaa ctaggtccga cagcgcagag cagcattcca acacagaatt gcttagcact    309780
     tgccaatgga tgagtggttc caaaaccata gcatcttccg ctataagtgt ctctcgcgac    309840
     agtctctcaa ataaacattt atctgtctgt gtcaaggctg ttgccaaatc agtcgctgac    309900
     gaagaaaggc agtcttccaa cagaggaaga gaagtttcga agggtgcaaa ccaattcatc    309960
     tggtcagagt gtctgtatgc tttctggaaa cgtacagcaa ggacactaag aaccttgaat    310020
     atagttgata ggctggagga atggtttttg aacagttgct gaattggggc cgcgatgaat    310080
     gcaaatcctg gggtattacg tgaaggcata ttgtgcttgc cgtcaatggc catgatgcac    310140
     cgtgcaaggg cttggtgggc aaaggggctc cggtcccgta ggtgctatgt gaaacaatta    310200
     gtcgattgtc ctatggcgga gtatgcagat cattcgtttc gagcttcatg gatcaccaac    310260
     cttctctact tctaaataaa gcagaagttc ctccgggtac atgtgtagat gattcacaag    310320
     aataccatat aacgatgtgt gctgctgaaa gaaccattct actgacacag ctttgtatcc    310380
     aagagcggag cgtacgatgt cctcaaagga aatctgctgg aaatgacgat ggctctctct    310440
     ttcaatttct atagcgattg ctctagggtc cgataaacac cctggtattg tgggaaacca    310500
     cttccatgta atcagtggaa gctgcctgat actcgatcga agcatgatct cttccacttt    310560
     ctgtggatgc gacagctcag ataggcggca atgctcatgc ggctctgata ccgcaacgag    310620
     gaactcattg atgaactgcg cattgcgact cagcagtgag ttacgcggag aatactcgtc    310680
     gtggaataac ccaaatctga tcgcttggct ggtatctttg aaatcataag cccatagcat    310740
     attgattccc tcatcttccc accatcgata tgtcatggaa aatcgaggaa tctccacatt    310800
     aggccgaaag ataaaccgga ataacccaat atccaccgga gcagcgttct ttgttgggct    310860
     ttgcatcatt tgggataatg tcagcagcag tgagttggtg atatcctggt gggggatgat    310920
     tgatgtcagc agacccaggg gcagagagag ctctacccat ctgtctatat tttaatttac    310980
     cgctaatgtc actttgtgta taagagcggt ctgtatcgaa acataccgtc gatgaccaca    311040
     cttgggcggg atatagtgtt ttgacattat atggcgagac cggggagggg cgcggagtga    311100
     ggcaaggcaa attctgcgcc ccaaagttag gcagagcgcc gtattgacca aaattgcaaa    311160
     tcgttgacct cacctcagat tctcattagc acattgagga tggtatgaaa tctgaaccat    311220
     acccgatacg gatgtcctcc aagccaaaat ttctcgactc cttgcgagct acaagctcag    311280
     catttgattt ttcaccggaa ccataattcc ttatctatgg tactcacgaa ttagaaggga    311340
     aggggatcaa gcattcttgg ataggaattc tgcccgcagc aagtcgcgct ttgggaccga    311400
     tgcgcttcac ccgcccccaa tgtgacatgt gctactccat tcacatcaga aagatagcct    311460
     gtttagctac accttttggc ttcttggcaa ttacatcatt gattatatat tagcactatg    311520
     gctaaagcgg gctcaatcaa aatcgccgct aattgcacac ccgtggtcaa caatagttta    311580
     tttctctgcg tactgttgag tttgagggtc cctctattct tcgatgccct gagaaggttt    311640
     ggctacttcg ttggtccaga aagaaattat caaaagtatt ggcaacacat taataccaga    311700
     cctggaatgc actttctctt tcctgcattg aacattgtat tcagggtgtg aggaatccgc    311760
     tgtatggcga acgtacgggt aaaattcaca atggtacaat tctctcccta actagaaaac    311820
     aacaatggtc cggttttgac aatctggtcg gacacaatta gtaagcaaat gcatagtaaa    311880
     aatgtcacat gttcacatgg taaaaagaca gtattatcct gtttcttgac acagggctta    311940
     accttcgctg acgtggtgat gaatgcgcat gtaaattacg atgttgaata aaatcaaatc    312000
     aacccttcaa tttactcttg attgctttct tcggatgttg acatacagtg ttttatgcta    312060
     tcttgcaata ccaaacacaa taccccccta ataacccacg aaccaatttc cttcctcttc    312120
     tcgcctccgt tctctccgaa tatgatctgc attcctgttc cattctagat agatcaggtc    312180
     taatataaat gtggagctgg tgggagtgat tccaccggat tatcgaagga atcggatggg    312240
     tacaaacggc aaatatattg cggcgccttt gtgccgacga attttactgg ggaatatctg    312300
     gcacaactga catgcggggt attctccagt gttggattat atcgaatcat agcactcatc    312360
     atggggatag ttggtttagc attccatgcg tcgatagttc cggacaaatc ggcagattgg    312420
     ggagtccatg gcctaatccc actagggagt ggttggtgcg ggcatggaat gggcggtaga    312480
     ggaactattg gtacggaaag gcgggaaatc attgctttaa cgtccgcact gctgttacag    312540
     agaagctctc cggaactatc ctagtccagt ccttccagag cctgggcagt cgtccggtat    312600
     acgaacatgt tggcagctct gacaaactcc cctgtcattt gttcatatga gctcccttcc    312660
     ctggatagtt cgacatgtgg ttcgctgaat taaccagaaa atcttcataa aagccgggga    312720
     attatttgtg tgaagcgagc gcatgttctt gcgttcaatg aatgttgccc tttcgagaca    312780
     cgtagacttc gggggccatt atcaccaagc aaatactagc acgcgtcctc ggccatacct    312840
     tcccaaagcg ccaggggtag cagtctagga agtcatgcga acacgacatt ttgaaagacc    312900
     ttgtaatggc gctaagtggg acggaattgg acccgtaatt ggatgcaggc aggggttggc    312960
     gtgtgccatt gtaaaattga accttggctc ttggaccaga ctggttgcgt tggaaaaaaa    313020
     catgtactgt aggataggcg gagcgaaggt tcggaccaaa gattcgaggt cgatccggac    313080
     aacatcggaa cttctggttt aggcaagaga tcctcctatc ggactatcca ctggcccctt    313140
     acgagaccgt ctccagggtt atttcgcttg cgatgggcgt atttaatacc gccttttaag    313200
     ccagaaggga taatcattct catgtgcaag aatacagata acaccttcga gttcgttttg    313260
     atctgaaggc aggatataaa ccatttccca ctcgtcaggt ctgctgcgtg gaattgctca    313320
     caggtaaccc aacccttggc ctacttgggg aatcaagact ctaaccaaac ttatgattgt    313380
     gacagtatgt accatgacga aaactcatcc agtgggagca caacctaccc actcgtgggg    313440
     gtcccgatag actacccgtg tggcctaact cccgccccgt tgatggactc ggctcctgca    313500
     ataggcccag cgagtgattt ttgttggagc tttgagcaag cacaaaactg gacgacaaca    313560
     ctcgcgtcgc caaccgtcac acttcctctc cacctgattt cgagatatcg aggaataata    313620
     actcgaccgc cgcacgaatc agcgtccact ttgcctccgg tgcagcctgg caaagaggaa    313680
     cagcacagcc ggcaccggaa attgggggaa aaaaacactc gaagggccac agacagttag    313740
     atcaaggaca cctcaagaag acagccagaa gcgcgattcg aacggcacct gaggttacgg    313800
     atacgaccaa gaagcaagtg agagttggca gaatgaggta tgtacggctg gactctctaa    313860
     ctggtatccc gggaaatggc taagtcgcct attacagcag agcgaaaccc ccgaaagctc    313920
     cgggggggga ttcagccaca caaggcccac gcccttggtc gcctgattgc tcttcaaatc    313980
     atccggagaa tagttctcaa gcttcagtag gggctcttca gagagccttg gaggcccagg    314040
     tattacaatc actcgaggtt ttgcgtgaga tcgccaagga gttccgcgcc ttcaacttgg    314100
     ggcttgagac gattaatgac tgggtggcag agatcaagga agttgacgaa acattgatcc    314160
     cagtcgcatc aagcaccgcg gtccaggtac ttgttccttt cgaaaagcta aactttatcc    314220
     tcgcgaaatg tattacagct tcaggaccca tgcgagactt tattgtcagg gaccaggcac    314280
     tggagttgtt gaaatatata cagacctatg cggaggagta tcacctgttt aaaaacccgc    314340
     gggtccatct tgacattggt aggtatatag aaagactcaa ccaaggcaaa gataatgcca    314400
     aggcaaagat aatgagatgg gcaaatgatg ttgttctccc gggaggtcgc gcatagtcct    314460
     ttgctgtata ccagtcattt tctgcctaat ttggcttcaa aattgaaaag atctctctgg    314520
     agtgttcatt gcatgccaca tactgaagat gcttaatgcc gttctgtcaa taatgaagac    314580
     tctaccgctg ccattctgct gttccagacg ttcccgccac ttacctttta aggtatagga    314640
     tgcatatcgc gcagtccaat aactctaggc ccgggaatat gcttgtatat aattgctccg    314700
     tcgtggcagc ccccaatctt tgggaatgcg gaggcattca accttgcttt cgcatcccga    314760
     atactacctt gccgatgaac aggagtatac ttgttgctcg gttacattgt tcgtatagta    314820
     gagggtatgt taggtcggtc cgattcgctc acgtaaacac cctgctagaa taccaagacc    314880
     attagctcga gactttcact ttggggacgc actgtgagac tcgacagact ggttgcgtta    314940
     tgtctctatt ggacaggttc cacctcatct ggcgctcggt atagggccct cttgtgctcg    315000
     tttgacaatt gggtagaaag ccatctcgtc gtgtacagat aataagtcca gctaagctta    315060
     gatatgtaag aaatgggaag caagactcgg ggaataatag gaagagaacg tgccttgaga    315120
     gtttcactca ccgtcaatca agaaaattct tgatttgctc ctccacagca agccttgtat    315180
     caggattata tatgctggct gtacaggcaa gtcgtagtag cctaaaagga tctcagaagt    315240
     ttctcgcttg cataggatgt ggtccgtgga cggcagatgc cgaatggtgt tttctggtag    315300
     catgtgggct cttcaaagga acaaaaggtc tcgatctgtt agggctgtga tatgttgttg    315360
     aataagccag ggaatgcgag gaaggaaggt cgaggaaagg agaaatgcat cactgactgt    315420
     ctgttttagg taaggcagat ttgggtcctc tgccctccac cttaccctga cgcgagcacc    315480
     tgactattct ggccctcctt gtctcctgcc accaccagtt ccccctaatt agataaaatc    315540
     catgcccgtg ttgcaatttc actttctctc ggtatccttc ccggtaagtg cgagctcatc    315600
     gaatcctcca aacctgtacc taccaaaggt cttcgggctc aagcctgaag gctacccacc    315660
     aagatccttt gctaccaaac gttcctaagg ctgattcgaa acgcaatcta gtattgtatt    315720
     accctagttc gaacaatagc aatcttcaga ccgaccagac tctagcctcc cccatccatc    315780
     cttccgtcac acgaacgtcg tgcatgattg ctcgactttg ttccaccgaa gtactgtata    315840
     aagccagtgt acgcacacgg ctatcaacat accgttcttt acttttccac caccggtgtg    315900
     gagaatttgg cgtgggctct aagggctagt ctgacccggt cagaagcgca gcgaccgtgg    315960
     cgaaacaact ctagcgcatt tttgctttaa ggtgagatgt cggaccaagc tgtcgcataa    316020
     tggacactgt ttctatctct tcttatcaaa agacagtccc taaataccct tggccgatgc    316080
     cacaccagtc aaacctgcta ggtcctcgca gcaaaccacc gctagcaacg acttcacaca    316140
     gggaagcaat agacgataag tgcttgaata tttgcctggg acctaggcat aatgcatcct    316200
     cctgttaggc caaaattaca aacagtctta gattgtgtta agaggtggga aattcataca    316260
     ttcagttccc ggaacaagct caaacaagtt gaggctatct taatcgccgg agtaacatat    316320
     atatagggca ttcagacatt aagcccatcc tctgtcctct tacttaatcc gcgtcaccta    316380
     ctcgttttgc gtacttgcct gtcatttggc agtggtttct cgatgataca acggagaaac    316440
     cggaagaccc taacatcggt cgcctcttca aacgccctat ttcaccggat tttccttcca    316500
     tgacttaaca actctgatat ggaaagatta ttgatgatac gaaggatgct ctacatcgca    316560
     tatcatgcag aaaccatgtt ctgtttcaac aactctggat aatctatgct ttgctgatac    316620
     taaaggcaat gacagcggac tcatgccgct ggatatggaa caagaatacg ttaatcattt    316680
     tgatgctgac cgggggatct tgggaggcgg ctcctaattt tggtacatat ctggtgccct    316740
     gcagtctgct gtaaagtata ttagagcaac acagagacag ctgcatgaac gtttgtttcc    316800
     catgaagact acttcccttt cccacaaaat tctcttagga acgtttcttt atccgtccct    316860
     ccgtgaacaa aaaaagctcg ttcagcgttg gaattacgga agaccatcgt atcatttata    316920
     gaacctgcac ctccggtgat caccatgctt gtgccaccaa aagtgcagtc tttgaaggta    316980
     tatgtccttt gcttttttga tcggtatcgt ttggtttctc acaagggaag acggtggctg    317040
     atgcaagtca atacccgagt cacgttctca aatcatagtt tgtatgaatg atataacacg    317100
     aatcgctctc gaggcccagg gttctcctac cactaatagt tgatatgaat ataaggatcc    317160
     ccgtcactgc catgctatag caccatgcaa aatcgctgga taccaattat agcaaagctt    317220
     tcccggtaaa gtgatctata ggcatgaacc attagatcta ttgccttctc acgttagatg    317280
     atggatgcgt atacaatatg agtatgaacg ctatatatta tttaacagga agtctttagt    317340
     tcgattgcct cctcataaac caaccattca tggtccaaca ttaggaatcc tgcccataat    317400
     tttcataata tttgtaccgg gagcggattg gattgtgttc aaatctttga gccattcttg    317460
     cctgaggatc acgtgtttgt gccagataaa cagcattttc tctttgttga ataatgtgcg    317520
     agatggggac attgtttcct tggacgctta atgagcggaa gaaaaggctt gcatatccga    317580
     aactgaaagc tgctttgatt ccgcgaattt gaactcttag atcgagtatg gtcctagaaa    317640
     agggactcgt ccctcaccgg tgagtaaagt ttgatcactg ttggagggct caacggcaaa    317700
     tcgccggagt caacgaagct agtgggagac gtgaaagcag cctgcgcagt acaattacca    317760
     gagcgtttag atctgttcag aatgttgagg tttttgggga ctcttattgt acggtctctg    317820
     atgttccgta gacacgattt gcattagagc catcataaag atgcccggta tcgacgcacc    317880
     tttgtgtatt ctacctactc gcatcattga ttatctcagg gctatagcca atgcaaaatt    317940
     cttcatgcac gactgccgtt ccctgcacgc tcatggccaa ctgtgcaatc aagttgcaag    318000
     ccgcccctct tatacatgct ccttgagaat atgcccagct ttagccggca gtatgctccg    318060
     agaacgtggc aaacatctcc tcctactttc gccggctcag cctttaccgc agcttgacca    318120
     gcatgatggc ccaagtctgc caaaggtcaa cccgccgacc ccagctgcca ctcctgtcca    318180
     taatttggac tcacgagtcc tcccaagctg gtccgacgcg ggtcacagca tatggaggca    318240
     taataaactc gatactacat ctctacactg tgaatatcgg gtagaccatg gggtaattca    318300
     ggcttaccac tgttccccgg gttctcatta ccatgcacca atgctgctaa gggaccgtga    318360
     catgcccagc ctctgtcttt ctcatgaaac agaccgtccc cttgagtcga cctccatacc    318420
     ttgcttgcca ccattaggac cctgccactt gagacaactc gactcatccc aaaagtcgaa    318480
     cgtagttgaa cgtgtgccgg gggctggttc ctcgacaagc aaactgtcaa cccagcgttg    318540
     gtatttccat cagcttcgac aactgcttct gagaccttgg atattacagc aagtctcccc    318600
     gcggtcgttg aagttggtcc tataccctcg cgtaccggta tcgcctctac ttggatgctt    318660
     gaccagtcac aggagcagtc ccaggtactc catgacacca ccatgtgtgt aaatgaccat    318720
     tcacttcttg actgtcacgt tagtagcagg cagcatggtc ataacttgaa tgttgagaac    318780
     cagaaatttg atctgcatga gcggaggttc aaatgcaaaa tcattggctg cagaatgggc    318840
     ttcaagcgtg aggaccacct cgagcgtcac acaaggaatc acttgaaaga aaagccatat    318900
     gtgtgctggg tgccttgcca ccgtgccttt tcacgccgcg acaacctcaa agtccattgt    318960
     acgaagacac atatgagaca cggtggtcgc aaccgttatg ttgctaccct cgacgagacg    319020
     agccccgact acgatccaga gttccgtggc cagctgtcat ttgatggacg cccactcagg    319080
     ttcttagctc gtattaactc cgttcctgaa gctaagcctc tgcaaccgtg aatctgcgca    319140
     ataataaacg tcaaggacat attttcccga caaacaagca ggcaaaacta agtggccaaa    319200
     gtaaaccagc gtcatccaag ctcatctgct tacgatccag ctagggaaga accgcggcgc    319260
     aatgccctgt cgccctgcca accttcaagc ttctcgtcca ttgtttctgc ctacaggagt    319320
     gctttgtcgt caaacatgcc gaatgtatac aactttagga acacaacgat agccccaata    319380
     gtgcaaaggt ggcacctaaa taataccact gcccctgcca ttcctggatt cgtcaatttg    319440
     taaattatct tcgggcaaat tactggtcaa gggagtgcag ctcgtttaaa actgtttgac    319500
     aacatatccg aggctcgtca ataacctcac atatttgcaa tctgctccgt actataaatc    319560
     aagatactcg gttaaaactc tgatactaca tttgaatagg ttgtcttcca tgattttccg    319620
     gccttggctg ctatattcca tgacacattc ctccgctggc gacctctcag gagcatcttt    319680
     cgatatccat cagcatggcc aaatctcccc gagaggattg attccagtcc ttgagcacgc    319740
     tgatcagtcg ttcttgagtc tgctccaaag cttgttccaa gaaaaccaga cgagatagct    319800
     gctcatcagg acgaagctgg aaaccgtccc gcccattact caatttggcg gtagcttcat    319860
     tcggagctct gtcattttcg tctggtatct cgctctcgga gtgtttcggc ccacgcgagg    319920
     cccatagacg tcgatagagt cccacggccc gagccgcttg aaaggcgagt ttggggtcat    319980
     cgcgatcaag atctgccagt gtctccaata tgggttgaaa atgctcgatc gtcagaggtt    320040
     tctttagggt tgcttcctgc tgctacgaga gaatatagtg attagcaaca gtataggacg    320100
     tgtcgtcgca cctagcttac aagtgggggt tcggaatcgg aaaccgcctg cggataggcc    320160
     tcatcactct ccataggcat ttcactcggc tgatggtctg cactatcttc gtccggtagt    320220
     tgttctgaag aattcatcct gttcacttgc aaagactcag cgcccaaaaa acatataatt    320280
     accagctggc gctggcctct cttatagcct gcccagaatc aaacagttag ttcaacgttg    320340
     tgacaaaggt ggcatagctg gtccaacgca accatgaccc gagacatgtc agagatctcg    320400
     ttgaacatct attttcaacg ctcggacttg ttataatcaa ttttctattt ttcattgtac    320460
     catctgctta ccattcgacg aaatctgagg gataaagaaa ggaaaaaaag aattcctccg    320520
     cttattctat ggtgaccgta gtgatagtaa gaaattatcg aggccattac ctcccccata    320580
     gttttgtaac tgttgaatat caataacctc cgaaagctta ccgctgttag taaggtgtat    320640
     tccggagata cgtaatcttt tcccacagct cttcgcacta tttcacccac tcgtctactc    320700
     agaaactgcc tcttgcattt gggctgtagg ctgtttcttg gtgctgtgaa gtgtggtcgt    320760
     tgagtcaacg ttagttcgtc aaccgtttac aataacgtcc tttcttgtca ccgaatgtgt    320820
     cgcttaagcc agtggaaata taatccagac atatgcacag gcctcacatt tggtagtcac    320880
     cctcacaaat atgcttttac atttgacgcc aactagaagc ttgcaaatgg caagacaagc    320940
     gggaaggtct ataactacct cttttaccta tgcttttgct caagacaact gcatgactga    321000
     tccgcagcca gcagatatta catcctaggc gtcagaatgg ttttgtccca agttgattaa    321060
     ccgtgggcat cttgatacag tgggaaggtg aggtgatgaa tattgtagag gttaaaaaac    321120
     gcagaacata tagtattaac cactggaatg tccgttatac attgtgctag tcgtgtcttg    321180
     gcaatctcgc atagtggaga tagaccacag gaaacggctt gctcctgttg ctttagggaa    321240
     gtacattact gaaggaagta aaacaactga caaaaagatg cacgctaatc catcttatat    321300
     gggtgacgtg gaaagagaac ctccgcgctt ttgagacatt ggtccaccgc ccgcctactc    321360
     acagatatcc ccacaatatt ccacatctca catcaataat caaatttcat tcgtctctgc    321420
     ttgcggctac cgactaactc tagctgggtg taaatgttta gtgaaggtgg gtaaaagcaa    321480
     attctagcct gttctggaac gcccagagcc taaactgctg catgaatgaa gtatactatg    321540
     tgacttgaac atgcttgact aactagacgc cgccttcggt aattttctgc cggacccact    321600
     ttttgtggtt ggcattccct ccaaccaccg catcgtcact ccgccaggat agtctattat    321660
     ccaccaaggt ttccccggac agccgggtgg tctgctcagg aacagcatat gcagcgggca    321720
     tggcagtcgg tgtccaaccg ggctcaaact ctccttcaat actggagggt tctgttggcg    321780
     ctgcaattgt gtcggatgcg ccatcggcga aagggtcacc gtccgcccac cacttgcagg    321840
     agggttctag atcaaggtcg atcaatcgcc aatcacaact cgttctggaa tgaacgatgc    321900
     ggcgtactgc tgcgcgtgtc gatttgcttg cgcacactaa taccagttag cctggcaaaa    321960
     ccgaagtgca taaacgggag agcgctcata cccgaaaccg cggtcgttcc gcctctacca    322020
     tccattagac gtgccatctc cttgccgata ttgatgacat gaaaatggta tttcaggcgc    322080
     gtgcaattgc gtttgtggta acgaatccgg tccacgggct gggtatctag gatatgtgta    322140
     gtgaattgca gaatctacta ccgagttagc ccggtccatt gtaggagtga tagggagaag    322200
     gaatattcac tcacatcaaa tccccggtca tctcggtgtc tatgctcggg acaatcgttt    322260
     ctgtcaaaca tacggtcgag ctcgaggatt tgcgagatgt catcccccac ccaaggggga    322320
     tggtttattc cagtaagcac atgacagcgc aaagcatccg agaagaattg gggaaccaac    322380
     tgaaatgttt cagcctaact tgccacagga cttctagcct tcgcaccgtg tttctccggc    322440
     ttcggctttc ttggacgaga tgtcgtatga acggcaacgc gcggaagagt ccaatgtctt    322500
     caagtacaaa gacgacggtc ccgtactggc caaggttagg tggatgccca tacggaccga    322560
     gcacgcatac cggaaaatga atcgtcgaat acgtcgcatg atccgcagct tgtgccatcc    322620
     ttccagtcac gcccggtcgg ggtcgggcca ctatgcgtaa cgtgcgagtg gtcggtgctc    322680
     ctggagtgtt ctgcgctgtg tccaccgaag ccacgtagaa tgcgggaagc tgcaagaaag    322740
     acctcacccc taagcgtggc atccagagct gtacatactg ccccggttga gcctcccact    322800
     ccctgggaac cgcaatatca agccataaga gctggttgaa agaccgcgcg agggcctgtc    322860
     tcgaggtgat gcgccacgac ctgtggaacc acatactatg cagacatgtc ccggcactcc    322920
     aggcacatcc ggcgcaaata ccaccaagta aaacccagcg gtaggatgat accctgtcaa    322980
     ttaaatggta ggaaagggcg ccggtggcgg tcaaagcaag catatggtgg accttgaggc    323040
     ccagttgcgg ccaccggcga aggattgcag ccaacgtcca aggcaagatc gagacgagac    323100
     tacatccggc ctgttcattg ttagccactt ctagtcagac atactgcggg ggaatgggga    323160
     ggctcccgtc ctcagacccg cttcacgtac caggagtggg atggcgaggc gagcaccgtg    323220
     gcttgtattt cgagcatttg cccctaagac ggacccatga agaaggcaat gcagcacgca    323280
     aatgcgacct agccaccgat gggcccagta gaacgtgtcc cgttcgacat agtagacgtg    323340
     ggccggaaga ctgaagctaa acccggagca gaggggaaca aggtgtgtga ccgccaagca    323400
     tccggctcgc ttctgcacgt ccgcccacgt ccgggcatga aggctgatta caatgatatt    323460
     tgcaatcagc aagactgtaa gtactccccc ttgcaagtat gatgggatat ctagccactg    323520
     gagcaggcct ggtgttggcg cctggaagaa acttctccag gatacctgct gcaacctcaa    323580
     aggcaaatga ctgaatctgc gtccgaggct ataagacatc cagcataaaa gagcaaggag    323640
     cccacagata ccgaatttat cgtggatgga agctctggca agccattcgg caaactctga    323700
     aacagggcgt gacatgcttt ttaggacagc caatactgga catcagcggg tttatatctt    323760
     gtttctcaaa tggctgtttg gacaacgttg acctggagct ttgatttagg caggcgaaaa    323820
     tggcttggga gagtgatgcg gcaaaaatga cactggtgag taacgatcag aaacctcatt    323880
     ttatgacttg ggatggtgtg gcaggttgat ggctgaaaat tttctgcatc ggcagcgtaa    323940
     cagtggcaat ccgccgcatg ccgattgcaa gacgtgcgtc tcggaaaaac cacgttcggc    324000
     gttgagcctt aattctacgg ttcccatgtt cctgcattat attacaattg tgagttcaca    324060
     tagttcgaac agttgaagtt gatcaacatt ctgagaagca tctccacatg gtgcatggtc    324120
     gcttatctaa tagacggcga ccgtctttat tagaaatatc gttgaggcaa cctcgtgata    324180
     cgctctgcaa actggtcgca gttaggttag aagggttcgg ggtcgtactt gccttacgct    324240
     ttcccaggct tccaacgtca acgatctgtc tctcaaccgt actgtttcct atcagggctt    324300
     tctacagagt aggtccattt gtggtatcga ggaaagatgc caggtagagc gccgaatagg    324360
     tctattccca agtcttggtc tatctgtgag tgttaccaag ttataatcaa agagtcttat    324420
     atttatccac aaggtaacca caagcaacaa tgtatgattg aagacgaaga acccaactaa    324480
     gtacacgaat aggtgtcctt atatatccct gagttcttcc tttgtagatg agtagatagt    324540
     agagtaatag atttgccttg gcagaatcta ctgatcgacc atctaccatt ctactacctg    324600
     cacggtcacg tggtcggttg ttccaaagtg gccgctggtg gtactgtgat ttccggcaca    324660
     ggtagtcgca tatgtataga aaaacctctg acggtgggcc ttggtcttgc tcactgagca    324720
     tgatcatggt ttctctttcc ctgaacatct ggggttgcca gaatatagga tgttgcacgt    324780
     tatctgctga catatcaaat ggttggatct tggtggccca tcggtgtagg tgtcgatcaa    324840
     atctgatttt ggtgacgggt atgcctggaa cacctcggcc agcaacggcg aggaaagcgc    324900
     gaaatagtat gtatacgaga tagagccgct gttgaccatg tgtttccctg gtctctcttc    324960
     tgctcttgga tacaggaact attcaaataa accgcctgag tgcaaatagc ggatggggcg    325020
     caacaagacc gcgacactgt tagaagacaa tgtgagactg tctcgtgacc cttaacctgt    325080
     ttgcggcgaa catgcgtttg agctgcattt cgaatagggg ttcaaattaa tctcaagtcg    325140
     tcaaaggtag actcatcatc gcagatctat attctatgac tccttctagg taaagtattg    325200
     tagtggtata gtgatattct gcgattacat ctggatccct ctcgctaaat ctagatcttt    325260
     gtgccgggat cactggtccc aagaggcgtt gatgaagctg atcgtgagaa actgcttcat    325320
     gctatctccg agaacccaaa aatcactcgt gaggatatgc ttgctgaggt atcgcataaa    325380
     gttagtataa aaggttagtc ctctataaga ttataggcct tttactaatt ttttataggt    325440
     taaatacgac tcaattcgac gccttcttaa tgctgagaat atgcgaaagt ggcgttgctc    325500
     ctggaggcct tatttaactg aggctcacgc gcttaaacgt ctacaatggg ctatgaagta    325560
     tcgtcacttt acgcctgagg actggggccg tgtctattgg tctgatgaat gctctgttga    325620
     acgtggtatt ggtgttaaac gggagtggac ctttatacgc cctcgggctc agcctcgaga    325680
     gaagcaatgt caaggtttac cctataaggg taagcaggta aaacagatgt tttggggggc    325740
     tttttgtggt gatttccggc gaactggcct aattccgcta tttagtgact ctcaatctga    325800
     gagaggaggt attaatcgtt ttgttattga agatttgtac cgtcgaatcc tacctatact    325860
     aattgcgcat gaagacggca ttttccagca tgataatgcg ccttcacata ccgcaattat    325920
     tgttaggcag gcattagacg aaatggtgat tgaggttatg gactggccac ctatatctcc    325980
     ggatttgaac ccgattgaaa acctttggac gttgttaaaa cagaagatgt atgagctacg    326040
     gcccgagttg attcatatgc ggaataatga tgaaacgaag gagctactag tagctaccgc    326100
     gcaggaggca tggaatctcc tagattggaa gcatctagag acatatctgc tacgatgccg    326160
     catcgtgtgg aagctattat tgaaagtcag ggctggtaca cacagtatta gttagaaatc    326220
     aatgcatgga ggttttagac tggcagaata ttacataata gtggtgggtg gagcaagggg    326280
     tgtccaaatt tatgcgctgt cactgtaaat tgttagaaaa gccgatacag aaatacagag    326340
     agttgaatac cattgattgg acccctacat ttttacgata cggcccacgc cgacactacc    326400
     aaacgctgac caagttatac cataaggcgc ccaaaatatc tgtagaaccc tttagaaatc    326460
     tgctctagaa cttcgaggct agtttctatt cagcagggta gattttaaca ggataagtag    326520
     accataatag ctagcgggcg aatcttgggc ggataattcg actggcagga atattatata    326580
     atcatatggt atggggcgaa ggatatatca cgattggtct caacttggta tgtatcgccg    326640
     tgacccctca gtcttgttac ccagagcgaa tgatgatgct aaaaccccgt tccaccaagg    326700
     ccacgaacag tctagagcgg ggaagggtct gatatttaga aggcaacttc gccgaggcca    326760
     gatagggaag taattccata gaactaactg tgactagatc ttgtttagta aacattatcc    326820
     tcaccattaa cgtagcatgt tgtctcaatc cagaaaaaga cgttgcgcgt actagaatat    326880
     caatttaaaa ttctcaccac atgggtgctg caagttgtat cgtcatcctt tttgacgacc    326940
     gagtgtaaaa tggacacaac catacgttta gtgttggcat gtgaataccg atacaatgcc    327000
     aagctccgat aatactcccc caaggaagaa gctttgacca aggaatacat cgataatgat    327060
     tttgaacgag gatttgttga atgatcgacc tcgaatgatg aaggatgcgg ttggcctgat    327120
     cttcgtacca aagaaaggca tgggtgaact gcaagtatgt ggaaattata ttccgctgaa    327180
     ccgatgtttg aacaaatgac cagcaattgc tcggcttgag tagccctggc gactggcgga    327240
     gagcacagat aggcgcctgg caggctacac gagcatgata aagtaacagc ttcagtagtg    327300
     actcaatgtg tgaaggtggt atgggattgg gaatggagat atgatagcat aggatgagcc    327360
     gaaacaactc ctcctcgttt ttgccagagt tggttgctca agttgtgaaa tattcatcat    327420
     gttagatgat gacatgtaga tatatacaaa ttaaaaaaat tgagactcag ttgtctcctt    327480
     cagtcgccag tatgcgagaa ttcaagttag ctgcaagttc tcagataacg agatttaact    327540
     agcactcaaa gggtcggggc aagacatttt atcttttcta atacggcttt gcttttgggt    327600
     tatatagtat atagtatgta ccaattcgaa cgcggatcca gacaagcagg tttgtaaaag    327660
     cacctactgt ctgtatgata aacagactga ctctatatac agagggacat cgcctcgaaa    327720
     ggcggtcatg cttcaggcgg aagcttccag cctggagacc cgagagctaa agaagcaggc    327780
     cggaaaggag gtcactcatc cgggcaacct gaggagtagg gcgattactt tattttagta    327840
     gttgggttat attcgttgtt gcgaatgacg agttgctagc actcttggga gacgatgggg    327900
     ggtgaacaga tgagaagata tttttgtaat acatttcgtt ttaaagtgct tacggaacga    327960
     tcgatttcta ttcaaaacgt atatccgctt gaattctata attaggggct tctggcccac    328020
     cgttttgtgt gagagccatc gcatccttta gatcactcca ctcccaactc acgaatagga    328080
     tgtccttctt aacctcttgg ggaagatgca gcgaaagaaa aggaatgaaa gaaaagataa    328140
     caagatttct acgagaatca agaaagtcca ttcacataaa acgaagacaa aaacgacttg    328200
     ccattaatgg gccacgcact tttattgtcc ctatgttgga tgcgcaaagt acatacattg    328260
     ttcgcccaac ccaacccaca tcttgacgtc catggaaatt gaaatcctca aattgtccaa    328320
     cgtttcattg ttcaaatggc gggttatcgc ttgttccagc gaacacaaac gaacccaacg    328380
     aggcccccct gacccgcttc gtctccagct cccctgtcca tcactggctg tcattacttc    328440
     ttgcatccag ggagatcgag ccacccatga ctactcgtct cgaccctcag catacagcag    328500
     gatccaaccc ccaatgcact cggttcgaac attctcaatc aactcggcct cagtccacac    328560
     acggaaggcc cgacggaagg tctgaaacga ccgctcatac ttgtcgagtt cggggtcaag    328620
     cctcatcagc cgcatgtggc tgccagagat tctctcatcc ttggggtgcg tgagcatggc    328680
     agtgcaacca cggcacgagt aaagagtttt gcgcgtattg tctcgattga tgacaggcac    328740
     ccgacaggca acttcatggt ggtgagcgtt ccgatgataa tttcccaacg acacgagcaa    328800
     acgcattttg acagaggtcg gctaatgcag ggtagcagcg cgataaatgt cacgtcggtt    328860
     ctcgaccaca aattcctcgt cgtcagggtt atcatacttt tcatctttat cagcaattgg    328920
     cgagttaccc tccgcagcac gcttaacgcc cttgcgagtg ccatacagct ccagggcttt    328980
     ggtcagcgcc aacttgatag gaacaaccca ggcgccaagg tccccgaagt ccaagtcaac    329040
     cttgctcagc tgcggcagat acatggtctg agtatcaatg aggtcgggta ggccgagacc    329100
     aaaaataatg gctgcctgtt gcacggggag acaccagtat gcgtggttgt cgtgcacgca    329160
     tgggtggcag atacgctcca tcgtgggaag gtagagttga acacacgcct cgccgcatac    329220
     cacgcagttt tcacggatga ttgcctcttt gagctcaaga atgttccagt tcatacggat    329280
     ctgggtctgc ttgaggatct tcgacatgcc gggggccaca ctgccgcagg aatgaaatcg    329340
     ggctttgctg cacaaaatga tgggcgacac ggttgacgta tgacagcctg atagcactag    329400
     gcaggtccaa tgtgttgacg atcatgtcca cgagttcgtt cgggagactt ctcatatccc    329460
     ccaagtcctt cacgggcttt tccttgggtc ctatggccac cggcacaggc ctcacctcga    329520
     tatcaacgat tccagtgttc agggaacggg ggctgtttcc aaggattttt agcatcttgg    329580
     caggctctcg actgttggca aatgcccgtc cccaggatat ctgctccggg accagcttga    329640
     gattcattgt gacgggacag cgcgcaaatc acaagaatat gaaattgaac gtggtggaga    329700
     gaaggcaatc agagatgccg ctgtagaaac gcggtcagcg aatggaaacc ccctaacagt    329760
     ggtatgtcag tgaatgaggt gatagacacc gcgcatgtca cctaggtaac acaaaccttc    329820
     gtgttgagaa aggatggaaa attgatggaa agggattgag aagagaggaa gatgtgaagc    329880
     gaaaatgtat cgagaagagg tgataagggc cgccaatcag tagaggaaac tcgaattggg    329940
     aagcgcgcga ctgcggcctg gcatggcaaa cgcgatgtca ttgctcaagt gcatggcata    330000
     ccatattgct tacgcgtgag cctttcggtg agctcatcgc ggacagcgaa ctggaggtta    330060
     ttctgaccat tgtgccttcc atatgcacta tcactatgca aattgggcat atccggagtg    330120
     cttgcatggc tgtcagccag cacgggctca tggaatactg cggcttgatc tagagtccac    330180
     aaacaaagag gggaggaagg cttcaaggaa gatactatac gatgttttgc aatttttatt    330240
     gaggtgccgc tctacaatta agcttggaga gtctagtcct ttacttttcc tgaagcagtg    330300
     ggctagggat gctgaatatt accccgagtc agctataagg cgggatacat gctcgtattt    330360
     gtctcatctc gctcaaagtg atcatactgg gaagacaagt ctaacataaa tccactactg    330420
     ctaataaaga agtagttaca gcctgccgga gctccaaaaa gggccaaaac caaaagctag    330480
     ccaaaagtct tattccaaaa tacgtatcct gagtacaggt agtaatcacg gaagctaatc    330540
     acgactgcag tgaatgcagc gacccctgac gctattcctc ccacggtttt ttgtgcataa    330600
     tatatcgggt aacaggtgag attgacccag aacatgcggg attgttcgca gacacattgc    330660
     agtgaagacg ttgataatga actattggct attttatgcc ctttttacta taaactctcg    330720
     gaaagatata gctgctttcc atgcggtaat tccccctgaa ctgcatggac gcttgtagta    330780
     tttccctatc gccaagatag gacaggtcaa tccggaatag gcaattcctc acccttctct    330840
     tgcaacgtcc ggcagccctg tcagattggg cctgaaagga tagttccagt catcgagtag    330900
     gctaatcagt cgttcccgag atgattccaa tgcctgttcg aaaaagtgca gttgagctag    330960
     ctgcttctca tggtgaagct gaagaccgtc cctctctttc ctcgggtgcg taccagcctc    331020
     cttcaagttc tgattgctct ggtttagctt ctgaccatcg atgtgcttgg acacgcacga    331080
     ctcccatagg cgtcgataga gcccaacaat tcgagctgct ggaaacgcaa acttaggatc    331140
     gtcgcgttcg aggtctgcta gcaccttcaa gacaggttga aagggctcgg tcgccaaagt    331200
     atgtcttgtt ccttcttcat gttgcgcagg ggagagctgc gatggtcagc aagaatattt    331260
     gaagccaaat catttcacat accaatggaa ggacatggtt agaagttacc ggtggattgt    331320
     ctttgtcacc aaggcttggc aattcactgg gctgctgctc tccttccttt ttctggtctg    331380
     gcgagctgtt tggggaatcc attttgtccg caggagaaag tcaatgatct gggaagtact    331440
     gtttccaaca ggccttggtg tctcttatag aatatgcaaa tgcaggtgac tatgtaatgt    331500
     attttgtact gttaaattat gcagccaggc tttgacttga atctgatcac ttttcggcgg    331560
     gctgttgaca atcaatttga tcatggatag tggtcaacca gtcggtcggg ggaatgatca    331620
     agcctcacga taatgacggc cagatatgaa cgctcattta tgagatatgt atttcaatca    331680
     aacatcactt taaagcgagg ctaggagaaa aagtccatga tttctaggga tggaattgta    331740
     agcgcttttc ggtaattcaa cgtttgagtc gctcacagat gaggtgaaca gaacaacaaa    331800
     taggggtctg tcattgcgga ttgaatatct cccacaaagc tgaatttaag agcgccatga    331860
     atccttccaa cgttgcttga ccgactcagc atcccttttt cccaacacca ctcttactcg    331920
     tttctctcgc tgagcacata aaggcatcaa agatgtcgct gcaaatagtt gcgtaaaaag    331980
     aagacgctgg tttcaacagg cctcaatcaa gagaggtgcc cttcaacgct tccaaccaag    332040
     ttggtaattg acagaagccg agaagcgtac aattacgtcc tctaccccgg caatttgctt    332100
     tacgatttat tcactttact ctgcaaaatc gagcaggctc gtgtctgagg cacttggtaa    332160
     gttctcctct ttgatcgaat actggaattc ctactgtact gacgcttata aaatacatcg    332220
     tgaactagca agtcagacag tgtctgtgag agatgtagtt cccagcagat ccactctgcc    332280
     attcacgcca gccgatcaaa gatatgagat ttgggttagc tggttaatgt gtctatgcga    332340
     agatgtctcc gctatagcag ctgactgagc tggcctactg tcccgcctct ggatgtaccc    332400
     tcaaagttga tgcgcgactg ctcatgctgt agatatgtga aagtctgcaa atccttcact    332460
     gacttgaaag acgggggaca gccagatccg tggacattca caatgcacca gtgcaagggc    332520
     cacagctcct ggccgtctct tcatccctgg tcttgaccat cagaacagtg gatcatggaa    332580
     tgtcacgctg atctactggc taataataga cagtgaacct ttgagagctc accagagcgg    332640
     ccctgataat catgcactac cgtccgtgct ccacgcaaag ccatggctta cacactattc    332700
     ctggccccgt cgcttcgagc aatgcagcac gccctaggtg gaagattgca aaccaagata    332760
     gcgggtcaac aacagggtgc gtccatccac ttgcgagctt cgttgcatag aaccctgaga    332820
     cttccattta catgccaagg tttgtgagat atagcgccta ctgctgcgcc gggtctgatt    332880
     atttgtgcca agccttttgg gccaaactga tctccttgga acacctttca ggagtaaacc    332940
     tacgattgag agactacagt gtaattgtag ggactcacgg gctttgattt ccctctatga    333000
     acagacttac cctgtctctg cctttattga atattaaata gagtaatttt acacttctat    333060
     gccaacacaa gaacactgat gctgttatcg gccagcggtc atttagtagt gccgcggctg    333120
     aaggcaccaa ccagaagtct ggtagcgtca cttactgccg ccccgtgagc atgcgctcga    333180
     ctaggtagag gcatctatgg atcgatttct tcttactcaa ttgctttgcg cttggtttgt    333240
     acttggtttg tacttgttgg agcacctgtt tttgatggat gttctgttat cctgatacgc    333300
     actactcatg cattagggtt agacctgtat ctatattact ggattactat cgtcattttc    333360
     acgaaatacg gcgaccactt gctggagggt ttcttctaaa cgatttagcg tatttgtggt    333420
     tggcggtggt taaatatgtt gtagttcaga ggtatgaatt gtgttgttat tccagaggga    333480
     tacatgagcc tatatataca gcaattaccc aaattgattt ctaatcaact tggtcgtctg    333540
     tatagacact tcggagctaa ttccgacggt gcggcttggt tcctgatctg caccagcctc    333600
     atatcacaac attccccctc aggatcgctt tgctggcaag gcgatactgg attaacgctg    333660
     tgcatgcaag cctcggtaaa accactcaaa aaaaaaacct tcgtgggaaa ataaagtgga    333720
     aagagcgcct gcgctgtcag gtttgttgcc tccgagtctc caaggcttcg attcctaaaa    333780
     gactacagaa cttggcaaaa gccgtaggtc ccaacggctt ggtgagaccg tctgcggcct    333840
     gttccccagt aggaacatat tgaagaccaa tctcgccagc attcagcact gctcgctgat    333900
     aacgaaattt cacgttgaaa tgtttggtcc gtttgtggaa ctcggggttg cgcgagaggg    333960
     caatagcgga ctggttgtca gccatgatgt tggtgaccgg ggaccgatac aggtgcgttt    334020
     ctgctaggaa ggtgcggagc cactgcagat gcagaatagc gttgtactgt ccgatgtatt    334080
     cggcgtgtgt cgtagacgtg gccacttccc cctgtctttt ggatgaccag gaaactggcg    334140
     cacctgcaag ttggaataca tagccagacg tcgagtacgc accgtcagtg acgacggagc    334200
     caccaaagtc ggcgtctgta tacccgacca gctgcccact gcggtaggta atgcgatgag    334260
     attgcgtggc tttgatgtag cgaagcaatc gctgcagagc gacttggtgg tgcgattgcg    334320
     gctgagccgt gaagcgactc aacatgccca acgcaaacgc aatatccggt cgcgtgccaa    334380
     ccatcagata catcaacgat ccaatggcgg tcgcaaaacg cgcttttgct tcctcgtccg    334440
     gaaactcctc gtctggacga tgattcagcc tttgtttggt attcataggc gtagacttcg    334500
     gctgacagct ctccatacca aagtcggaga gaaccttctg gatatactgg tgttggtgga    334560
     tagacacgga cccatcgatg tgatagtcga actggattcc gaggaacgat cgcggggtgc    334620
     ccagatcgtt cagtcggaac tctgcttgca aggctcgttg cacttggtcg atttcgtggg    334680
     tgtttgccgc agcgacgaga aagtcatcga catacacgca cacgacgcaa tctggtttgt    334740
     agaacacaca gttgtccgat tgggcctggt gaagccatga gaagccagga cgcggtggac    334800
     gcattggtac caaatccgcg gagcctgctt cagcccgtac agtgagcggc gcagtcggca    334860
     tacgtaccct ggctcttcga agccttgggg caactccata tagatagacg agtcgacgtc    334920
     tccatgaaga aatgcggtga tcgcatcgaa ttggtggagt ttccatccgc gcaacacggc    334980
     gctggctaca atgcagcgga cggagtccat tcgcgacaca gcagcaaacg tttcgtgata    335040
     gtcgatgcca tgtttctgcc ggtaaccttt gataaccaaa cgtgctttgc gcgttccgtt    335100
     ggctttggtc ttgaagaccc atttgcagcc aattacatga tctctggctg ggacgtcctc    335160
     tcgccgaatc ttttcccatg ttccgtgttc gagaagcgac gcatattctt tctggatggc    335220
     ggcccaccat tccagctggt ctgggcctga aacggcttcg tgaaaggtcg ccgggtcgac    335280
     ttgtctggcc ggagtggtat tcaatgtgcc tgccgagtac accttgccca gtgattccag    335340
     gagacgccgt gacggtcttc gtctgcgacc atagatcgaa tacccaaggt ccgatgtcaa    335400
     gtcggtttct tgttggcttg ggttggccaa tggaggtgtt tcctcttcac gatcagatgg    335460
     cgtttcctct cgctcattcg acggaggtaa tggcgatgca ggaggtgttg gcagcccgcc    335520
     cgacctcggc attgatggaa agacaggtga tggaggagca ttgtccggga ggtcgttgcc    335580
     tgtttccccc tcgatgagtg gcgccacagg ggttctttca tcgaactcga catcacggga    335640
     aaagactgtc tttccagaat gaacttcata cagcttgtac tggttcggtt cacagtagcc    335700
     tagcaatcgg cactcggatg atcggggtcc gagttttgct cgatgctctt tcgggatcaa    335760
     cacccaagcg cgggagccaa tccgtcgcag atgcagcagc gagggcggct tcccgtataa    335820
     tatctcgaac ggtctcttct tctgtaaaat tgatgctgga gcgcgcagct tcagatagac    335880
     taccgtttct aaaagctcgg tccaccagga aggaggaagt ctcgcatcgg acaggagcgt    335940
     gttgatccgc tcccggatag tgcgattcgt gcgttcggcc agtccattct gccctttgca    336000
     gtatggcggc gaggtgtcaa actcgactcc ctgggtctcg aggtgtgttc cgatcggcaa    336060
     gtattctctc ccgttgtcgg tgaggaacct cttgatctgg gcgccgaact ggcggtacac    336120
     ccacgcctca aatcgtcgga acttctggag cgcttcagct tccatctcat ggcataggcc    336180
     cacgagccac gagaataatc gtcagtaaag gtgatcacgt actggagcca tctttggcaa    336240
     tcggcatctc catgatgtcc gaatggatca tttcgaaaat ccttgttgaa tgcagacgtg    336300
     gccgtcttgc acgggagttt ctcttctgat gctgcttacc cgacatacac gctgggcact    336360
     gcggcgttgc cagcagctgc gcctgcgtca gcggtcggta cggaatgccg gtctgccgga    336420
     ggaccaccct caagtctccc cggttcagat gtcccatccg agcgtgccac aacgcttcgg    336480
     aggcctggtc cactcctttg cacgcatctt cttcgagtat cacagcttca ccaccgagtt    336540
     cagaggttga cgttgcgcat cctgcgtcac ttgactcctg agggtcgtcg acgtccatgg    336600
     ccaccgcctg cggttccagg gaatctgcgt ggtcatgggt cgccggcgcc ctcgccagtt    336660
     ggactcgctc tcgagatctt ctgctcacat ggcaccgcag gatcaacaga tcctcctccg    336720
     cgtggtaggc ggtccccact gtccgtcctc ggcgttgcac aaagacgttc tgcgggtgcg    336780
     ccaccaccga gtagcggtct cgcaataact tcggtacact gatcaggttc atcccgacgc    336840
     gtggcgcgaa gtatacattc ttcaacacca ggggttggtt gaacttcccc cggagcgtga    336900
     gcttcaccgt accaatccct tcggcttcca ctggatcgcc cgccgtgtcc agcatctcgc    336960
     ggtggggccg cagactgctg aagcagctcc ggtcccagca gatgtggctg gtggcggccg    337020
     agtccaggat ccaccggggt tgcggtgcgt gggtataaag ggtcgtcacc ctcgccctca    337080
     cgatattgat cctcggtctc ttggaagtcg gcgggccctg ccgatcttct ctctggctta    337140
     acggtatatt ttgcatgttg tttcttggtg agccggaatt actccgttca gccttcaggg    337200
     catggtccct aggcgggtgt ttttcgcgct gtttcttcca gcactccgcg accacatggc    337260
     cgcgcttctt gcagtaggta cacttcttgg gatctctctg cactgcattg attgacggtc    337320
     ctgggactcc ctgcgggggc gcgggagact cctttcgtcg gaccgtctgt tcggcgttgg    337380
     aaagccgatt tccgatcgtg gtcgggttga ccggatcctt gtcattctgg atcgcatcca    337440
     caaccaggat gtactccggt ccgatctgcg tcagcaagat cgcgatgtgt gcccgatcgc    337500
     caatcgatcc gggcgcgatg gcattcaatc gatgtacaag cagccgtaca cgatcgacga    337560
     attcgcgcgc actgccgcag cgctcgccgg ttgtctcgcg gagttgagca aacagttcgc    337620
     agaaagtggc gagttccatt cgccggtatc gttcttcaag ttcattccag aggtcacggg    337680
     acgtctccag tcccgcgaca tgaacgctga tgtgggggga caggtaccgg aaaatggtgt    337740
     ggtaggcctc ggcttcacga cgcgaccatt cacgatggcg ctcgaatgcc tggacctcca    337800
     cttcgaggcg cgcttcaatg gctcgctgtc tcaccgcccc attgaggtgg ggctccacca    337860
     aggggtggat gtccgccgta atgggtttgg cgtacttgaa tagacagtcg ggacgctgaa    337920
     ggtcgcccga cactacatcc cagacctgcc tggctttcag gtaggaggtc atgagacgtt    337980
     tccaggtcgc gaagttatca cttcccgtcg aaggctcgat ggccgtgacg gctcggtcgg    338040
     gcgagtcatg gaccagagca gacatcgtgt ggatagtgaa agcggggtag atatataatc    338100
     aagatgatca agatgattct cggatgagta gaaacggcac ccgagatttt gctcccgggc    338160
     tcataacctg ttgtaattca gaggtattta ttgttgattt attcagaggg aaacatgagg    338220
     ctatatatac atcacaaagt ccaatttgat ttccacttgg ttctttgtat agacacctcg    338280
     gggtttattc cgatggtgcg gcttggttcc tgatctgcac cagcctcata tcacaataat    338340
     ttaagacacc atcaatcgct catagatagt ccatccaatt tgtcacctgg tcgaccttca    338400
     taaataactg cagcaaacct atccacattg aataaaactt gaggagaaaa ggcacataag    338460
     cctctcaagt ctgtccaaag gggctattta gtagttatgt cttcatatat tgaaaatgcg    338520
     actatacaaa ccatgcaaac taatatttca tgcctaaggc cacatacaga tgtcggaata    338580
     gatgcattgg cataccggca taccggagga tccattgatc ctatgcattt tgtaatttta    338640
     gattagtaat tggcggccca taagttataa atcgttagga aagtcgatac agcaatacgg    338700
     agagttgaac accattgatt ggacccctac attttacaat acggcccacg ccgacaacag    338760
     atgactggac cagaactctc tctccatttt cctctcacgt gataggatat gtttattaag    338820
     cattgcccga caatatctcg ggcacccaaa gcaaggtctc gttatatcta ccccgccata    338880
     aatgctggcg ctcgtcagct acgtaaccac tctgtctcct gagtaagctt cccatatgat    338940
     tgcggctgac cttcaatata ttctgacagc caaaattaca gctcatctct atccttacaa    339000
     tgcctcccac gacgataaat cagaatgccc tctcgcgctt aacggaactc tcggcatggg    339060
     tctccgaaac gaacgaattc aaggcggagc aggaaaatct attcagatgc tcagatgaag    339120
     gccgccatgt gagagttgat cctttgttgg gggaactggg gttcaataaa atcaaggtaa    339180
     atcattatac cgcttgcctg aaacttttcc ctaacattcg tagggatacg ggtattccat    339240
     ctggcggatt acgggaaaga tcgctttgaa ggccactcgt cattaccagt ctctattctt    339300
     tcctttatcg atcaagtccg ggtctggtag tgcggccggg gaggtgcaag ctgcaggcga    339360
     ggtgcttaca ccgggtagct atatttcatt ctctagtccg ctgactctcg acagtcagtt    339420
     ggattgttta attgtctatt tacccaagac ggacgactca tccgtcgctg agtaatgaaa    339480
     tgtaaattgg catcccctca aatcatgtat gtactagtac cttctacata tgacctcaag    339540
     catcagataa aattaactat cgtattcgtt accttgtata taccatcaga aggtttgttt    339600
     taatttccag ccaagggaaa tggcaatgtt tccgcgagtt ttgaacttca caccgtgcat    339660
     gctctggcaa atttgacatg ccaggaactg cagaataggc tcgctgtcgc ccagaaggat    339720
     attcagacaa acgctctgaa gtatcgctat gcgacggagc ttgtcagatt tggaaggtga    339780
     ctggaagggg acatgaaatc ggccaaattc ccctgacgag aaccaggcgt ggcaacggaa    339840
     tctgtcgaac acttccctgg ttctcccgtg acggcgaagt tgacagagca gccttttggc    339900
     gtgtcatgac tatcttcagc tggcaaagat cctgctggca gagcattgaa cgactcatga    339960
     gggaagtcac tggcagggga ggtgtctgct atgtaagaag gctggctgga ctcgggcaga    340020
     ttgggtaaac ccctgaaact tccatggggg aagtcactgg ccggaaaagg ctctgctggg    340080
     aaaggagggt tgggtagatc attgaacaca tcttggggga agtcactggc tgggaagggg    340140
     tctgctaggt atgaaggctg gccggactca ggcaggctgg gtagatccct gaatattcca    340200
     tgggggaagt cactggccgg gaaagggtct gctgggaaag aatggttggg tagatcattg    340260
     aacacatctt gggggaagtc actggctggg aaggggtctg ctaggtatga aggctggccg    340320
     gactcaggca ggctgggtag atccctgaat attccatggg ggaagtcact ggccgggaaa    340380
     gggtctgctg ggaaagaatg gttgggtaga tcattgaaca catcttgggg gaagtcactg    340440
     gctgggaaag ggtctgctag gtatgaaggc tggccggact caggcaggtc gggtaaatcc    340500
     ctgaatattc catgggggaa gtcactggcc gggaaagggt ctgctgggaa agaatggttg    340560
     ggtagatcat tgaacacatc ttgggggaag tcactggctg ggaaagggtc tgctaggtat    340620
     gaaggctggc cggactcagg caggtcgggt aaatccctga atattccatg ggggaagtca    340680
     ctggccggga aagggtctgc tgggaaagaa tggttgggta gatcattgaa cacatcttgg    340740
     gggaagtcac tggctgggaa agggtctgct aggtatgaag gctggccgga ctcaggcagg    340800
     ttgggtaaat ccctgaatat tccatggggg aagtcactgg ccgggaaagg gtctgctagg    340860
     tatgaaggct ggccggactc aggcaggttg ggtagatccc tgaatattcc atgggggaag    340920
     tcactggctg ggaaagggtc tgctgggcaa gacgggttgg gtagatcatt gaaaacgtct    340980
     tgggggaagc cactagccag ggagggggct gctaaggcag aaaaggtgct gtttgcccgg    341040
     gggcttgtat ggctagatga tgccaaactt gcttgaagat cagatgatag cgaccggtgg    341100
     ctctgtggag ttctggggct caagctagtg gcctcatcga atatcgcatt gttttgctcc    341160
     gaattttgtt ggatgccgcg atttttgcca cttctttgta tcaaatgctg ggtccttggt    341220
     cgcagcgtgt tgtcgtcgca atctagaaaa tgtcatttac tggtaacata cgaagttgga    341280
     catagactta cctggcttgt tatgttggcc ttgacatcgc cttttagaat gccttgattg    341340
     ctccgatgtg ctcggtcttt tattatcata aggttttaat gcctcgttga acaagggccg    341400
     atatgaattc acgtcagtcc agctgtatcc caggcattcg caaattactt tcagcctgtg    341460
     attagtcagt catgctttta gaatcgtaaa taggtaacaa cgaggggctc acgaagtggt    341520
     gtctttgaac agcctttcta agatcagagg tatcacgaga ggggctgctt cgtctgtgat    341580
     tccatgtccg gaagagtcat tgacaatatc ccttattctc ttcaaaagta atccctcggt    341640
     ctcggtagaa tactcggcga atcgaccgta gaaggtaact gggcgctccg cttcttggat    341700
     ttagcagatg caacgagcgt gataggatta tctgacttac cagcgaaaat aacactccag    341760
     cttctagatg cccatttagt ctggcttagt agagatatag cacgatttgc ccacttcgca    341820
     ccacaaacaa gtttgctcaa atgctttgac tgagcattag atccacggaa agctcgcata    341880
     acttcgtaca cttggtcctt ctctttatgg attctcaatg caacagcaca tgatgaaaca    341940
     aagacgagct ctcgaaagta ggcgattttc cgatccaagc tgctatccct cgccgtgaaa    342000
     tgtgcgtatt gatgtaggat tggtattata ttgacaggct cagccgacgt gcacgattgc    342060
     gcttcagatt ggtcatttga cgagatacag gtcgacgcag ccgacctgca gtctcggacc    342120
     aattcccgaa gaatgatctt gcgtcgagct tcgtcaatag gggacgtcca atctttcaaa    342180
     gaaggtaagt ccgtaagaaa cgaggtgaat tcagatttca ccctaagctg ttgcccacca    342240
     ccttgattca gagagggccc ggcgcgtttc gaatccttac tgagcgggtt gtattcaatg    342300
     attttcaatc ctgtccggtc attatccgca tcttcagctt cgtggttgtg atcctcatca    342360
     ccacgacttg gtgaagcctc caattcgggt tgcgtccgat caccccgtcc ttgcccgtcg    342420
     aaagtgccgg aatcaccgct tctatggtac ctcgcacctg cgaaatcttt tcctcgattg    342480
     ctgacaaaat tgtcttggcc tcgtaaagga tgaagggttt cgatacgggc atcttgtcga    342540
     gaaaggcggt gaagactagt ctcaagttca aagatcctat cctcgaggta ccaaatatat    342600
     gcggcatcat caccctcaaa tccaaatcgc cgggaacagg gcatagttgc ctaggtgtcc    342660
     atcgacgaag aacgaagaac cactggataa tttttttccc tctcctcgcc ccccagatat    342720
     ggacgttgac gcggcgcgag ccacaagcca atcaaattac aagatgcaca tgaaatgacc    342780
     cgtgctgcgc catgcctgca gtctcatcac gccgatgcgt ctgatgtgag accaacgcgc    342840
     ttgcacgtct tcatccttgt attagaatgg atttgtctcg ccttttctaa atcaaatccc    342900
     cttcttagta tcctgcagtc gtcattgcca cttcctttgt gatatgttca gtttcgctct    342960
     ttaatttgtt taccatctaa aaccaagacg gcctaccagt tcttgaagca agctctaccc    343020
     ctatcaccca gccatatcat ctgcccagta tgtcagacta acagccatgc tgaatacacc    343080
     agattggacc tcaaaatgga tgttgcccgt cgtggtcatc caacgctcat ccccgcaaag    343140
     caacgctagt ctgatttggc tccccccaat gggcgaccct aacctggtaa ttgatcgtcg    343200
     ctatcccatc ccttcatcat ttttctcctt tttgtttttg gcaagtatct ttggcaccag    343260
     tctgccaaca aaattgaaca gccacacctg agtatgagtc cgtgtgcaac aggatcctcc    343320
     atccttccat gatttcccat tctcatgcat tttgcatcca tccatccgcc cacatatatg    343380
     tctatctcca cacaattgtg atttattcaa ttcgtcttaa tgtccccagt catcagtccg    343440
     aatttatctg ccgcgaggaa ctctttggca agaaaaatgt cgtctcttac ttctggacat    343500
     gttcttcgag gcgcttgttg gaactaccgc gttctggaac ctgttaaagg agataacaca    343560
     cacatctcca ccgtttttaa ggcccagatt gttgcacgtg actcccgcgt cgtccccgaa    343620
     gtccccgaat ggttcgttgc attaaccata tccagactct ttaagcctaa ctctgccata    343680
     tagggctttg atcaaagtag cgtcgcctag tgatcaaaat gccaccaaga acttgcaacg    343740
     tgaagttctg acttatcgtc ttcctgatgt cgcctcggcg aagtgcttcc ggaaaatgta    343800
     tgatgtaatc gacgacagca ccatcgcttt ggaatggttg gatactactc tcgcagaggt    343860
     ggaataccat cctgacatcc ggacctactc cctcattggg acttttttaa gagcagcgtt    343920
     cacaggttgt gtggttctgg agaaccacag acatgtgaat acaggtagaa tctcttgtct    343980
     tgaagaactg gcatttacta attactccag actataaacc tgccaatatc ctactttctg    344040
     gcatccggac agatcgtgca atcgctaaag tgggagactt ggggctcggt gagcaagcat    344100
     tgatgtacga gacatacctt ctaataacac tcttatagtt gtcccggtcg gcgaactttt    344160
     taacgcccaa ccgtatgcta tgcgcgcccc tgaagtcttc ataggcaatg cgtgcactga    344220
     accatcgcaa gtctgggccg ttgctgcgat gttactttgc tggatcaagc ctggtgtatt    344280
     gggcgtatgg gacagccctc atcctttgat taacgaggct tggtctatgg caaagataca    344340
     gcggctcttc ccccactggg agatcccacc tcctgaaatg gtgaatggcg atatcctcaa    344400
     agttgcagta aattctgccc gatctttatg taaagagatg ccagagctac tagcgatctt    344460
     acctttcgac gaggagacac aaaaggtgga gatgccgcag cagttaagag atcttcttcg    344520
     ttttatcctg gtacctgatc caaaggcaag gccttccgcc tcatctgttc ttgcgtcgag    344580
     ggaatttcga aggtttgaaa actacgtgga cgtgtaatct aaccaaaatg ggggatcgtg    344640
     tcttgccata gtggagaata gtgaataagt caaatctgaa tttgcagcgt ctcacacgga    344700
     acgatttcgt ttccctttcc cctgctgttt ccttgctgct gctgctgccg tacctagtcg    344760
     tcttagccta ccaccatgcc attcaagcct tcagaggtgc ggtcatccgc ctgctctttc    344820
     ttagtacgat aaccgaaatg aatgccgtag gagatcttcc aatgaaagag gggatcctcc    344880
     aactttacgg cgattgctgg gttttccaac gagacggcct gctttcagaa aagaaaatac    344940
     cagaccctgc aactcaatag aaaatttgga tagatcgcgc atgccttttg agccagtaat    345000
     gctgggccat gcctcagccc ttcaaagccg accaatcaga atgagccccg ctggctttac    345060
     aaaggcaaag ctcatttctg ttttggctat attcgaacag gataactcgg cgtgaatgac    345120
     ttggaaccta gtggctttga tcaagagggt cagatcaaac aggcagcaaa gatcgtcccg    345180
     tcgaaaaacc aattcccaaa gagatgaagc ggtctcgttg gattgaggta ggaacctatg    345240
     acagtggaat atataaaggg ggcagcttct cgaagttgat acaaattcgt tggctctgtc    345300
     acttccatac ctactcgtgt atatttcaat tatccgactt cgatcacaaa ctcaagatgg    345360
     ctctaatcgg tcatgtcttc aacagagttc tcaacaagta tatcccggtc tatatcgccg    345420
     aatccgggaa cggattcatt cgcttgactg cctacatcga ccaaaaggtc aaggacgcgg    345480
     cttttgctac agttaaggcg ccctttgaaa acggcaagct gttcaaggac gatgacatga    345540
     agcagatgga gcaactctca atcacgtgag tgactaattc agtcaatcta cgctatcttg    345600
     attaaccatc accagcaaca tgtctcatag tagccttggt gataccaacg ctcactattc    345660
     tgttcagggt gagaccggcg ccggtagcaa ggtcaaaggc aatcacgctc aggaggacca    345720
     gtcaaagcag actgtaattc cagccccacc acttcacgtt gggattaacg ctcagctaat    345780
     cccgtctcta tagcgagcta attaagtatc tgccttgcag catcgagtta tgcacgagga    345840
     ttcgcgaagc atgcctgggg ccgcggaata ttgcttgtta ctttcaggag tgtgactgtc    345900
     acgaggaggt cgaagcatat ctatccaact gttgtcattc tctagctata tggtattgat    345960
     aattatgaat tagtattggg gttctcggct caatgtaaca aagcctgaga ggaaataccc    346020
     aactctagat ttggatcaga cttcatattt gtcttccgtg taattcgtgg ctggttggag    346080
     gatgtaccga gtttttaaaa tggggctgtg gaacatatag cggcaaacgc gtaacatcac    346140
     gtagaaaaag tctttattgc gcagagtgta gctttaactc aacccacaaa gataaaaatt    346200
     agcccagaca acgaagctaa accagtggtt cacgatcata tcgtgtagca aagcgagcac    346260
     tccctttctt cgctccagat ctcaatgtgc gcctgtcaga gcatatcatg gacctgttta    346320
     gttcacaaac atctactgct ccggaactct ttcaattcgt tgtctttgtc gattatctat    346380
     ctgagcacat cctagcatcg ttgcctagct cggggatgtg tataatcgat tacgagaacc    346440
     gtcaatgccg cttacagtcc acaggaaggt tcgcgaggat gacttaaccc ttatccgata    346500
     atatagcatt gacctaaata taaagatatc aatgcttata tcccacagag ctggttgata    346560
     ttcaagctcg attgaggccc tattggtggc agcataagct cctctgcttc tggaatgact    346620
     actccgccta tattatatac attttgtacc ctgggtctgg actgaagaaa aatcattgtt    346680
     caattaatat accgctgtac gattgatctt taataatatc taccatcaat acaaccattc    346740
     caattaacag aacgcgggta agcttgacgt tgaaccttgc ggagggaatg agtcagatga    346800
     tagtacagag ctaccttccg caactagcat cttgtcggag ctaactagct gaacttctag    346860
     tctgcatttt accattatag gcgaggatgt cgatgcggtg ttattggagc gcccgctcga    346920
     agctctccca ctcctgtcat tccaaggcat cgctaaagct gtgcatgaac tgccagatat    346980
     gaacgcccat tgagacatat ttcaatcaga aacctcgttc actttcgttg aaggtctcag    347040
     aaactcgata aacagaacat cgtagaactc acatccacca aaaagagaag ttcgaaaaat    347100
     tcaaataaaa tacaataaaa gggtgtatct tcatgatcac aagttcgaaa ttgagtgttg    347160
     ataacggttg gccaagcttc aaggggttga cgggtcgggc acccgcacat cgtaccgtga    347220
     cctcctcgct ttctgcagtc tagacggaca gacccagcta atacaaccaa cacaacacta    347280
     caggcaaggg aaaataaaag agaccacgat ttctagaaac gagattgtaa gcgcttttcg    347340
     gtaactcaac gttgaatcgc tcacaggtga ggtgatcggg acaaggaata caggcctgtc    347400
     attgcagatt aaatatctcc cacaaagact taagttaaga gggccattaa ggattccaca    347460
     gtcagccaac gttgcttgac tggctcagca tccctttttc ccaacaccac tcttactcgc    347520
     ctctctcgct gagcatccaa ggaatcaaaa tgtcaccaca aattgttgtg gcaaaaagaa    347580
     gccatgggtc tcaacaggcc tcaataaaag gtgtgttcct caacgcttcc taccggtgtg    347640
     agtgacagaa gccgagaagc ctacaaatac gtcctctacc ccggcaattt gctctacgat    347700
     ttattcactt gactctgcga agtcaagcag gcttgtgtct gaggcacttg ataagttctt    347760
     acccttcgac tcagtactgg aatttgtact gtactgacat ttatagaata caacatggac    347820
     cagcaagcca gacagtgcct gtgaaatact gtagtggagt ttatgttcca catagaaaat    347880
     gaaaaataag agagaaagat aggaaagcct tgtgaccgct ggtcatgtga taatcggctt    347940
     tccgtcttgg gtaagccctt gcggactagc aacggggcaa taaatccagc cagctgtgta    348000
     acgttatgga tcacatgggg cgcttagtat atctgtcacg ctgcatttac ttaaatctgg    348060
     atagataccc cgtgctttac tgatagccat tgtcgtagag gtcgagaacg atcttccttc    348120
     cactttcccc tgtcatattt gtggtcctgc caatatgcac tatcccgtgt tgtatacgtg    348180
     cacgaatata ctcactctcc tctcagttct atcacctttt caagggtctc acattcaatt    348240
     ccgagttcac atacatgttg tgtgaggcct tttattgaga agtttgtgac tttccagaga    348300
     gctttccaca atcggcctaa taggtagggg tggatttcca gttgggcaaa gtggtcagcc    348360
     acaacttact tgatcaggaa acccgcaatg gggggttctg aatgaggtta agtgggttgt    348420
     ggctaacaaa aatagaccga tttggaatcc cacagtgagg ggctctaaat ttggcttagt    348480
     gttaaaattt cacaattgtc ggatatagct aactgtagac ctttcgtagt gtcaaatggg    348540
     taagcaagcc tattatttct gatcttattg agaaagaata cctatagctt tcccactgta    348600
     attgagcccc gcagcttttg ccgagcaacc tggtggcctt ggcagagcta aataatcaga    348660
     aaattgtaca tgtactaatg aatcatggtg gtgtatttaa ccagattcta tttttgcccc    348720
     acaggccaaa cgcagataaa tggacgggat aagttagcgt ccccgaaata tcgggtctct    348780
     ttgacaacgc gcgcgtagta ctcgtagtac aggcccggaa caggtaatcg gcccccattg    348840
     ttgctgcatt gacttactgt atgggcgttt taactcgtat atcgcaatat catggaatat    348900
     attgtatggc ccccaagcaa tataaattat tgcaaatatc tacttcttgg tatgtacgcc    348960
     tgctacgtcc tgcgagcaag tatggagaag ctcctctctg cagcaattac atatctcata    349020
     gtcttgaaat tagaagtaag atctcttttc cccgccgagg gaattactgt actaatcact    349080
     tgaccagcca tgggacgtgt tacacatccg ggagcaacat gcaaacatgg tgacagtagg    349140
     agcaacggga tggaagctag aaatctccct cgacgaaatg aaaagctcga tatctgggtg    349200
     cgcatttctg cttgaccatg gaggatattt ttggtgcata atccgtcaca ccctgcagca    349260
     ttggaggaat ccagagtgga ggcctctatc cggagccgac ggcttgcgag ttggcagtaa    349320
     aacccaaaaa ggaatactgc atctatgtcc tgttttttat ggggatactt ccgctttagt    349380
     tccattctcc atgctggaaa tgacgacacc tggtcgaata atgatttggc tggcggagaa    349440
     ccaggtgacc cagtacacgc tcaagctcaa ggccaaacta ctccttcaaa tcatcaaggc    349500
     gggtttgatc ggaaattgga agttttctcg acgtttgatc ctcgacatcg ccatttgtgg    349560
     gcaacgggtg atgttgattg tgattgtcat aaccatgagg ctggtaaaca ccatgtggga    349620
     acgaagattc gcaaactcct tcgagcctct cgagtgattg tacgcattat tcttgtttct    349680
     tttttactgg tcagaatctt tccttttgta aattggatcg ccgataacac cctccaatct    349740
     tctatatcat acacaaaaat gattgtcact tggggcgaaa taatactaca atacaactct    349800
     actgcttaaa aaaggcaaag gggcattcag ctgaggtctg gataatctat tatgtggaat    349860
     gtataatact tctaaccctt cctaatcaaa tattaccaat cacgtttgta ttcgaacaaa    349920
     atctacctct ctcagcagtt attaattcag ccaggcactc ttggtctcga cttacgacgg    349980
     tagttcattt tgcaagtcta ggtatttgat ggcaacaatc cagcatgtgt aatacaggaa    350040
     attatgcaat acttgcatgg tggaatctta ttcctggagg aacatccagt gctgtgcgtt    350100
     gtggatttgc taccaaaagt ataagtacac caaaagtgca ccatattcga cgatatccat    350160
     catgtgcgac caggagctgg aaagcctttc gctcggtgtt tgcatatacc atttctttaa    350220
     ttctttattc aaatattctg ttttgcgtaa taacttgtcg ccacgcccga gaaggctgct    350280
     ctacgtatgt ttacctcggg cttttggtta taaggcttac agttgttaat gaagagtaac    350340
     atataaggtg cagtcctgtc gctcggcagt ccttacacct tgcccccccg accaagacca    350400
     tacggtatcc tagcgagaca aacatggacc gaagcactct gtttattatg gcgggatgta    350460
     cattggattg gcttcaaaac caacaggtat gaagccttga tgataatttt tcacatctga    350520
     caaatccagg cacgcctagg agtagtctgg aaatttcatc tggtttataa aattgcgaat    350580
     agaaaaatac agcaatgggg ttctacatgc gaaggggctg ttataagtgg aatggagata    350640
     tccgaaacag tgcgaatgtt cgatgggaag gcacaggtga cgcaaagtgc tcagattgtg    350700
     aatagtatca cttgaatatg tcaaacttga caaaatttcc ttgcgatatt tactacaatg    350760
     agaggtcaaa ggcacaatat agatgaagcg gccacagagc tgaatccagt ttactatgag    350820
     attagtccgc gcaatcttgg catgagccct aaatgaccag atggtgattg gtacgcgcag    350880
     ttctcgcatt gggttagtat tagtattgta ttatatcatt agtatatgag gatccttgca    350940
     caaccaacta gaagtagtct agtgtgatat ctattggaat acgctcggcc ctcttctagc    351000
     tagaaaaagt ataactcgac tgagatgagt gaatggatct agcaaaaggt gtatgtactc    351060
     aacatgaaaa tttttttgga tacaatgaca cggattgacc aaagaatgcc ttggacgtat    351120
     aataacacat acggtacaag cgggcccaag aatctgggcc ctcctccacc aaggcaatga    351180
     tgaaatgcaa gctccggtcg ggagaaagtg atgagaatac ttattaccag cctctgccgt    351240
     cgaaaaggat aagacccaaa attgtacaga ccctgggacc tgggtaatcc ttctcaattc    351300
     attccatcgt ctttgctttc ctcgatgcct ccacatcatc aatctgagtc tgccgtgcga    351360
     acccgcgctc gtacagcatg ccagtcttgt cgcaaaacca gaactcgctg cattggggga    351420
     cctccgtgtg agaattgtgt tcgacttaga aaggaaaatt gtgaatttgt gcacaccccg    351480
     tccagcaaga aacttgttac accggagcca aggcctgtcc gcgatgcatg cctcccatgc    351540
     tgcatggaaa aagctctttg caatggggga ccacgttgcg agaactgcgt tgcggaggga    351600
     agagaagtct gcgcattcga tctggaatct cacaaggagg ttcgtccaag aaaaagacgc    351660
     acatgggcct gcctgccgtg ccgcttacgg aaaattcgtt gcactggcgg agggcctcct    351720
     tgtggaacat gtactagtcg tggggttgaa agtacgtgcg agtttattga aacaacaaaa    351780
     gacgaccccg aagacacgag aatgcataca attcaaggcc aatccaatgg caatagcgag    351840
     tcatcccgga atgctgttat ggaggcaggg acaatccaac agccggacag caccctcgac    351900
     gaaaggcccg agaataggcc atcacccaac actttcactg ctcttgacac gagacaagta    351960
     tgccgcaaga aatcactcag ctgtagtgag acgctttcca ccatcagcaa tgcgaatccc    352020
     ctgtcagact tgagcaaaag cccaagtctg gatggcagtg attcagacaa gggggctcat    352080
     ctagcttcat tgataggctg ctcttcacat ggggaactac ttgacgtcct cccaaactgt    352140
     cagatggtcg attacttaat agaaagatac tttgaatcta tttccacggt aaagttggtc    352200
     taccaaacat tttgaggttg attactaaca acaaggtagc tattttgtgt catcaatgcc    352260
     accagcttca aagctgagta cgaggtattc tgccgcaatc ctaacgtcac gcctaaatcc    352320
     tggctatccc tgctttttgc agtcctagca ctatcttgcc gtgcagaaga agatcccgag    352380
     aggggctgtt gttctgaccg tctgtcgacg ttgtacgaga aagccgcctg ggactgtttg    352440
     ttgaccaacg acccaccgtt tgaaccatca cccacttcac tcaaagcaat catactcata    352500
     atctatggtc gcacacaccg tggagccgat gtattcagta acctccaact ggcttatcat    352560
     acggcaggtt ctaccaaatg ccatatcgat accacgcaat gtgttgtcga gcccatggtc    352620
     tgcgaggaat atcgacagct tttgattggc ctgaaaatgc ttttccttct caatgcccaa    352680
     gtgcacgact actaccgcaa ccgggatatc acacaaggta tagagcgacg agctgatatc    352740
     tacaagtcca ctgaaagacc acacctacca ataagtgtcg aaggatcacc taccacgcag    352800
     atgactttca caatcctgaa tttgcaactt ttggaaatat cagacaaaat ctgcgtgagc    352860
     gcagagcgtg gtttgatgtc agaatggagc ctcactgggc ttgagactga gttattccgc    352920
     ataaaggaac agtgcagcga gatttacacc aaagtcagtg aatctgactc gcagcttgga    352980
     tctcacccag ggagccaggg tatactgcac tgctatatca actatctgct tcatcttctc    353040
     ttcctgcctg atctccagcg atacctaaat ggggacatcg catctgggac aataatatct    353100
     cagtcgaagt gcattgcctt tgcaaaggcc tcattacagt gtttcaactt tttggctgag    353160
     gacatacagt ccaaatccta tggatggtat atccgaggtc tcgaagttac tatgctgagc    353220
     agtcagcata tactctcatc agaagtcgtg cagggctaca ggaaaatgac caataccaag    353280
     aggtcaggtc tatactgaaa cgtacgttgg aagtattttc tgcattctcg gaccgcagca    353340
     tattctctac aagaggagcg tttgttattg agaatcaatg tatgtctcgg tcatccaaag    353400
     ctatttctcg agcatgcgta tctaacttca cttcaggatt ccatgcggaa cacttggggc    353460
     gaggggacgg tacgtgatct ggtcaaaatt actggtgaat aggccttttt gagttggtcc    353520
     aagttgaaat attcagtatc ttagtgtaat atagaagacc catttattgc tttataaaac    353580
     acttagtatt tcgcttgctt tcgaagccat caactttcga tctggtaaag cctacccttg    353640
     aaacttgtgt atcgcaaact tgtgtatcgc tttttataaa acgtccggag tcgcatgcat    353700
     tgatgtagaa tggaacggtt tcgtaatggg cccaatgggt ggatcctcca atggtcgtag    353760
     ccgaaaagct gcgagctaaa atcccgagct gactgtcttt ttaggcctgc atcgctcaat    353820
     atttacgtgt tagttcgata gtacctgaag aatgtgatat ttccccatgc gtagttgcgt    353880
     tcccatcttc ccatggaagg ctagtgcgac ccacgccata gactggctgt taagtcgcgg    353940
     cagtataaaa gaccacattt ccccaacatt gaaaggtggc ataggatcga tatcttccct    354000
     ttacagtggg aacgagacct acacctgctg ccaaattgga actaggcttc atttgggtag    354060
     tctctatttc tccgcaatat gacatccacc caagacatgt cgttcgatca caccatccca    354120
     tactcggcca tggaggttat gggttacagc aaactccaag ccagctcgcc gcctgagagt    354180
     atggtcagag aggtggaaag atctctccgg tcgcggccaa acgaagtgtc agagactgtc    354240
     acgtatggaa gaggggatca tgacgcatgc gaaagcttct tgagattcgg aatccaggat    354300
     catgacgtat gtctttcaat acagtggtcg atatatagaa ctaaaattat ggaagttcac    354360
     caggaagatc gaagaagtga tcgcaaggcc cgcttttctt ctccaccaag gcccagtcat    354420
     cgtccactct cccgatttcc caaccaactg gggaatcaat gccgcccatc cagtccgaaa    354480
     cggagtctca gttttccgaa ccctctcagg taacctggag gacagagtgg caatcctgaa    354540
     gctctacccg gtctcacacc acttgtcgag caccgaattc gcgcaggaaa gaggaacgcc    354600
     gatatcgttc tatttgcgac cgaacgaggt acttttcgtg cgaggtgcac ttaagatgga    354660
     gattaaactg cctgctggtg gattccttgt gtggcaagga ttttccaaag agccgtgggg    354720
     gatggatccg tcagcgcggg aagcctttgc ctttatgagg atctagtggg aactctcagg    354780
     ttgcttggtg attctgcacg tgctgagcag cgtatttctg tggggaaggc tttaggtaga    354840
     gaatataggc gggttggtcg tgttagctta ccgggataaa gtccatgaat gtattggtag    354900
     ttgaccctga ggcaagttag aagttgcgcc tgacgagtga cgtatgcaaa gtcactgctt    354960
     cgcagcatct ccattgttcg agcttcttca ccaatggaca gggaacggaa ggcggaaagg    355020
     acgggtaaca aaaggagcgt aattccatgt ccaaattcac gttcaaagcg catcagtctg    355080
     cgtccatgtt ggagtgcttt tatggtttta tgattgtcag gcatcccctc ttcttggata    355140
     aacgcagcca tggttccgaa gcgatggggc cctgagcatg gaataggttc attgcgtcca    355200
     gtccgctgta gccagtcttg ctcccacaaa gctaggttgg tccactggtg aatttcttgg    355260
     agtcgctgta tccagcactg agtgttcttt cctgtggcca agagctcagt ggctcgccga    355320
     gttcctcctc gttccaagtc accctctaag atggttgagg ttaagtcggc cttgagaaag    355380
     cgaatgaaca tatccagttg tggtgataaa tctgccagaa gcgtttccgc ggtagctggt    355440
     ggcatgatgg ttgctgggaa tgagcgacga cgcgtgcctg gaatcaattg gctaagagga    355500
     aagctctctg gaaacagtat aggtcagacc gcgccgcagg aattcaacct gagctttagg    355560
     cgctcgggtg gaattttcaa tgtcagcaca tctgactagt gcataacccc tggacacaaa    355620
     tgacacaata gtcgctgccc tatccatacc gcgattacag ctcaaacctt aattctatct    355680
     tggtgtcccg tttgcccatg ctggagtgga ctttctatct ttcggccaat cttccaactg    355740
     ccatgtatat tttacgattc caccaatgtt tcggtatctc aaaggtgtgg aacctggatc    355800
     ttccgttgtg accttgcgcg tgctaaaatt cggcgtagag aacaactgtc ttcaagaacg    355860
     tatcggagcc ctggatatgg gaagtagctc ctcttgacca atcatcttcg tcgcccgtag    355920
     gcccggcata ttatatccac aacgcgacta ttattaagat cttgtctttt cgaacacctg    355980
     tactcatgtg aaaaaggccg cttacagttg gccagatcgt cgtatttaac agatattttg    356040
     aaagtttcgc cgtgtacccg gtgttttatc agcactctgg ggtatgaaat ctgaaccata    356100
     ccctagaggg aatgtcccgg gcttccgcct gtaactgcgc cgccccgttc tcaggtgcca    356160
     gtaccccctg atcttccgcg gatgcaccgt actgacactg tgattgaatt ggcctgcagg    356220
     ggaaagtgct agctactggt tgatagcgta gggactcagg ttggaatcca ccgcctcttg    356280
     agtatcgagg gccagtggcc aatgatggcc aagccgtgct ccgcccaccc caggtgattg    356340
     tgcggtctaa tttaccagaa tctgctcata gccttagcac caaacaagac gtgaggcaga    356400
     gcctggaagg tgaaagaaag cgcatcctct atgtctagtg ctccttgcgt atccaggact    356460
     ccgactatga aggatgtaaa cctactgctt gggcacgttg taaattggtc ttccaccaaa    356520
     atggcacact ttctgtacgc caaagatgca ggcaatgcga aggctcagat caggaacctg    356580
     agatcagctg gaacaaccac atcggtgtgg atcaaagtcc tacacttagg agaccatttt    356640
     gctgatcttg ttttcggtgc catgtgcact gaccggtgca aactttcggt attcagcacc    356700
     agagaaactt caccaatcat caggttgttc attgttcctc catgagacat ggccttgtgt    356760
     caatcatgcc taatggagca aatcgggtga catccacaag cacactggaa acgtcaccac    356820
     taaaattgca gcagggcggt gcctatatcc acacaggcct ttttgctcga ttcaattggg    356880
     actatgttct cagggctgat ccctaagcaa cggtaaatta ccgttttacc aaaggcccac    356940
     acagggcctg gctctgtgta tcactatagc tcgtattcta gctcctggga tctagagcct    357000
     cacagagaac taccccttga aggatcgaga aacttggcac agcaggctgt ggcatagccc    357060
     gggcttcacc gggtggttga ctggactgac tttccttttc ttcgtctatt taatcgagac    357120
     cctacctctt ccattttcat tctatcaatc agatttacat ccacatttta tcacaatata    357180
     cagaagcggt tagtcttttg gtacaacttc tcgtcttgct gaaaagtcgg ggtagcagga    357240
     actatctaac atgctttcag aacgaagatt cacgtccaaa tttcccctta ggcgtcaagc    357300
     acagtcacag ctagggccat agcgggtctg attctgagac agcttgacga aaacccgaca    357360
     cccctgccaa atgacctcac gcttgctacc atcgacatct cgaaatgagg gggttactgg    357420
     aagtatcgat caaacaaagg ccgatatagc tactctcaga cagcaatacg caaagcttat    357480
     actgtgggaa aaaaagtgta tttggtttga caagaaacaa ccgcaatcca aaatccacat    357540
     acctttccac agatggcaag cccttctcgc catacacaag catttgcttc aagagcatga    357600
     acacttcttc tccatgtccc agatgccatc tgctagagct gctatcagag atgttcctta    357660
     cgactatgcc atgtttaaca gaatgtggcg ttatggaata tattcaccct tagagcttct    357720
     gcaccaaaac cttccaggat ctttgggccc catgctccat ttcatttacc acgtctcatc    357780
     aacgctgaac cgattcttag agttcgatcc agctcttggg gtgatattgt atgagcagct    357840
     gggtgatgtg acacgatatc atatggctgc gcaaagacag catcggaaac atctggcagg    357900
     catatcgcgg tattggtacc gaaaggctgc ggaccaaaat cccaatctcg gtagaatcca    357960
     acattctctt gcggttttgt cacactccga cgctcttcaa agactctttt atcttaccaa    358020
     atcattcgtt agtgtgcagc cactctgcca cagctgggcg accattgaca ttttcttcga    358080
     ccactggaag ggttttacct ttcaacgaga tatggccgct cactttgtga ttgcacaccg    358140
     tctcctactc gagaattgct cgggagaacg acttaaaggc attgacaaat gacttcctgt    358200
     cgctcttccc aatgcacatc caacgcccca ctagccgaaa tcaacatgag gtgtacataa    358260
     tgtcctgcaa catcgcctct gtacttggtt acggtacacc tgtataccca caggtggccg    358320
     atctgttttc caagaagcag agtaccggtg ctgcgaatga gtcggcaccg gcaatggaga    358380
     cagaatatgt aagcaatagc cctactgaat tgtgttcgca gctcaaactg aatcaagcat    358440
     tccaggcaat ccgcctcact tttcaaactc tcttcgttct tcttaggttc agtaacttcc    358500
     ccaatgcaat cccagggatt catatctctc tggcgttcct ctggcgcgtc tcctttcatc    358560
     gctccgttat ggaaggccta gaggccacgg ttccctggca agcagtcgct ggattcctaa    358620
     atagtctgtt ttcgcacaat actgttttct cgaggatcca agacgagaag ttcccaattg    358680
     gagaatatga aacagctcca cagctaccag aagacttttt gatacggggt caagcgtgga    358740
     gtcaattcta ttacccaaac aacttcttca aagatacctc agggtacggc atttcaatcg    358800
     atgaaaggga ttctgaggaa gtagtgagaa gacacaggtg cctctggcta ggagtgcaaa    358860
     tagcaaaggt cagttggcat cacttgggat atgattcatt tgagggagac agcacaggta    358920
     ctgacttgtc atacagtttg gtagctggat aacttacagt ccaacgagaa cgaggaggtt    358980
     cgaattagca catactttcg cggagagata tggccattga aggacgtgtc tgagctagtt    359040
     tactttatac gcgccaatgg aatgcgagtt atgctgcatt actttcaata tggggtcttc    359100
     ggagggaaat agatcatact tttagaccat agttgacttt tacataacca cgttttgctt    359160
     ttttgtatcg accactttcg tatacaagtg ctgatagagc caaacaatgt actgcagctt    359220
     ttaacgtctt tgagacggta caccgcaaac aagaatagaa ggcttctaga aaatgctgac    359280
     tagtgtcata ctttctttag gttgagcggc acccatatgg tgcatatggg ttcccctgaa    359340
     cgcgaggaag cctgcctctt ttgctttctc gcgctacatc ttgtttctag agtaaactag    359400
     agtaataaat tctgtggcga gctaggagtg tagcctgtcg ctccgctgag aggtgcatag    359460
     caatcagacg ggagcatgaa cgccttgaca acaatgttta ggtggggtta gaggatatct    359520
     ggtctagctc ctgggaacgc caaatctgtt cccggtagtg tgtcaatggc tccaggaggc    359580
     cgaatctatc ttggcaccca cttctcgcac ctagcgcata agcgccaatc acaacctaca    359640
     cacacttcaa tatgtataga gaaatctcgt aattgccgac tatgctacca acaagaatag    359700
     acatccctcg tgccaacgca tggtcatgac aacctacagc cacaagtgca cctgatttgg    359760
     gagcagtaat ctcgaatgat atcccttctc gcaggccact gactggggca tactgcatca    359820
     gaatgaattc atcgacacgt cgggaatttc aagggaggca ccttttccag gagccacgaa    359880
     gacacgtagg caaggaccct acgacgatgg catataaagc cgatgaagca acgctgcaaa    359940
     gatagtccaa caccaacaat ccgaaggatt tcctgccttt gacaaccacc tcagagacta    360000
     ctatgcattg gaacccattt gctttctgcg ggatccatca cggtggtcct gtgtcctgtt    360060
     gcggggtgac gaagaaaggc gagccgtgca aaaactccgt caaattccaa gacaccaaga    360120
     tcggccatga aaggttgacc actctcggca gagagccgtt tgatttgtca actttgcagc    360180
     caaagctcta tgatattgct agagtctttc tctgcgcgag atggcaccgt caacggcagg    360240
     ccgaccaggt tggccagcag tggtatggag cagccgtccg caaccaggcg cgagtgccac    360300
     gtggctctag ggttgccact ccatccattg tgtatccggg ccagcgtcag atgttttcag    360360
     cctccaggag acacctgacg ggatcagaca agacccaccg gtgcggctgt caaccaaccc    360420
     cgagccagtg cagccattca gtccatttgt gacttctgca atgctgcgga caaacagtat    360480
     ttcatggcat atatcgccgg ctcaaccagc gatcctgaca tcggtcgcta acgtctgggc    360540
     tggcgtccaa agcttgacgc tcaaggatct caccctgagt gacgagttcg acgacatcca    360600
     ctgtgtattt tgtctggccg aggatgatga ccttgcaaat gagagtgtga tcttgcactg    360660
     tcagtgcaag gcgctttccc acctggcctg cgcggaagag tgactggaaa agcgaagtac    360720
     aggttttagg acgtcatgct gtgtgtggta agtagggctg gttccaggta tgcaataccc    360780
     aagatgctga ttaatacagt cgaaatgaag ggcctttaga cgccttggtt cgcccaatac    360840
     gagtccaacc gtcggacgcc gagagagaac ttgccactat caggaagtca tcaccgaatg    360900
     acccgagtcg gagtcagctg cgacagcgct cagtgggacc ccaagggaga tcagtcgagc    360960
     agagtgtgga gaatggcccc cgtcgttcgg ctaggctagg agctcattta ccacaaggcc    361020
     cttctacgtc tgcaccaccc cgccggtcaa cacgactaaa ttccactcga aggtgatctt    361080
     agtttacagc agaggtgtga cgggaatgag aaattagcga agtgactgca atcacgcgtg    361140
     attccatatg accagccact cggcattggg accagcaaca tagagcatag cgacgcatta    361200
     ttccctgcac aagctcacaa cacttgtcac tgtgacaggt tgaaatatga gctggtagct    361260
     tgctatggag cgggggattc tagctttgag ggcgttctct gtagggcatg gtttagattt    361320
     tgtaccacac ttaatgacaa tgaaattgac caagaatagt tggtaataag cggcgaaccc    361380
     cagaatcaac ccccaaaaga catttctagg tcttgaccaa agtcaatttg attacagtat    361440
     gaaaaaatac tcgcagcaga agtattgcta tcgtgggtag gatgtggcgt gtttaggaac    361500
     ccatacccgg aaagagggta taaaatctga accataccgt atagggaaat cttccaatgt    361560
     gagccagaat cacacccctt tacgagctac agattccagt tcctcagatt tacataaccc    361620
     taattcattg agagttcgtt tcatgaacag caatggaagg caaatccggg tttcctggaa    361680
     agtatctaac ggtggccaac taccattgga cagcttggag gggattcgct tcatatcgag    361740
     ggtaatcctg cctgatccat tgaacttgcc gatcgtaaca tatatttgac tccaaaagtt    361800
     catatccctt gtgatggtcc ctcccagaat cctcaacccg actggctcca gcatccgcgt    361860
     tccattccgc accattctcg accatcccat aagacagcaa tcctaacttg agccccccaa    361920
     ccggatccac gggcccatac gtagaatctt ctacggagct taatgctctg aattactcat    361980
     attcagtctc ttctgccgca gaaatattcc aaaaactcgt ctcccctcat gtcgcggttc    362040
     gcaaacttgg cgcccgggct aatattgacg tggcccgcgc gaacgggggc cttctcttcc    362100
     gcgccatctt gcgtatttcg atcctataag gatgagtacc ttgacgggac aggtaaataa    362160
     tccgggaaac gttaacatac ggtgccgacg ccctcgccag gcgattcagg tcccccaaga    362220
     accggtgtac tgtccatctg cttcgcccgt tctctaggtt tgaacacggt cgatgcattc    362280
     ctgccgttca aacttgatcc gtcgtcgaag gtacaatggg atcgaacgta tggtggtgtg    362340
     gcctatgggc cttgccatta gaggtcgcat ttgtggaaag tattaatggg agctgtggaa    362400
     gtacctgaat tggttctgtg ctcgtcacct gatcaacctc agagattgga taagaatact    362460
     agcgatatca tcactcagta agtaactcta cacgactgac aatgatagat ctggcagggc    362520
     catactgtat gatcctgatt tggtagcgat tgcgcggtcc cttccccagg ttttggtgcc    362580
     tcccgatcgg agtgttgatt agtccgacga ggcaactctt tcttcaagta agtgatagcc    362640
     atgatatgga tagtgctctc tgaaacgaga atcgtctggg tattcagcgc tgataccgtt    362700
     caacggaaga aatatgaaga aggtggaggt gaaaggagac cagccccttt tggatccagt    362760
     ttagcactat aataatccac cggtgcaacg taataacatt gtcatgaaac tttcagtaaa    362820
     attactgggt gggcctatag ggaaagtgct agctgctggg gcgtcaatat gaccgttagc    362880
     gtaaaagact caggccgatg cccacgggcc ttccagctat cgggagccag tggccaataa    362940
     tggccaagcc atcatgcgct caccctaaat aaacgaatga tggatctaac gaataaattg    363000
     tatccatggt gcgattctaa acaagaaatg aggtggactc gggaaggtga aagcaacaat    363060
     cttcctacct gtggcattta ttgcgtatgc tagactccaa ccgtaagggt ggtacaccta    363120
     ccgcttgtac gcacacagaa acagctacta aactggccag gtcatagtgg gccaaggagg    363180
     tgggcaaaga gaaggttcag accaaaaact gaagtcggtc cgggtcacat cggaacaacg    363240
     acgtgaggca agagcgccta tcatgatcca ccagaccctt gcaagtctgg ttcctaggat    363300
     tcttccgcga ggtaaatgca gccaatgcgt gctcaaagtc ataagccaga tctgtgtcat    363360
     gcacaagaaa acagactacc ccttgggatc tgcgcgcgca ttctgccctc aaggcagcaa    363420
     gcaacctcat tcctactcat caagcctgct ccatgaacct ctttaagggt aactcaacct    363480
     catgagctac tgacatttta agttggttcg ttgttgcagc attatgtctc atgcgcgaaa    363540
     cccatttaat gtcactggct tcgtgttcac ggaagtccca acaaactatt ccattggccc    363600
     gacatacaat ccgctacctt cggagatagg ttcaggaagt tctctccatc cgagcgttcc    363660
     acaatcggaa agctggttaa caggatctgt gtcttcaacc gtcactccct ctccccggtc    363720
     aagttcgtca tatcgagaaa taagacctcg gccagcacca acattgcctc aaccggaaac    363780
     caaaaatgaa gaaaagcaac gagtccggag gcccaccaaa aagacacgtc gaagggtata    363840
     tgggcttact ggcacgccca accaaccacc ccggcgtaat gaaacgaggt ctgcatggat    363900
     ggttccccga acattcgtca catcggctaa gtaggctctt tcagcgcagc aaaaacaccg    363960
     gccatgacga gtcacgatac agccactcag gcccagggct ctcgctcatg caattaccct    364020
     ccatataatc aagaaagccc tccccaagct tccgtcgagg ctctccagaa agccttgaag    364080
     gctcaagtct tacactcact cagggttttg cgcaagattg ctatggacca ccacgcactt    364140
     aacctggtcc ctgagataat agatggttgg gtggcggaaa ttgaaggagt tgatgcaaaa    364200
     aatatcccaa ttgcatccag catggcggcg cagatgtctg ttccgttcga acgattcacc    364260
     attctcacga aatgcatcac agctacgggc ccgatgcaaa agcttactat caggcaccag    364320
     gcaaccgagt tgctgaaata tatattggct tatgcggagg agtactactt agtccagggt    364380
     tcgcaggtct atcttgatat tggtagatgg atagaaagac tcaccaagac aaacatgagg    364440
     aagtgaaatg ttattatcca gagggtctgg aatattccat cgctctttct ctggaattat    364500
     gtgtaggatg ttatcttctt cttgtaccag atctcttttc aatgttatgg gaatatgttc    364560
     tgtaatgtca catccgagag tcccagtgcc gctatcccgt attagaccga tgaaagcttc    364620
     tgtcctttcc ctgagatggg tgtcaaggga ctattccaat gttttaccga ttgctcacct    364680
     cggtacttcc atcgtccttt gcgacacaga atgaatatca tcatgtccag ctagtattat    364740
     tccagtgtta tgggtgtctt gttggttcca tcattgtggt cgctagctgg ttgggatgca    364800
     cgggtacgtt gggaagtttc ttgtaaacac cgatccctaa ggcctcctct gggctttggg    364860
     aactggagta tatttgtctc acagatgcat cattggtacc tcttcatcat gtggcacacg    364920
     ggattggacc gattctttca cggaaagatc ctgcaggaga accgtaaatc attagcctgt    364980
     ggcttccact gcgaataatg attccgaggt tcaacagaga gtttgtgtta ctacctccat    365040
     gaaaacccta taattgcatc cgtggctttt tgaaaaggcc gcctcctgct tgtttgacca    365100
     aaatcgacag ctggataggg aacaaatctt cgtctacaaa acgtcatcag caagcgctag    365160
     agttgtgcga ctgggcctac aaccactgaa tggatgtggg aaaggggaag gggaaagggg    365220
     atgctggagg ggaggcgcgg tgaataggaa gccgacattt cttgggcaca ccttcgatct    365280
     agacgggatg cttaatctat taacccacgg taagccattt ttcagtattt cattctcttg    365340
     ctgcacggtg aagatgcagt agcataagag tatctgagaa gttgcgttgc tcacttacct    365400
     gtgatattat ttgtgcaagg ccgttgatgg gaaatgtcaa aaagagcttt cgattatgta    365460
     tttgtctgcc cgtataaaca aattagttca atttcctcta gttggatacc tgttgttgag    365520
     tcctgggtgc gaggcgtgag cttgaggagt gaagagatga accgctgact gtcagtttta    365580
     ggtaagtcag actcacctgg gccacctact ttccaccctt cctagagcat ccgaccatcc    365640
     tagccctgct tgcctcatgc caccattagt cctcctacca tcagatacaa tccatccccg    365700
     gttgcaatgt cacttctgcg cagttcctct tctgctatgc tcaaacttac tgaatcatcc    365760
     aacttccccc cgactaaagc tcttcgcacc tgagtcggaa acgtcttagc catcaagata    365820
     tgacatcttg ctccgaactt tggctggact ggtttggact ttatcgtttg attgccattt    365880
     gctggtccga atgataattg tcaggctcat cgaactactg acctctccca tctgtctctt    365940
     cgtcacatga tcgcttgtct ttgctcgacc aagattccgt ataggacaac ggtgagcacg    366000
     ccaccccaat gtcacatact tcgaataaag ggccgctctc aacggctggt gtgatggttt    366060
     ggtgtgtcct gaaggcgcta gtcagacccc cggccagaag ccctgcggct gcagtgggag    366120
     atagctcgca tgttgctgat ccaagataag ttgaggtaag ccccccctgt ttaatctgtc    366180
     acatatcgta ccatactctg actctatctc ttctgctcaa agggcgtcgc tgaataccct    366240
     cagctggaat ctacgcctat ccaatcttca accacggtcg atgattcact tgcccgcaga    366300
     atatccatac ctcacaaagc ccgttccttt atcctcctac tccgctgtgt agtagagcca    366360
     ctccgcgatg acacgactga aaaatcgaag gggagggcga agggctatat cgccaacccc    366420
     tcgaaacacg ttattccaga ggttgacctt ccaaggccca ccgtggactt agctaactac    366480
     ggtactatgg gagaagtact ctatcacaca ctgcacgaag atggtaaaaa aagcattgac    366540
     gtgggaagct aaagcgttta ttccatggct aaaccgatat ctggatagag tcacagatat    366600
     ccgacatgtt gctggtaagc ctgaaagcac atatttctca tgtcgatatt gtcgacttct    366660
     tcaaatgtgc atccagaggc attcctctga cctgatgact gcttgatccc gcgtaggtcc    366720
     cgaacaacaa ggtttccata tctctcttct ccatatcacc gcatatcacc atttggctta    366780
     tgtgaccttg ctggcggaag ctttagttgg gcacttcata gctgtcagtc tgggttaggc    366840
     caatacctat cctgagttag gtataaatgc catgaattga atactccccg actgtgcggc    366900
     tagacgatcc aactgtctgc catatactga aaactagaat atttcttcgg aatgcaaaag    366960
     acccgaagac ggaatatggt gtccttgtgg tgagcggaaa acatcacaac aaggacaagg    367020
     tccaattgcc acaacatcat cgtatgctga gctgactttg catcctcacc cagctcatgc    367080
     tcctggctct agaactgagc attacgtaca cgcctcactc tctctcgtcc agcaacaaaa    367140
     tattccacca aaattcattt caccatcaat tgattgatcc acattgttgg tcacctgggt    367200
     acattttatt gacgccacga agatgtgccg cgttattcca ctttcaggga agcgctcagt    367260
     ggccacagtg ggaggcatag tacggcagac ataaggaatt aacaggacac cgggttattg    367320
     tcttcacgct gggaactggt tatagcttgg aatagccgaa gtagcggctg ttgcgccgac    367380
     ttgccgcact gtttggactc ccgaatatga ggctggagga atggaatacc gggatgctga    367440
     tcgtagcgct tgcggtatga agcgaaattg tggcttgggt ctatgagagg caaaactttg    367500
     gccgggatca aagaggtagg agtaacaaca gtccgactgg cgtcgaaagc acggaatgta    367560
     ttagatccga ctgcaatata tttgcaaagg ccgtctagta tagccattag agaataatag    367620
     ttgcgcgcct cataaagctc ctgtgagaaa acaaattaaa tttcagtttc ttggtatgtt    367680
     cgatagctgg agtccttacc aatgtgcagg tctgaaggta cggaactagg tccgacagtc    367740
     cagagcagca ttccaacaca gaattgctta gcacttgcca atggatgagg ggttccaaaa    367800
     ccatagcatc ttccgctatt agtgtctctc gcgacagtct ctcaaataaa catttatccg    367860
     tctgtgtcaa ggctgttgcc aaatcggtcg ctgacgaata aaggcagtct tccaacagag    367920
     gaagagaagt ttcgaagggt gcgaaccaat tcatctggtc agagtgtctg tatgctttct    367980
     ggaaacgtac agcaaggaca ctgagaacct tgaatatagt tgataggctg gaggaatggg    368040
     ttttgaacag ttgctgaatt ggggctgcga tgaatgcaaa tcctggggta ttacgtgaag    368100
     gcatattgtg cttgccgtca agctggatgg ccatgatgca ctgtgtaagg gcttggtggg    368160
     caaaggggct ccggtcccgt aggtgctatg tgaaacaatt agtcgattgt catatggcgg    368220
     agtatgcaga tcattcgttt tcagcttcat ggatcaccaa ccttctctac ttctaaataa    368280
     agcagaagtt cctccgggta aatgtgtaga tgattcacaa gaataccata taatgatgta    368340
     tgctgctgca agaaccactc tactgacatg gctttgtatc caagagcgga gcgtacgata    368400
     tcctcaaaag cgatctgctg gaaatgagaa taactctctg cctcaatttc tagagcgatt    368460
     gttctagggt ccgatgaacc ccctgatata gtgggaatcc agttccatgt aagtaatgga    368520
     cgttgcggga tactagatcg aagcaggatc tcttccactt tctgcggatg tgacaagtct    368580
     gataggcgac aatgctcgta cggctttgac gccgcaagga ggaactcatt gatgaactgc    368640
     atattacgac tcagcagtga gcttcgcgga gaagtttcgt cgtggaatag cccaaatcgg    368700
     atcgcttgac tgatatcatt gaaatcgtaa gcccatagca tattgattgc ctcatcttcc    368760
     caccatcgat atgcgacgca aaattgagga atcgccacac taggacgaaa gacaaacggg    368820
     aatgacccca tatccacggg aggagcgctg cttgttgggt tttgcatcat ttgagacaaa    368880
     gtcggcagca ctgagttggt gatatcctgg aggtggggga tatgtcggca gacccaggga    368940
     cagagagagt tccatccatc tatctatatt ttaatttacc gctagtcacc ttgtgtgtag    369000
     gagtggtctg tatcggaaat accgtcgacg accacacttg ggcctggtgt agcgttttga    369060
     caatatggcg agacgggagg gggacgggga gttagccaag gcaaagccca cgccccaaag    369120
     ttagctagca tgccgtgttg aaccaatatt ccaaatagtt gccctcatat ctggttccca    369180
     ttagcacatt cgggatggta tgaaatctga accatacccg attgggaata tcctccaagc    369240
     cagaattcct ccgccccttg cgacctttga tttttcccaa gcaccataat tccttgcatc    369300
     tgggtctcac gtattacaat agaagggaaa ctcaagattg ttggataggt attttgcccg    369360
     cagcatgtcg agatctagga ccgatacgct ttgcccgccc cacgagaggt gttatcaagt    369420
     gacttgcagg cctatgtgaa aaccgaaaat ttgtaccaac tgtgtgcctg tatttaaatt    369480
     gataagtggg tttagtccgc gcctaaggga tgtaggattt catgtggagt tgatagggtt    369540
     gtgttattcc tggtgtgtag accatggaga tgctggtgag aaaaacatgg atattagggg    369600
     gctcaacggt tagttactaa aaccaacaaa tgggaaaagc ggcccacgta ttattatttt    369660
     gagattgtca aggcattcat gttgttgagc attttgggtc ccactgttat tgttataagg    369720
     cctcttaaag tgaatatctt gacaccattt ggatcataag gtagcttgta tttccgcacc    369780
     ttttggaagc atagccatta cgtcattcaa catgtcaggg aatcattcat acaaagtcaa    369840
     cgttagtggc acgctcatgg gaaatgattt ctctgcgggc agtcgatttt gagataccct    369900
     ctgttattgt aaaagctctg ggagagtggc tacctcatca agatagggaa gatcttcgaa    369960
     ggtatccgta acacatgaac accagacctg gaatgcactt tctttgtcct ggatcagata    370020
     tcgctaccca gggcttaatc ttggctaacg tggtgatcaa cgcgcatgca aattacgatg    370080
     ttgaagtata tcaaagcagc ccccagggtg ctgatggtca gtttggttaa tttaaatctc    370140
     acttcctcta gcgagggcca tgacatatgc ctccatgtgg atcattcaag cagttcttct    370200
     ttttctagct tttaaaacac gtagacttcc gcgagcatca tcacagctag cactaggccg    370260
     cttcctcagt catactttcc caaagcaccg gggctagaaa tttacacagt catgcgaaca    370320
     cctccttttg aaagacctcg taatggcgct aagtgggctc catttggctc gtaattggat    370380
     gcaagcaggg gttggtatgt gaccttgtaa tattgaacct tgggttatgc actagactgg    370440
     ttgcgttgga aaagacatgt tctgtaggcg gagcgaatgt tcgggccaaa gattcgaggt    370500
     cgatccgggc aacatcggaa catccggttt aggcaaaagc cctcctatcg gatatccact    370560
     ggccccttac gagattgtcc cccgatgtct cacttgcgat gggcagattt aataccgcat    370620
     tacaagccag aaggaagaat ctatttcctg cgaaagaaca cagataacgc cttcgaattc    370680
     tttcgacgtg aaggcagaat ataaactact tcctactcgt caggtgtgtt gcgtggaatt    370740
     gctcacaggt aaccaaactc ttggcctact tggggaatca agactctaac caaacttatg    370800
     attgcgacag tatgtaccat gacgaaaact catccagtgg gagcccaacc tacccactcg    370860
     tgggggtccc aatagactac ccgtatggcc taactcccgc tccgttgatg gactcggctc    370920
     ctgcaatcaa cccagcgagt aatgtttgtt ggagctttga ccaagcgcaa aactggacga    370980
     caacacctgc gtcgccaaca gtcacactgc ctcccctccc tattttgaga tgtcgagaaa    371040
     taagacctcg accgctgcac gaatcagcgt ccacgttgcc tccggtgcag cctggcaaag    371100
     aggaacagca cagccggcac cggaaattgg gggaaaaaaa cactcgaagg gcccacagac    371160
     agttagatca aggacacctc aagaagacag ccagaagcgc gattcgaacg gcatctgagg    371220
     ttacggatac gaccaagaag caagtgagag ttggcagaat gaggtatgta cggctggact    371280
     ctctaactgg tatcccggga aatggctaag tcgcctatta cagcagggcg aaacccccga    371340
     aagttgcgag gggagattca gccacacaag gcccacgccc ttggtcgcct ggttgctctt    371400
     caaatcatcc ggaggatagt tctcaagctt cagtaagggc tcttcagaaa gccttgaagg    371460
     cccaggtatt acaatcactc gaggttttgc gtgagatcgc caaggagttc cgcgtcttca    371520
     acttggggct tgagacgatt gatgactggg tggcagagat caaggaagtt gacgaaacat    371580
     tgatccccgt cccatcaagc accgcggtcc agttacttgt tcctttcgaa aagctaaact    371640
     ttatcctcac gaaatgtatt acagcttcag gacccatgcg agactttatt gtcagggacc    371700
     aggcactgga gttgttgaaa tatatacaga cctatgcgga ggagtatcac ctgttcaaaa    371760
     acctgcgggt ccatcttgac attggtaggt atatagaaag actcaggcaa ggcaaagata    371820
     atgagatggg caaatgatgt tgttctcccg ggaggtcgcg catagtcctt tgctgtatac    371880
     gagtcatttt ctgcctaatt tgtcttcaaa attgagatct ctctggagtg ttcattgcat    371940
     gtcacatact gaagatgctt aatgcccttc tgtcagtaat gaaggctcta ccgctgccat    372000
     tctgctgttc cagacattcc cgccacgtgc cttttgaggt acaggataca tatcgcgcag    372060
     tccaacaact ctaggtccag gagtatgctt gcatataaat tctccgtcgt ggcagccccc    372120
     aatctttggg aatgcggagg cattcaacct tgctttcgca tcccaaatac taccttgccg    372180
     atgaacagga gtatacttgt tgctcggttt cattgttcgt atggtagagt gtatgttagg    372240
     tcggaccgat tcgctcagtc gacaccctgg taggattcca agaccactag ctcgtggctt    372300
     tcactttggg tacgcactga gagactcgac agactggttg cgttatgtct ccattggaca    372360
     ggttccacct catctggcgc tcggtatagg gccctcttgt gcacgtttgg caattgggta    372420
     gaaaggtatc tcgttgtgta cagataataa gtccatctaa gcttggtgat acgtaagaaa    372480
     tgggaagcaa gactcgggga ataataggaa gagaacgtgc cttgagagtt ttcactcacc    372540
     gtcaatcaag aaaattcttg atttcctcct ccacagcaag cctggtatca ggattatatt    372600
     tgctggctgt acaggcaagt cgtagtagcc taaaaggatc tcagagtttt ctcgcttgca    372660
     taggatgtgg tccgtggacg gcagatgctg aatggtgctt tctgttagca tgtggactct    372720
     tcaaaggaac aaaaggtctc gatctgttag ggttgtgata tgttgttgaa taatccaggg    372780
     aatgcgagga aggaagatcg gggaaaggag aaatgtatca ctgactgtct gttttaggta    372840
     aggcagattt gggtcctctg ccctccacct taccctgacg cgagcacctg agtattctgg    372900
     ccttccttgt ctcctgccac caccagttcg ccctaattag ataaaatcca tgcccgtgtt    372960
     acaatttcac tttctctcgg tatccttccc ggtaagtgcg agctcaccga atcctccaaa    373020
     cctgtaccta ccaaaggtct tcgggctcaa gcctgagggc tacccaccaa gatcctttgc    373080
     taccaaacgt tcctaaggct gattcaaacc gcaatctagt attgtattac cctagttcga    373140
     acaatagcaa tcttcagacc gaccagactc ctgcctcccc catccatcct tccgtcacac    373200
     gaacgtcgcg catgattgct cgactttgtt cgaccaaact cctgtataag gctagtttca    373260
     gcacacgata tcaacatacc gttccttact tctccaccac cggtgcggat tattgcgtga    373320
     gctctaaggg ctagtctgac caggtcagaa gcgcagcgac cgcggcgtaa caactctcga    373380
     gcatttttgc tttaaggtga gacgtcggaa caagctgtcg catactggac actggttcca    373440
     tctcttctta tcaaaagaca gtccctaaat acccttggcc gaatgctaca ctagtcaaac    373500
     ctgccaggtg cgtatggccg tttatgagat gtcctcgcag caaacgaccg ctagtaacga    373560
     cttcacacag ggagacaata gacgataaac gctttaaact tgtctggagc ctagggataa    373620
     ttcgtcttca tgttaggcaa aaattacaga cagtcttaga ttgtgataag aggtgggaaa    373680
     ttcatacatt cagtttccgg aacaagctca aacaattgag cttatattaa tcgccggagt    373740
     aacatatata tagggcattc agacacgact aagcccatcc tctgtcctct tactcaatcc    373800
     gggtcacctg ctcgttttgc gtacttgcct gtcatttggc agtggtttct cgatgacaca    373860
     acggagaaac tggaagaccc taacatcggc tgccttgcaa acgccctatt ttgccggatt    373920
     ttccttccat gacttaacaa ctctgatacg gcaagattat tgatgatacg aaggatggtc    373980
     tacattgcat atcatgcaga aaccatgttt tctttcaaca atctggataa tctatgcttt    374040
     gctgatacta aagacaatga cagcggaatc atgccactgg atatggaaca agaatacgtt    374100
     aatgattttg atgctgaccg ggagatcttg ggaggcggct cctaattttg gtacatatct    374160
     ggtgtcctgc agtctgcttt aaagtatatt agagcaacac agagacagct gcatgaacct    374220
     ttgtttccca taaagactac ttccgtttcc cagaaaattc tcttaagaat gtttctgtat    374280
     ccatccctcc gtgaacacaa aaggttcgtc cagtgttgga attatggaag accaccgtat    374340
     catccataga acctgcacct ccggtaatca ccatgcttgc gccatcaaaa gtgcagtctt    374400
     tgaagatata cgtcctttgc tttcttttat tgatatcggt tggttcctca cgagggaaga    374460
     cggtggctga tgcaagtcaa tacccgagtc atattctcaa atgacgcatc atagatacct    374520
     gagtgtctct gttcatcaga actggaatga cgatgactgg atagctttcc ttcgtgcttg    374580
     aatggttgct tgagtggaaa ggaagaaggg ttagtaaaag ctgctgtaag agcgaaggca    374640
     ctctcgcccg agctttagtt tcagacttac ctgatcccga atacacttca tggatgtcga    374700
     cattggcttt ctggtatcat tctgatagct ttggggctgg ggcttgtaga tctgttagaa    374760
     acagtaatct ctggaaaagg aaagcctagc gcaagggtat gataccaatt ctattctctc    374820
     cagatgtggc cgggtagacc cattgagcca tgtcgaagta tcatctgaat cggggttgcc    374880
     ttgagataat gcaccttgac aggacagccg cctttcaacc atctgatggt catcttggaa    374940
     gttggggctt tgcagaatac gaaatatcgc aaagacgccc tggaatgaga caatgaagtg    375000
     aagtcggaat gtgaggggga acggatcagc catgacctag gcgggatatt acccctagta    375060
     atgtctacgt actgtatggc ttggcactcc atgccctaaa cgatggtaat atttctccgt    375120
     aggtatccag cgttggcaca tatgccatac ggctggccgt ggaaagaagt gcggatctat    375180
     caggttgagg gagggccctg ggaagatcag ccactaaggc ctttttcatg ctagcggtat    375240
     gattcagacc ttgaccccga catcagctgc gcctacctcg gaccaagtac agtatcatag    375300
     tttggttcac ctactcttgc gtccaatgga aatgagagca tgagaggaag agtagttaga    375360
     ggaccccgct agtgcaatgg cccgagagtg agaagacgcg ccacaaccct ttcccccaaa    375420
     ccctcgataa acctactccc aggaaaaatg caacgatcat ttctattact acccaccata    375480
     aatatattgt tcattatgaa agaagaacct gaggtggtgt tgtccccaaa tacttgggga    375540
     agctcccggg tccatcggaa agcctgcact ctggatcaaa tgggtacttg aaatcaggtc    375600
     acattcggtc aggggactac agtaacacaa gctcatgtgc ctcaccacat tacatttcgg    375660
     ataaccccca gtggtggacg acatattctc gaggcttgct atcaaaaata cgacttcatc    375720
     tacaaagacc tccgtcagca acctttttgg cagcaccaca cgcgccctcc cgctttcctc    375780
     caacttcgcc cctccaatat cacgcgaaac gacctgcacc cagtgaattc ggacccactg    375840
     cggaaggcac cgaggagaca ttgcactgca atataagtct tggaaacgtc ggataagtga    375900
     aatgtcctgg aagagccaac ggctacccca agtgagaggt ggtgattcaa agtcggccca    375960
     gctaggggcg gtgtcaacat ggtcttttca gctagatccg ggagagaaag ggcagtattt    376020
     ccgagttgct tggtatgtac tgtaattctg acacaacgac cataatatca gctccatacc    376080
     ttcagcaaaa tacgggttcc gacctcgact ttagcagtca agaaccttcc ttcgccgctt    376140
     gaccattccc accttcaagc aacctcgcaa gtccggcgat gaatcgcgcg ctccaaatgg    376200
     gccactgatg cttttgaagc gcttatttcc cttaggccaa cccatcgcca cgacgtgcag    376260
     ccctcctttt atttgcacaa taaccagttc acatgtacga gtgcgtcctt gagttagcgg    376320
     tatgtaaatt tcaacagagg cagtttatat ttgtttcgcc gcacatgttg aaatagccca    376380
     agttctgtag tcactgagca ttgtataggg ttacccggtg aatgacactt caatccatga    376440
     aaggcaagcc cccaaggttc atagatggag ggtggattat aagcgcgatc gtatcgccgt    376500
     cattgtccga atgaggaacg gcagctcgga cagctgcggt cacgacatag tttgtatgaa    376560
     tgatataaca cgaattgctc tcgaggccca gggttctcct accactaata gctgatatta    376620
     atataaggat ccccatcact gccatgctat agcaccatgc gaaatcgctg gataccaatt    376680
     atagcaaaac ttttccaggt aaagtgatct atagacatga accattagat ctattgcctt    376740
     ctcacgttag atgaagttgg atgcgtatac aatatgagta tgaacgctat atattattga    376800
     acgagaagtc tttagctctg ttgcctcctc ataaaccaac cattcatggc ccaacactag    376860
     gaatcctgcc cagaattttc atcatacttg gaccaagagc ggattgtgtt caaatctttg    376920
     accattcttg cctgaggatc acgtatttgt gccagataaa cagcatcttc tcttcgttga    376980
     atattgtgcg ggatggggac attgtttcct tgcaggctta atgagcggaa gaaaaatctt    377040
     gcatatccga aattgaaagc tgcttttggt tctgcgaatt tgaactctta gatcgactat    377100
     gttcctagaa aaaggactcg tcactcactg gtgagtaaag tttgatcact gttggagggc    377160
     tgaacggtaa atcgccggag ggagaggtga aagcagccca cgcagtacga ttaccagggc    377220
     gttcaaatct gttcagaatg ttgaggattt tggggactct tattgtacgg tctctgatgt    377280
     tccgtagaca cgatttgcat tagaaccatc ataaaggtgc ccggtatcga cgcactttta    377340
     tgcattctac cctctcgcat cattgattat ctcagggcta tagccaacgc aaaattcttc    377400
     atgcaatatt gccgctccct gcacgctcat ggccaactgt ccaataaagt tgcaagccgc    377460
     ccctcctata catgctcctt gagaaattgc tcagctttag ccggcagtat gttccaagaa    377520
     cgtggcaaac atctcctcct actttcgccg gctcagcctt ttccgcagct cgaccagcat    377580
     gatggcccaa gtctcccaaa ggtcaacccg ctgaccccag ctgccacccc tgtccataat    377640
     ttggantcac aagtcctccc aagctggtcc gacgtgggtc acagcatatg gaggcataat    377700
     aaactcgata ctacatctct acaccgtgaa tatcgggtag accatggggt aatccaggct    377760
     taccactgtt ccccaggttc tcattaccat gcaccaatgc tgctaaggga ccgtgacatg    377820
     cccagcctct gtctttctca tgaaacagac cgtccccttg agtggacctc cataccttgc    377880
     ttgccaccat tgggaccctg ccatttgaga caaatcgact catccccaat gcccaatgta    377940
     gttcaacgtg tgccgggggc cggttcctcg acaatgcaaa ctgtcaaccc agcgttggta    378000
     tttccatcag ctttgacgac tgcttctgag accttggata ttacatcaag tctacccgcg    378060
     gccgctgaag ttggacccat accctcgggt accggtatcg tctctacttg gattcttgac    378120
     cagccacaag agcagtccca ggtactccat ggcaccacca tgtgtgtaaa tgaccattca    378180
     cttcttgatt gtcacgttaa tagcaggcag catggtcata acttgaacct tgagaaccag    378240
     caatttgata tgcacgagcg gaggttcaaa tgcaaaatca ttggctgcag aatgggcttc    378300
     aagcgtgagg accacctcga gcgccacaca aggagtcact caaaagaaaa gccatatgtt    378360
     tgctgggtgc ctggatgcca ccgtaccttt tcacgccgcg acaacctcaa agtccattgt    378420
     acgaagacac atacgagacg cggtggtcgc aaccgttatg ttgctaccct cgacgaggcg    378480
     agccccgact acgatccaga gttccgtggc cagctgtcat ttgatggacg cccactcagg    378540
     ttcctagccc ctattagctc tgttcctgaa gctaagcctc tgcaaccgtg aatttgggca    378600
     ataataaaca ccaaggacat attttcccga cagcgagcaa gcgggactaa gtggccaaag    378660
     taaactaccg tcatccaagc tcatctgctt acgatgcggc tagagaagaa ccgcggcgca    378720
     atgccctgtc gccctgccaa ccttcaagct tctcgtccat tgtttctgcc ttcaggagtg    378780
     ctttgtcgtc aaacatgccg aatgtataca actttaggaa acacaacgat agccccaata    378840
     gtgcaacggt ggcacctaaa taataccact gcccctgcca ttcctggatt cgtcaatttg    378900
     taaattatct tcgggcaaat tactggtcaa cgcagtgcgg ctcgttcaaa ctgtttggca    378960
     acatatccga agctcgtcaa taatcacata tagttgcaat ctactccgta ctgtaaatca    379020
     agatactcgg ttaagactct gatactacat ttgaataggt tgtcttccat gatttttcgg    379080
     ccttggctgc tatattccat gacacattcc tccgctggca gccactcacg agcatgtttt    379140
     catacccatc agcatggcca aatcaccccg cgaggattga ttccagtcct tgagcacgct    379200
     gatcagtcgt tcttgagtct gctccaaagc ttgttccaag gaagacagac gagatagctg    379260
     ctcatcagga cgaagctgga aaccgtcccg ctgtttgttc aatttggtgg tagcttcctt    379320
     cggagctctg tcattttcgt ctggtatctc gctctcggag tgtttcggct cacatgaggc    379380
     ccatagacgt cggaagagtc ccacgggtcg agccgcttgg aaggcgagtt tcgggtcatc    379440
     gcgatcgaga tctgccagtg tctccaatat gggttgaaaa tgctcgatcg tcagaggttt    379500
     ctttaggatt tcttcctgct gctgcgagag aacgtagtga ttagccacag tatagaaagt    379560
     gtcatcgctt agcttacaag tgggggttcg gagtcggaaa cggcctgcgg ataggcctca    379620
     tcactctcca taggtatttc actcggctga cggtctgccc tatcttggtc cggtagttgt    379680
     tctggggaat ccatcctgtt cacttgcaaa aactcagcgc ccaaaaacat ataattacca    379740
     gctggcgctg gtctctctta gccttcccag aatcacacag ttagttcaac actgtgacaa    379800
     aggtggctag ctcgtccaac gcaaccatga cccgacacat gacagagacc tccttgaaca    379860
     tttattttca acgttcggac ttgatataac caatttcttt ctttggtcca ctttctattt    379920
     ttcattgtac catctgctca ccattggacg aaacctgagg gacaaagaag aaaaaaaaaa    379980
     aaaaaaggaa ttccttcgct tattgtatgg tgaccgtagt gatagtaaga aattctcgag    380040
     gccattacct ccccatagtt ttgcaactgt tgaatatcaa taacctccga aagcttaccg    380100
     ctgttagtaa ggtgtattcc ggagatacgt aatcttttcc cacagctctt cgcactattt    380160
     cacccactcg tctactcaga aactgcctct tgcatttggg ctgtaggctg tttcttggtg    380220
     ctgcggagtg tggtcgttga gtcaacgtta gtgcatcaac cgtttacaat aacgtccttt    380280
     cttcaccgaa tgtgtcgctt aagccagtgg aaatataacc cagacatatg cacaggcctc    380340
     acatttgtta gtcaccctca caaatatgct tttacatttg acgccaacta gaagcttgca    380400
     aatggcaaga caagcgggaa ggtctataac tacttctttt acctatgttt ttgctcaaga    380460
     caactgcatg actgatccgc agccagcaga tattatatcc aaggcgtcag aatgattttg    380520
     tcccaagttg attaaccgcg ggcatcttaa tacagtggga aggtgaggag atgaatattg    380580
     tagaggttaa aaaaacgcag aacatatagt actaaccact ggaatgtccg ttatacattg    380640
     tgctagtcgt gtttttgcaa tctcgcatag tggagataga ccagaggaaa cggcttgctc    380700
     ctgttgtttt agggaagtac attactgaag gaagtaaaac aactgacaaa aagatgcacg    380760
     ctaacccatc ttatatgggt gacgtggaaa gagaacgtcc gcgcttttga gacgttggtc    380820
     caccgcccgc ctactcacag atatccccac aatattccac atctcacatc aataaccaaa    380880
     tttcattcgt ctctgctggc ggctaccgac taactctagc ttgatgtaaa tgtttagtga    380940
     aggcgggtaa gagcagattc cagcctgttc tggaacgtgt tgagcctcaa cagctgcatg    381000
     aaagcatacc atgtgacttg aacatgcttg actaactaga caccgccttc ggtaattttc    381060
     tgtcggaccc accttttgtg gttggcattc tgccctccaa ccaccgcatc gtcactccgc    381120
     caggatcgtc tattatccac caaggtctcc ccggacagcc gggtggtctg ctcaggaaca    381180
     gcatatgcag cgggcatggc agtcggtgtc cgaccgggct caaactctct ttcaatattg    381240
     gagggttctg ttggcgctgc gatcgtgtcg gatgtgccat tgatgaaagg gtcaccgtcc    381300
     ggccaccact tgcaggaggg ttctagatca aggtcaatca atcgccaatc accactcgtt    381360
     ctggaatgga cgatgcggcg tactgctgcg cgtgtccatt tgcttgcgca cactaatacc    381420
     tgttagcctg gcaaaaccga agtgcataaa cgggagagcg ctcatacccg aaaccgcggt    381480
     cgttccgcct ctaccatcca ttagacgtgc catctccttg ccgatattga tgacatgaaa    381540
     atggtatttc aggcgcgtgc aattgcggtt gcggtaacga atccggtcca cgggctgggt    381600
     atctaggata tgtgtagtga attgcagaat ctactaccga gttagcccgg tccattgtag    381660
     gagtgatagg gagaaggaat attcactcac atcaaatccc cggtcatctc ggtgtctatg    381720
     ctcgggacaa tcgtttctgt caaacatacg gtcgagctcg aggatttgcg agatgtcatc    381780
     ccccacccaa gggggatggt ttattccagt aagcacatga cagcgcaaag catccgagaa    381840
     gaattgggga accaactgaa atgtttcagc ctaacttgcc acaggacttc tagccttcgc    381900
     accgtgtttc tccggcttcg gctttcttga acgagatgtc gtatgaacgg caacgcgcgg    381960
     aagagtccaa tgtcttcaag tacaaagacg atggtcccgt actggccaag gttaggtgga    382020
     tgcccatacg gacccagcac gcataccgga aaatggatcg tcgagtacgt cgcatgatcc    382080
     gcggcttgtg cgatccttcc agtcactcct ggtcggggtc gggtcactat gcgtaatgtg    382140
     cgagtggtcg gtggtcctgg cgcattgtgc actgtgtcca ctgaagctac gtagaatgag    382200
     ggaagctgca agaaagacct cacccctgag cgtggcatcc agagctggac atactgcccc    382260
     ggttgagcct cccaccccat gggaacggca atatcaagcc ataagaactg gttgaaagac    382320
     cgcgcgagtg cccgtctaga ggtgatgcgc cacgacccgt ggaaccacat agtatgcaga    382380
     catgtcccgg cactccaggc acatccggcg caaataccac caagtaaaac ccagcggtag    382440
     gacgataccc ggtcgatcaa atggtagaaa agggcgccgg tggcgatcga agcaagcata    382500
     tagtggacct tgaggccgag ttgcggccac cggcgaagga ttgctgccaa cgtccaaggc    382560
     aagatcgaga cgagactaca tccggcctgt tcattgttag ccacttctag tcaggcatac    382620
     tgcgggggaa tgggaaggct gccgccctca gacccgcttc acgtaccagg agtgggatgg    382680
     cgaggggagc tccaaggctt gtatttcgag catttgctcc taagacggac ccatgaagaa    382740
     ggcaatgcag cacgcaaatg cgacctagcc accgatgggc ccagtagaac gtgtcccgtt    382800
     cgacatagta gacgtgggcc ggaagactga agctaagccc ggagcagagg ggaacaaggt    382860
     gtgtgaccgc caagcatccg gctcgcctct gcacatccgc ccaggtctga gcatgaaggc    382920
     tgattacaat ggtatttgca attaccaagg ctgtaagtac tcccccttgc aagtatgttg    382980
     gtatatccag ccactggagc acgcctggtg ttggggcctg gaagaaactt ctccaggata    383040
     cctgctgcaa cctcaaaggc aaatgacgga atctgcgtcc gaggctacaa catatccagc    383100
     atacaagagc aaggagccca catagaccga atgtatcttg gatggaagct ctggcaagcc    383160
     actcggcaaa ctttgaaaca gggcgtgaca tgctttttag gacaggcaat actggacatc    383220
     agcgggttta tatcttgttc tctaaatggc tgtttggaca acgttgacct agagctttga    383280
     ttcaggcagg cgaaaatggc ttgggagagc gatgcggcaa aaatgacact ggtgagtaac    383340
     gatcagaaac ctcattttat gacttgggat ggtgtggcag gttgatggct gaaaattatc    383400
     tgtatcggca gcgtaacagt ggtaatctgt cgcatgtcga ttgcaagacg tgcgtctcgg    383460
     aaaacccacg ttcggcgttg agccttaatt ctacggttcc catattcctg cattaactat    383520
     attacaattg tgagttcaca tagttccaac agttgaagtt gatcaacatt ctgagaagca    383580
     tctccacatg gtgcatggtc gcttatctaa tagacggcga ccgtctttat tagacatatc    383640
     gttgaggcaa cctcgtgata cgctctgcaa actggtcgca gttaggttag aagggttcgg    383700
     ggtcgtactt gccttacgct ttctcaggct tccaacgtca acgatctgtc tctcaaccgt    383760
     actgtttcct atcagggctt tctacagggt aggtccgttt gaggtatcga ggaaagatgc    383820
     caggtggagc gccgaatagg tctattctca agttttggtc tatctgtgag tgttgtcaag    383880
     ttataatcaa gcaaagagtc acatatttat ccacaaggta accacaagca acaatgtatg    383940
     attgaagacg aagaacccaa ctaggtacac gaataggcgt ccttatatat cccagttctt    384000
     cctgtgtaga cgagtagata gtagagtagt ggatttccct tggcatattc tacagatcga    384060
     tggtcacgtg gtcggttgtc ccaaagtggc agctgatggt actgtgattt ccggcacagg    384120
     tagtcgcata tgtatagaaa accctctgac ggtgggtttt ggtcttgctc actgggcgtg    384180
     atcatggttt ctctttccct gaacatctgg agttgccaga ctataggatg ttgcacgtga    384240
     tcttctgaga catcaattgg ttgtgttgga tcttggtggc ccatcggtgt aggtgtgagt    384300
     tccatctgat tttggtgacg ggtatgccag gaacacctcg gccagcgacg gcgaggaatg    384360
     cgcgaaatag tatatataca aaatagaccc gctgttgacc atgtgttttc ctggtttctt    384420
     ttctgctctt gggtccaagg attcttcaaa taaaccgcct gagtgcaaat agcggatggg    384480
     gcgcaacaag accgcgacac tgttagaaga caatgtgaaa ctgtctcgtg accctcaact    384540
     tgtttgcggc aaacatgcgt ttgagctgca tttcgaatag ggtttcaaat tgatctcaag    384600
     tcgtcaaagc tagactcgtc ctcgcagcat ctatattcta tggctccttc taggtaaagt    384660
     attgaagtgg tatagtgata ttctgcgatt aaatccggct ccctctcgct aaatctggac    384720
     ctttgtgccg ggatcactga tcctgcaagc ctcaagaggc cttgtggtca tgtaactgaa    384780
     tgtctttgac cccttccatt atggggctgt cgtcaggcgc gaactaactc cagatgaggg    384840
     gagttggcta aagacctatc atcccaggca ttcctctggt tctcctacgt ctaccacaag    384900
     aaaagacttc tgtcacaagt tcgagattct aaaattcaat tcccaatttt ggcaacgtac    384960
     aatgaatggc aagggaaaag aaaacaatca aatcaaacca taaataccaa cagctacgtt    385020
     gcgagccacc aaagccttct aacacgcatg ccgactctag gagtgagtga tgggcttatg    385080
     agaagaggtg acctgaacat gagaaacttc gaggagctca gcaaggatag ccgctttctc    385140
     tctactcgac gtttcgagtc tgaacgtgag ctttgcccta acaagccaag attttccgct    385200
     cattcgctcc agcagagagt aaactgagtg gttggtggaa ctatcagatt cgcccgtggt    385260
     tatcttgaag tttgccgggt ccactgcgga atatatccag ataaatccgt tggaatgctc    385320
     gaaagaagcg gcactcgcgt tccatttcga tatcagcgtg ttgaataatg gcccgaagat    385380
     tgtgactgga aggccaacac agacatatcc agtctcgtcg agtctctctg gacgcagagc    385440
     cttgagtatc aattctgcct cctcgatcga ctttgaatca ataacaaccg agtctgatac    385500
     ccagaattcg gttgaccagc tactgaaata aggtgggacc ttctccaata cacaattctg    385560
     gaagtgaaag aggcttgccc ggagactctt tgcttgtttc ctttttttcg tattggcaag    385620
     gataatcttc aggtttcctg actgcgctgt ctccagaatt ccgatctgat agtcatgatg    385680
     ttccaggtta gtcagctgtg cttgagggaa gacttgaaca acaccattct cgattgatat    385740
     gaattcttct cggctgtctg ctttgtttgg tgggcggcct tgcggaagca tggtggaagg    385800
     gagtctgatg ttgatactct gaccacagag ctttgactgt tcccatttcc aaacgagctc    385860
     ctcggtcttt gaatatatga aaggggcttt cgtgaccggg tttttcgagg agaggcccac    385920
     acgagggata tgctgcctgc tgcgttcagc atatttatac atggccattg gaattcataa    385980
     tacgcaccta ttcgcacgcc gccaatgcga cagaaacgga tgttgaagta gctgtaacat    386040
     caagtgtagc accaaacaat ctctctcagg aagagcttct ggtagcaatc cgggagtagc    386100
     aatccagggg tactagttct cgtggatgtg aatatgcaga accagcgcta atttggtcca    386160
     cttttggcaa tgatatcagg ttataaaact gtttcgggag gccttacatg agataacacc    386220
     cctcaaggaa caggtacaac gcaatttacc catggccagt caagatcaat cgttttctat    386280
     cacaactttg atatgttcac tggaacccaa cggagtttgc atttttaaaa ccctggtgaa    386340
     aataataaac cgcaaacgtt cacaaactat ttagtatacg tttgtatcgt gctggtcaaa    386400
     ggctttacac tcaacgttga gtaaaagcta ctgaaaatag gtatttcaca tggcgagagt    386460
     caaaatcggc aaggtgaaca ggctcgaaga tctagatcac tttgcctggt ggacatgcag    386520
     agaatttcgc cattgggaaa cttagttcaa taagatttcc atgacaatgt ccgttgaaac    386580
     ctcaccaact tcgttgaaaa tttactctgc tcattaggag ggtctgatta tggctgaagc    386640
     agaaaattac gaagctggac tgcttcagtg agatgcttcc acactcagtt tgcggttgga    386700
     tctcctagga tttgtaactt ccttgtggat aaagtggttg tttgaccgga cggaagatgt    386760
     agatgttggg actagcctgc ccttcactag tggtggaacc agaaacatac aagcaatgag    386820
     aagagaccta ctcagaacta acttcggaga gttgataaac atagcctacc ggttatatac    386880
     gtactgtctc cagcgtatgg cgacagggcc aaatttggtt gggaaaacac taaatcataa    386940
     ggctttcggc taaaaagcga taacattgct tcgcacgcgt taatatagag acagcttact    387000
     agctggcaaa ttggtaatgt gcacagcttc agtactatgt acgagtcatg tcttctctgc    387060
     aataccactc atatgtggcc tttcctgctc ccaggaccgc cataggacca aatattgtac    387120
     aacaggacta tcattctggt ggataacccg tttggcaatt gtgcttatcg gtattttgtg    387180
     gccaacctag ctagggatgt cagctcatcc attagaaaca gtattcccat gcaacttaca    387240
     gggttagaaa agtcatcatc atgtctgtgg tggcagtgct gactatagtt tgaagactca    387300
     gaggatcggt tcgagtaggg tgattgatct ccatccgaca ccacgaatgc gcggtcttca    387360
     cttgtttccg aaatatcttc ctctgagtgc tcagagattg actcttgttc ttcggattca    387420
     ctgggctcac tgtacgagga tataatttcg gaaagctcat tttcttcttc catggccatc    387480
     ttaggtagga aatgccggtg ccagatgaat ttacaacaga agatggacaa attttggatt    387540
     ttcaattcag gtacgacccc catttatgta gcccgagggt cgattctaat atgccttgaa    387600
     catgcctaaa gagccctgca aagcctcgac gacaagcgaa agaatttagc tagtgcttat    387660
     gggtcaaatt actaaaacgt tgattcacct gaatacctaa ttgagccagt gatacgtcgg    387720
     gaatcgttga cgtcatcgac tttcaccgct caagatattc ccccttcgtg tagcacaggc    387780
     ttcatctatg acctgatgat cctgaagcta gtgaggatat caaaaattca atagaacaat    387840
     acatagcgat gctgtgagac atttttcaac gtttgcctac tttgagactc aagaaccgct    387900
     ggtggttcag ttacgggcta tctgcattct tgaagacctt taaactcacc atctcaaatc    387960
     cccttcggtg gttcctcaat ctggtcactg ggattcatcg acttcaacac tcagggcaaa    388020
     aggacggacg gattagtcag gagaccacgg tatataattt ttgacgcgat gactgattcg    388080
     tgggacgcag cggtcgccct accataaaaa gctggcacca gtctcgcttg ctttggctgt    388140
     gatcccattt attctggcgg cgtcccccgc cagctttaca cccctcggcg cgatgtgttc    388200
     gattgagact gcctcatcat cctcgtcagt cccaatgtcg ctgtcttcgg tatgtcatca    388260
     ccgggagcca gtcaactgat tctaacttaa tttaccactt gaagcttttt aatcgcccct    388320
     caggcatcgt aacgctggaa gaccgaccca gaagcccccc agcaaaactc acacggtttg    388380
     caccgggccg ccgagattgg gtgctctacg actccgacca ggagaaagaa tttttatcgt    388440
     ggtggctgga gaccgagtat ggacaacagc tgaccaaaaa cggaaaatac aaattcagat    388500
     ggtcggctga gtctcgttcc tcaaaggtgt ggaagcactt tgaccaggtg gcagagctca    388560
     ggtctggccg acccaaggta gtttgtcggt cttgcctcac gccgcttaat cacccacatc    388620
     atccacgtca taaatcccat ggaacaagca caatgggtaa gcacttgaag tccaactcat    388680
     gtcgcagaag caaagaggaa gtgtccgttt ctgctgtcac cccaggccca attnaggagc    388740
     ctcgtgcaag cttctcaccc atgaggagca gattcaccaa ggcacagctc gaaggacacc    388800
     ttctgcggac aatcacgtcc gcaaaccttt cttttgaggt cacngaagaa cccacattcc    388860
     gagaattgtt ggatctagtc tattccggac ctcaagcttt ggaggttccc tcgtcaaaga    388920
     agctccgcca ttatatgcac ganatagtaa ccacctacca agagtcacag ctgcaggacc    388980
     tgcccggaga ttccaaggta tcgatcgctt tgtgctgttg gaaaggtccg ttcgggcagg    389040
     actntatggc tattactgcc tattattttg ataaagagtg gagctaccga gaggtgctgc    389100
     ttgggttcga gctaatttgc aggtccgaga caggnaatga cccctgtgat caaatacttg    389160
     gactgatcca ggaaaanggg ntgcttcatc ggatattcag cgtgacagtc gactataggg    389220
     tcgatgagaa cctgatgctg tcattaagag agaagctcac ttcttctggt ggtatcagct    389280
     cttggcagtg ctttgttggg gttcctggca cagtacaggc cattcagctc tgccttcggc    389340
     ggtatatcga gaacatcaca agctccccag aaggggaaag ggttgagaat gtgcgagaga    389400
     tatcacacgc caatggttgg accgacccat cagatggcga cgaaatatca cacgttttgg    389460
     gaaaggtgaa anccctccat tctcttgact agaaaataaa atctgaccct tgctttcgca    389520
     gattcgatca tttgcaaaat ttgtcaacga gacccctagg aagcgcgatg agtttttgtg    389580
     tctccagcct gcatcgactc gagtcttgcc gttagacgat gcgaagtccc gatggaattc    389640
     ggtattcctg atgttaaaac gagccggcag actgcgaaga tatatcgacc aatactgcca    389700
     agagagtggg aatttacagt acaaattaac aagtacggat tggcgcaagg tcgactacct    389760
     tgtgcaactg ataatgccat tcattcagtt tactacggcc ctcctggcat cgagagaggc    389820
     gacagtccac aaggtctgtt tcgtgtttaa gatactaatg gagcatctcg acgagtcaac    389880
     ccgaatattg agaagaaaat cagcgccgtg gaagcgcaaa ctatctgagg cgtcgcatat    389940
     catcaagatg gaacttggag aagtatacga aaagacattt caaaaatttg gggtcatgta    390000
     tggccctgga actttcgttg ctccccaata caaggtgtcc gcattcgatg aggccacatc    390060
     atcgcaaggt ttgggccaac ccgagcgcta catcgagtat ctgaggatct ttcacctaca    390120
     ataccgaccg caaatgccca cgagcttgtc ttgcgtgaat ggactgtctt gttccccgca    390180
     attgttgggg cttgaccggc ttctgcaccc actagctggt ctggcgggta gctcaaggtg    390240
     tgggcaagat gaagttgatc aatatcttcg tgaaggtctg tacaactgcc cagtatattt    390300
     cctgttgact actgacacgc aacaggggtt ctcaatatct caccatgcgc ttactggaaa    390360
     gaccatcaac gcgaatggcc tgttctcact cgactggcgc gcgatctact ctccattccg    390420
     gctacaggag ctggcacaga acggcttctc accgttgcac aaaacatctg ccgtactcgt    390480
     gggggatctc tggacgagtc gaccatgcga gatttggtga tgtacgcgta ctcggaggga    390540
     tccgaatcag ggaagcaatc gatcagccgg gtgcaacgtg acatggcgag tgacgaagaa    390600
     tgggaggagt tcgaagtaga ggcagaaagg cctgaaccga tcagcgatga cgaatgggat    390660
     tcagccgaga tgagcgttga cgagcgctct ggggacgacg aaaacagtca ggcagagaca    390720
     gcggtactgg aaatcctacc tacagatggc atggagcagg atatgatggc taaaggcgag    390780
     gatgactcat tcctgcctcc gcctgtcaca cggctcatca ataacatccg aagaagattc    390840
     tcaggcggaa cgacagtaac ctagcactgt gcgtcatcat ttttgtcagt gttcatggat    390900
     tattcaatct gcctagcctg cgagaactgc gcacagatta aaactcatgt cgttaattta    390960
     caacaagccc gcaatcttca taggataaga tatcggatta atcggtcaag tgcaaccaca    391020
     tacggacgac cctcaagggc gcaagtatgg aaattagcat tgccagccct gttgcgatct    391080
     ctgaaagagg tgcgttgctg agcgattggc agacgaccat cgctgcccca ccctagctat    391140
     agcctaaatg ccaaattagc agggggtcga gttctgtaga attaccctgt aacccttaca    391200
     gtagttagat caacatctga gatgatatat cgtgcaatgc ttaatgtatg ggctcggagg    391260
     agacacagta ctgtatattt ttatgacatg tacagtagat cagagatagt tgccctttcg    391320
     gcttagccgc cgggcgttaa taaattgtgt ctgtgtcgtt agatcgtact tcccggttct    391380
     gaaatgggcg agataaggcg actgtctcaa gcgagttttc gtgcagaggt tgataaagac    391440
     tctaatttag ttgtaactct tcttgatgtt cataaccatg ttcatttgcc ttgactaccg    391500
     tatatgcgag agacatagcg ctggaaactc gttaattttg attgactgtc acaacgtaca    391560
     ctaatccacc aagcttagtg cttagatagt cgatgccgcg ccaccaatga ataactaaac    391620
     tgccaatttg agtactcgag gagcttaatc tccctattgc ctttggtaac caatctggtc    391680
     ctgatagacc atggtagctg ctgctcacgc gaaatcccag ggaaatgaag caagccatcg    391740
     tcccacacgg gtaacttgag attcatctct gtatttccag atgatgtagc gttcctcctg    391800
     tctcttccag gcttcccgga gtttgctttc cgccacattt ttactgccac acaaacgaac    391860
     aaagtcatct ctcggaatcc aggaaaagtc tccttgcagt agtcccctat caataatcac    391920
     gatatttctc cacttaattt taacccaaac ggcttttcgt aacttataga ttctgtccgg    391980
     gaattttctc tcttcgaatg caactccaca tatcccgaca acgttttctt ttgaataccg    392040
     ccaatatttt ccgaggtcgt tgtagtccct cagttgggtg attcgaacgt cgaaacttga    392100
     aacacccaac ctttcgctga caccgtggcc gtccgtatac tttgcgctga acttagccac    392160
     aaagtctgga ccgtaccgga agatgataat cggtgatcca cgaaaagtcc caaagcc