(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_2

ID   PENCW_2; SV 1; linear; genomic DNA; GRV; FUN; 39849 BP.
XX
AC   AM920419_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   02-NOV-2010 (Rel. 126, Last updated, Version 12)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c04, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920419.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..39849
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        join(2129..2232,2323..2600,2666..2691,2938..3405)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950845"
FT                   /orf_name="Pc04g00010"
FT                   /product="Pc04g00010 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP74095.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00018307C2"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVT0"
FT                   /transl_table=1
FT                   /translation="MVWCVLKALVRPPARSPAAXVGDSSRALLIQDKLSWNLRLSNLQS
FT                   RSMILARRISIXHKARSFILLLRCVVEPLRDDTTEKSKGRAKGYIANXSKHVIPEVDLP
FT                   RSTVDLANYGTMGEVLYHTLHEDESQISDMLLPQEKSHVLHGTTMCVNDHSLLDCHVNS
FT                   RQHGHNLNLENQQSDMHERRFKCKIIGCRMGFKREDHLERHTRSHLKEKPYVCWVPGCH
FT                   RXFSRRDNLKVHCTKTHTRRGGRNRYVATLDEASPDYDPEFRGQLSFDGRPLRFLAPIS
FT                   SVPEAKPLQP"
FT   CDS_pept        join(complement(4396..4512),complement(3942..4331))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950846"
FT                   /orf_name="Pc04g00020"
FT                   /product="Putative uncharacterized protein Pc04g00020 "
FT                   /protein_id="CAP74096.1"
FT                   /db_xref="UniParc:UPI00018307C3"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVT1"
FT                   /transl_table=1
FT                   /translation="MDAPQQLPDQDRVDRQPSEMPMENDEAYPQAVSDPQPPLEAILKN
FT                   PLAVEQFQXILXTLADXDRDDPKLAFQAARPVGLFRRLWASCEPKHSEGEIPDENDRAP
FT                   KEATAKXSXERDGFQLRPDEQLSSLVXLEEALEQTQERLISVLKDWNQSSRGDLAMLMD
FT                   IERCS"
FT   CDS_pept        join(5116..5356,5405..5931)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825150"
FT                   /orf_name="Pc04g00030"
FT                   /product="Pc04g00030 protein"
FT                   /function="nucleic acid binding"
FT                   /function="protein dimerization activity"
FT                   /protein_id="CAP74097.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR008906"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI00018307C4"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVT2"
FT                   /transl_table=1
FT                   /translation="MSAFDEATSSQGLGQPERYIEYLRIFHLQYRPQMPTSLSCVNGLS
FT                   CSPQLLGLDRLLHPLAGLAGSSRCAQDEVDQYLREGVLNISPCAYWKDHQREWPVLTRL
FT                   ARDLLSIPATGAGTERLLTVAQNICRTRGGSLDESTMRDLVMYAYSEGSESGKQSISRV
FT                   QRDMASDEEWEEFEVEAERPEPISDYEWDSAEMSVDERSGDDENSQAETAVLEIPPTDG
FT                   LEQDMMAKGEDDSFLPPPVTRLINSLRRRFSSR"
FT   CDS_pept        join(complement(6928..7014),complement(6698..6835),
FT                   complement(6566..6619),complement(6262..6483))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825151"
FT                   /orf_name="Pc04g00040"
FT                   /product="Putative uncharacterized protein Pc04g00040 "
FT                   /protein_id="CAP74098.1"
FT                   /db_xref="UniParc:UPI00018307C5"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVS8"
FT                   /transl_table=1
FT                   /translation="MYQTRCWMVLWYEARCDGVRSRDGDNTLEGSLALVIWHGFAGMYS
FT                   ISESPIQVELTSVFVRASATSRGQGVNSRTERRAKIPGVELIFLEIVRQQERQDPLNHQ
FT                   WQDGDEGQNGYCASIIWVGDLNDVPAGAQPLLLTAKDLESSASWARVPVRVNLMIEFCQ
FT                   LYS"
FT   CDS_pept        join(7142..7360,7406..7504)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048617" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950847"
FT                   /orf_name="Pc04g00050"
FT                   /product="Pc04g00050 protein"
FT                   /protein_id="CAP74099.1"
FT                   /db_xref="UniParc:UPI00018307C6"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVS9"
FT                   /transl_table=1
FT                   /translation="MAAEQKTIRTRHSNSLKSSRQKQARRRNSLLRKSFEHCRECDADV
FT                   FMMIRLKRNGKIQFFNSCAQWPLSRQQLASHYPAPREIAWHYMATEYAGGEGVSANEPT
FT                   A"
FT   CDS_pept        complement(7726..9930)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234740" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950848"
FT                   /orf_name="Pc04g00060"
FT                   /product="Pc04g00060 protein"
FT                   /function="ATP binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="lipopolysaccharide biosynthetic
FT                   process"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP74100.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009103"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="InterPro:IPR010440"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI00018307C7"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVT4"
FT                   /transl_table=1
FT                   /translation="MSGSSSPDYKALFLKAEEERQRAEEREKQAEERERQEAELRRQAE
FT                   ERERQQRERNRPTTFPEFIRLCHDLLWRPLRAQTPSRSTTGKIPAPIGKHCPLRLRPWT
FT                   DCEDKQRKIYESVCRYLQPIEGDARELFTSLVALEDHGRRFARRPISSEQDLETYERLA
FT                   VEDHVHDIVAELCKVPEAREEFRLGNGIWFDNHPNALDDDNEVDASQPSTTKPSKPDQF
FT                   CIYQRDGNRRTLLTTVEYKPPHKLSAANLRLGLRPMDFWREVVQPDRVPTEEPEKSRYH
FT                   AERLVGSAIVQEFHVMIQEGLEYSYLTNGLMDVQLWVPYDDPTTLYYHLGDPGIYGMAG
FT                   VAGAGIPRTRIERTLCLCLMSFRAPLRDQAWRNAAKDGLPKWRSILDSDRAQIVLVELP
FT                   RDLDMDGANSESASPEQSTSEYLTSSSPITSGPRVTTRAAASCAPLSGPHHHESSSDSE
FT                   ADPTSSAGRKRGFSQVTSSPPTQRSAPRADRQGKQSGQSRSHDAPYCTQKCLLGLQQGG
FT                   TLDPECPNTELHMLGGRVDRHPIGAADLVKRLKMQLDQDLDHNCTPIGPCGSSGAPFKI
FT                   TCATFRYTVVGKGTTSKLWGEVSREAEVYRVLQRAQGSAVPVFLGAINLAQTYFLHGAG
FT                   RIRHMLLMGWGGESVGHTTPDKTTQRAISRSVKEIRRFGVVHQDLRPENILWNAELQRA
FT                   LIIDFHLCTLDRRPLDRRPGTLKRLRHGSTEGHSKRVRVV"
FT   CDS_pept        join(complement(10638..10798),complement(10465..10602),
FT                   complement(10002..10320))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672452"
FT                   /orf_name="Pc04g00070"
FT                   /product="Putative uncharacterized protein Pc04g00070 "
FT                   /protein_id="CAP74101.1"
FT                   /db_xref="UniParc:UPI00018307C8"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVT5"
FT                   /transl_table=1
FT                   /translation="MNMVGKVDEPSTRSPEERSLVAWPAPPQLKDSTAARQQTICHWRK
FT                   APARRSSASTGHTAEGTTGAADQSLEPVFPEDPGSRRRRIQIPSFEMITAVNPFSRAFA
FT                   NGIDGLLISYVTSFRVSAPVPIHDGPDALLLTAPTCVGRCCDCTIGPGQTRSTKDHNME
FT                   VIWDIRGCHNRGTFQYKDKGGGGFRSEVAYGRINTFTEMPPS"
FT   CDS_pept        join(11329..11356,11429..12276)
FT                   /pseudo
FT                   /gene_family="HOG000234604" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(14234..14529),complement(14060..14184),
FT                   complement(13528..13913),complement(13451..13471))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950849"
FT                   /orf_name="Pc04g00090"
FT                   /product="Pc04g00090 protein"
FT                   /protein_id="CAP74103.1"
FT                   /db_xref="UniParc:UPI00018307C9"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVT6"
FT                   /transl_table=1
FT                   /translation="MIFNQTHYRIEWRVTVNNREVSKDTEEDVVLAPSAFWQLSLGKVL
FT                   EKALRRKTAHHRQVRSDDTVIVASTTDRTKQNLSKRLDDTDISWTAIEKQLLICFNYVE
FT                   NRRSSPSAGRKGEKRGKSSVTQRLLSERDAQIDVEEISHVEKGGVLESHKDVPEAVRDE
FT                   LYREEQDRLERDRPKGGHVTGPRLSYPPINIHLSSSPSAPHGLEISAPKVPDNLQPPSP
FT                   LDISSPRDVSVKEYGYWQVSNVENDSLKTVFREVCDVMLENGLDLEQVSLDVS"
FT   CDS_pept        join(15007..16168,16230..16468)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076478" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950850"
FT                   /orf_name="Pc04g00100"
FT                   /product="Pc04g00100 protein"
FT                   /function="exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP74104.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001830886"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVT7"
FT                   /transl_table=1
FT                   /translation="MDKKYSIRFYCPGCERENFRSLVGVRNHFLEKRHSLQCPVCEKTF
FT                   QDEMAIIQHYQSYYTKPASPGRPSDVHQVSPPSVLSSAAVTPVVRSISVHTDALEEPLR
FT                   PSEQRPRIPGGHLLHSLPVSMPVLNINEGPILGKEPRIYPLSNPRLIFISTKALPGVAP
FT                   STAAYPTDMNLLEQNLILRYLRSRCHTWNRLETEGYIIGPTTIRNKKRPRKGSIPTYQF
FT                   RETPRMELQAAGTICAIAIDCEMVGVRNGRQALAFLSAINFLTGEVLISRYVNPSEEVL
FT                   DWRYKFSGVTQGIMTSAVASGAAFRTWQEARDKLWEFMDDSTVLVGHSLQYDLEVLGIS
FT                   HAKVVDSAILTAETVYSSIPSTKPLTRNWGLKTLAKDFLGLNIQTSDRTQEDLKVWAEK
FT                   AQLQEEQKLARSRQRYGKSKSKGKFPATQSTPIWGHDTVFHDAPEDIRWWDPAEEFEWS
FT                   EGYDPWSD"
FT   CDS_pept        join(18319..18403,18686..18748,18917..19127,19186..19262,
FT                   19309..19514)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129517"
FT                   /orf_name="Pc04g00110"
FT                   /product="Putative uncharacterized protein Pc04g00110 "
FT                   /protein_id="CAP74105.1"
FT                   /db_xref="UniParc:UPI0001830887"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVT8"
FT                   /transl_table=1
FT                   /translation="MIPVPAQKSAVELAACRGEAEVRPSLLSEDVGFNRPQLRNVSFNT
FT                   SSQVVYIVDQQTRQFLYCKRRGSKQIHCPIYATDRRYAIWINWSRCLYEEVSAIASWST
FT                   VAALVDHKFEVQLPTLQIRRRSNTMHQSKGHSSSLVLTIRKLNLWELTRVALITLHYRQ
FT                   CSTQSHGLHTIPSPVASNNAACPRWKIANQDSESTTGCGNSSASFSRIEA"
FT   gap             23495..23594
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(25909..26258),complement(25741..25810),
FT                   complement(25605..25694),complement(25440..25517))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076477" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950851"
FT                   /orf_name="Pc04g00120"
FT                   /product="Putative uncharacterized protein Pc04g00120 "
FT                   /protein_id="CAP74106.1"
FT                   /db_xref="UniParc:UPI0001830888"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVT3"
FT                   /transl_table=1
FT                   /translation="MSPRSACGWPEWEEKNLLSWLDSHRGLPWKALSDAYYEEYQVYRS
FT                   VESLRGKKYHILRKQRRTGAKVPGHSGRQKRPGDVRRSLVDSGSRSTLPENTSAQRNID
FT                   KRFQTILAADPSQLREPAPLPYSPQRTRSSSWMWDYNVHTSSMTSTGALHCYVEGTVAN
FT                   YFDEIVLEGAITLVWNYNSSEKVPKSKVNIRA"
FT   CDS_pept        join(26796..27124,27187..27225,27258..27441)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076481" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129518"
FT                   /orf_name="Pc04g00130"
FT                   /product="Putative uncharacterized protein Pc04g00130 "
FT                   /protein_id="CAP74107.1"
FT                   /db_xref="UniParc:UPI0001830889"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVT9"
FT                   /transl_table=1
FT                   /translation="MGGIRKASRPLRRPDFRSRLQRALSLSSLESEDTGSVSSTATGDT
FT                   TSDESPSQEEYDSGDQENSDAADESEQEATRQQRTVFGHETDLGIRGQTQLSGDSNTVA
FT                   LECLTELHNRMGQVAVTTESIERLSHDQGAWNEAVRNDLVDILGRLAIVETEVQKVTGQ
FT                   GTNKSTEGQKTGRPMRRRQQ"
FT   CDS_pept        join(27556..27602,27698..27820,28023..28277,28355..28422,
FT                   28527..28594)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076482" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825152"
FT                   /orf_name="Pc04g00140"
FT                   /product="Putative uncharacterized protein Pc04g00140 "
FT                   /protein_id="CAP74108.1"
FT                   /db_xref="UniParc:UPI000183088A"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVU0"
FT                   /transl_table=1
FT                   /translation="MDTLIMDAELEGHWKRLCTPKLPRPSRGARRELLYVKVYLKPFIS
FT                   STIADDLYCLIQTYYGKLWIEEREEITTVVRKRSGGFSIRPIVTRPSIVLIGLSRCIPF
FT                   TWTTININSTDQRAKVFPISEAYLSGVILNPPRLRLYKVVNPPLTCAEHCIETPVLTRT
FT                   GGSLFMSYLRVDSIKKAILSTGN"
FT   CDS_pept        complement(28624..>29139)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076510" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950852"
FT                   /orf_name="Pc04g00150"
FT                   /product="Putative uncharacterized protein Pc04g00150 "
FT                   /protein_id="CAP74109.1"
FT                   /db_xref="UniParc:UPI000183088B"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVU1"
FT                   /transl_table=1
FT                   /translation="LHMMSIVEEEIQKAQEEREEERHKHCQLLEQLEAEKAEETSKLQL
FT                   VIAARDVALADNQRVGHEICELQQQLESTNAALQDQVPWNDIQLVLDQAHGDMVSTTTR
FT                   FWNTIDALQNRRLASYLPGSGVIHADWAEQSGPVTQGHDALLSLSESNVPLPSQQEPSA
FT                   TNQFGSLV"
FT   gap             29402..29501
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(30958..31009),complement(30591..30704),
FT                   complement(30325..30500))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076483" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950853"
FT                   /orf_name="Pc04g00160"
FT                   /product="Putative uncharacterized protein Pc04g00160 "
FT                   /protein_id="CAP74110.1"
FT                   /db_xref="UniParc:UPI000183088C"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVU2"
FT                   /transl_table=1
FT                   /translation="MESSTLLDYTNIPTTTSVAWYWWLFQRSTAGRAKLRCISCHLSAM
FT                   ALLLLVIAVIGRTGHHRHLGVVLAVNPVSQIGDRWVLGYLQLACGMWTGGSDKAIETRS
FT                   LLIVLSLKD"
FT   CDS_pept        join(complement(35324..35467),complement(34756..35271),
FT                   complement(34501..34707))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076484" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950854"
FT                   /orf_name="Pc04g00170"
FT                   /product="Pc04g00170 protein"
FT                   /protein_id="CAP74111.1"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI000183088D"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVU3"
FT                   /transl_table=1
FT                   /translation="MKLSTKSRLDSLVSTTALSFTVAVLVCLSFVFVGCSSSSSPKGLH
FT                   FLKVDLKEFPKLRDLQIRDSFNIDTARIESGGRNAVEGVASSIHTSANEAIHEATPAAS
FT                   SMVEAQIHEFKSHLPQYYLVGLWSYCKAKDGSEMVCSDPSTSFTFDLSAVLDSTPINLR
FT                   NILPDIDLSLVSGYRRFSQSVICLYIAGFVVTTLSGVLACRKVFFSKGSRPLAIFCTVS
FT                   SMLITTATIVVTGMYGVFASKVKNTLQPYGVEVTLGAKMFTTAWLAVFFSIGGSTIWLV
FT                   HLFCCCI"
FT   CDS_pept        join(35968..36783,36844..38298)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076485" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950855"
FT                   /orf_name="Pc04g00180"
FT                   /product="Pc04g00180 protein"
FT                   /protein_id="CAP74112.1"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI000183088E"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVU4"
FT                   /transl_table=1
FT                   /translation="MSFSRQSEVEHWEQKLYDYRESHFELSARVHISHLFFESGFRRRM
FT                   DGRQNIRRLTQLMKMQGCQRLMRDNHVPVLVPRAHWQDRVRPRSGGGIIPSLDMELDYR
FT                   LCAYDHENLITAARNFLDHDNQWWIVDVYLTDNEEGAFAQFQLSEIVVDKFIVSPDDHR
FT                   NETESIRHKFIQSLKERYPNDNRPPDGLIYERINRYEGYLDTPRDPLAANNWWAVLEAL
FT                   AGSKKGKYLKQFFKHETLHQKLNSLLIIPGLWGGMRIGLLHKLTAMHCDEPVACYWELI
FT                   FSTFSRLVGGREELLLLIDGVTVELLQSRVPKISRKDLQSLQVELEEGRLFPNFSEEAR
FT                   QDIWARLKEIDYPIPTLKTFFKDRLYLEVAQSVMKRLFVQPRGDKITIDQGVYGKYDTP
FT                   VPVSMALRQEWLGSDLLEFWRFSFQYGFEMTDHQRLKWPTDADPEDMLDRRSSGSSFLP
FT                   KQEIWRHFFTLVRARGFQAPVTDDTSFATGELPSPRVCEFPEDLAEEIEVAKRCGKPYS
FT                   NTVEADRFALSAETLRQSQASVRVTAGFLRQSVFKAFFGYLWNSNSQMAGGDPPDDNIE
FT                   VHHRGERPTTANVGRAMMATDGMDVDPGSLRPNPLVTSAARTHNAAATASPADILPPFG
FT                   VMTFTVGRTTRILDLPIHDSFMKDFSTGLFNNNFNVQTDEREKRSISPYTCYSHYLHNP
FT                   SSVLHAEFRQNEHTTYAIAPSQIGAGSKRRMLDEDEQMARAEIWLQEQIALLSDRRNGD
FT                   EDL"
FT   CDS_pept        join(complement(39379..39592),complement(38945..39329),
FT                   complement(38836..38890),complement(38599..38661))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076486" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978316"
FT                   /orf_name="Pc04g00190"
FT                   /product="Putative uncharacterized protein Pc04g00190 "
FT                   /protein_id="CAP74113.1"
FT                   /db_xref="UniParc:UPI000183088F"
FT                   /db_xref="UniProtKB/TrEMBL:B6GVU5"
FT                   /transl_table=1
FT                   /translation="MFRSLLTVIAILGQVQALDLRPLIQSTCNTVSSWHQAMGGSLNAT
FT                   LSTSGHTQSVSLSPDCEAEMESALSRCVDGPSIDCRSIAVSLDGQLPLMASVRQHAERA
FT                   AGDEVPSQQQGNCSCQSLPLNKETTRPESTQQQTSTNTESTGSATHTASSSCELPNISR
FT                   FASISASPSAPSETHGPTTIPSPKGSGELDLNTCLIKEADHREGGLCHCASGSAKLKPL
FT                   RFLGLWNLHLIVSCKI"
FT   mat_peptide     join(complement(39379..39541),complement(38945..39329),
FT                   complement(38836..38890),complement(38602..38661))
FT                   /db_xref="UniProtKB/TrEMBL:B6GVU5 "
FT   sig_peptide     complement(39542..39592)
FT                   /db_xref="UniProtKB/TrEMBL:B6GVU5 "
XX
SQ   Sequence 39849 BP; 10286 A; 9750 C; 9410 G; 10189 T; 214 other;
     ccaccaaaaa gacacgtcga agggtatatg ggcttactgg cacgcccaac caaccacccc        60
     ggcgtaatga aacgaggtct gcatggatgg ttccccgaac attcgtcaca tcggctaagt       120
     aggctctttc agcacagcaa aaacaccggc catgacgagt cacgatacag ccactcaggc       180
     ccagggctct cgctcatgca attaccctcc atataatcag gaaagccctc cccaagcttc       240
     cgtcgaggct ctccagaaag ccttgaaggc tcaagtctta cactcactca gggttttgcg       300
     caagattgct atggaccacc acgcacttaa cctggtccct gagatactag atggttgggt       360
     ggcggatatt gaaggagttg atgcaaaaaa tatcccaatt gcatccagca tggcggcgca       420
     gatgtctgtt ccgttcgaac gattcaccat tctcacgaaa tgcatcacag ctacgggccc       480
     gatgcaacag cttactatca ggcaccaggc aaccgagttg ctgaaatata tattgactta       540
     tgcggaggag tactacttag tccagggttc acaggtctat cttgatattg gtagatggat       600
     agaaagactc accaagacaa acatgaggaa gtgaaatgtt attatccaga gggtctggaa       660
     tattccattg ctctttctat gaaattacgt gtagaatgtt atcttcttct tttaccagat       720
     ctcttttcaa tattatggga atatgttctg taatgtcaca tatccgagtc ccagtgccgc       780
     tatcccccta ttagaacgat gaaagcttct gtcctttccc tgagatgggt ttctagggac       840
     tattccaatg ttttaccgat tgctcacctc ggtactccca tcgtcctttg cgacacagaa       900
     tgaacatcat catgtccagc tagtattatt ccagtgttat gggtgtcttg ctggttccat       960
     cattgtggtc gctagctggt tgggatgcac gggtgcgttg ggaagtttct tgtaaaaccg      1020
     atccctaagg cctcctctgg gctttgggaa ctggagtata tctgtttcac agatgcatta      1080
     ttggtacctc ttcatcatgt ggcacacggg attggaccga ttccttcaca gaaagaccct      1140
     gcaggaaaaa cgtaaatcat tagcctgtgg cttccactgc gaataatgat tccgaggttc      1200
     aacagagagt ttgtttcact gtactacctc catgaaaacc ctgttattgc attcgtggct      1260
     ttttgaaacg gcaggggaag gggaaagggg atgctggagg gggaggcgcg gtgaatagga      1320
     agccgacatt tcttgggcac atcatcgatc tagacgggat gcttaatcta ttaacccaac      1380
     ggtgagccat ttgccagtat ttcattctct tgctgcacgg tgaagatgca gtagcataag      1440
     agtatctgag aagttgcatt gctcacttgc ctgtgatatt atttgtgcac ggccgttgat      1500
     gggaaatgtc aaaaagggct ttcgattgtg tatttgtctg cccgtataag caaattagtt      1560
     caacttcctc tagttggata cctgttgttg agtcctgggt gcgaggcgtg agcttgagga      1620
     gagaagagat gaaccgctga ctgtcagttt taggtaagtc agactcacct gggccaccta      1680
     ctttccaccc ttcctaaagc atccgaccat cctagccctg cttgcctcat gccaccatta      1740
     gtcctcctac cgtcagatac aatccatccc cagttgcaat gtcacttctg cacggtttct      1800
     ctcttctgct atgctcaaat ttactgaatc atccaacttc ccccccgact aaagctcttc      1860
     gcacctgagt cggaaacgtc ttagccatca aggtatgaca tcttgctccg aactttggct      1920
     ggactggttt ggactttatc gtttgattgc aatttgctgg tccaaatgat aattgtcagg      1980
     cccatcgaac tactgacctc tcccatctgt ctcttcgtca aacgatcgct tgtctttgct      2040
     cgaccaagat gccgtatagg acaacggtga gcacgccacc ccaatatcac atacttcgaa      2100
     taaagggccg ctctcaacgg ctggtgtgat ggtttggtgt gtcctgaagg cgctagtcag      2160
     acccccggcc agaagccctg cggctncagt gggagatagc tcgcgcgcgt tgttgatcca      2220
     agataagttg aggtaagccc cctctgttta atctgacaca tatcgtacca tactcttgac      2280
     tctatctctt ctgctcaaaa ggatgtcgct gaataccctc agctggaatc tacgcctatc      2340
     caatcttcaa tcacggtcta tgattcttgc ccgcagaata tccatacncc acaaagcccg      2400
     ttcctttatc ctcctactcc gctgtgtagt agagccactc cgcgatgaca cgactgaaaa      2460
     atcgaagggg agggcgaagg gctatatcgc caaccnctcg aaacacgtta ttccagaggt      2520
     tgaccttcca aggtccaccg tggacttagc taactacggt actatgggag aagtactcta      2580
     tcacacactg cacgaagatg gtaaaaaaag cattgacgtg ggaagctaaa gcgtttattc      2640
     catggctaaa cctatatctg gatagagtca cagatatccg acatgttgct ggtaagcctg      2700
     aaagcacata tttctcatgt cgatattgtc gacttcttca aatgtgcatc cagaggcatt      2760
     cctctgacct gactgcttga tcccgcgtag gtcccgaaca acaaggtttc catatctctc      2820
     ttctccatat caccgcatat caccatttgn cttatgtgan cttgctggcg gaagctttag      2880
     ttgggcactt catagctgtc agtctgggtt aggccaatac cttggattct tgaccagcca      2940
     caagagaagt cccacgtact ccatggcacc actatgtgtg taaatgacca ttcacttctt      3000
     gactgtcacg ttaatagcag gcagcatggt cataacttga accttgagaa ccagcaatct      3060
     gatatgcacg agcggaggtt caaatgcaaa atcattggct gcagaatggg cttcaagcgt      3120
     gaggaccacc tcgagcgcca cacaaggagt cacttgaaag aaaagccata tgtttgctgg      3180
     gtgcctggat gccaccgtnc cttttcacgc cgcgacaatc tcaaagtcca ttgtacgaag      3240
     acacatacga gacgcggtgg tcgcaaccgt tatgttgcta ccctcgacga ggcgagcccc      3300
     gactacgatc cagagttccg tggccagctg tcatttgatg gacgcccact caggttctta      3360
     gctcctatta gctctgttcc tgaagctaag cctctgcaac cgtgaatttg ggcgataata      3420
     aacatcaagg acatattttg ccgacaacaa gtaggcggga ctaggtggcc aaagtaaatc      3480
     accgtcatcc aagctcanct gcttacgatg cgactaggga agaacctgcg gcgcaatgcc      3540
     ctgtcgccct gccaaccctc aagcttctcg tccattgttt ctgcctacaa aagtgctttg      3600
     tcgtcaaaca tgccgaatgt atacaacatt aggacacaca ccgatagccc caatagtgca      3660
     aaggtggcac ctaaataata ccactgcccc tgccattcct ggattcgtca atttgcaaat      3720
     tatcttcggg caaattactg gtcacggcag tccagctcgt tcaaaactgt ttgacaacat      3780
     atccgaggct cgtcaataat cacacatagt tgcaatctgc tccgtactat aaatcaagac      3840
     actcagttaa aattcggata ctacatttga ataggttgtc ttccatgatt ttccggcctt      3900
     ggctgctata ttccatgaca cattcctccg ctggcgacct ctcacgagca tctttcgata      3960
     tccatcagca tggccaaatc acctcgagag gattgattcc agtccttgag cacgctgatc      4020
     agtctttctt gagtctgctc taaagcttct tccaaggnaa ccagactaga tagctgctca      4080
     tcaggacgaa gctggaaacc atctcgctcg tngctcantt tggcggtagc ttccttcgga      4140
     gctctgtcat tttcgtctgg tatctcgccc tcggagtgtt tcggctcaca cgaggcccat      4200
     agacgtcgaa agagtcccac gggtcgagcc gcttgaaagg cgagtttcgg gtcatcgcga      4260
     tcganatctg ccagcgtcnc cagtatggnt tgaaactgct cgactgccag ggggttcttt      4320
     aggattgctt cctgctgcaa cgagagaatg tagtgattag ccacggtata gaacgtgtca      4380
     tcgcgcgtag cttacaagtg ggggctgggg atcggaaacg gcctgcggat aggcctcgtc      4440
     attctccata ggcatttcac tcggctgacg gtctacccta tcttggtccg gtagttgttg      4500
     tggggcatcc atcgtgttca cttgcaaaga ctcagggccg aaaacatata attaccagct      4560
     ggcgctggtc tttcttataa gccgtacagg attaaacagt tagttcaacg ttaaggtggc      4620
     ataaatcgtt caatgcaacc ttgatccgac acatgctgga gacctccttg aacatttatt      4680
     ttcaacgttc ggacttgata taaccaattt ctttctttgg tcaattttct atttttcatt      4740
     gtaccatctg ctcaccattc gacgaaacct gagggacaaa gaaaggggaa aaaggaattc      4800
     ctccgctgat tgtatggtga ccgttgtgat agtaagaaat tgtcgaggtc attaccttcc      4860
     ccatagtttt gcaactgttg aatatcaata acctccgaaa ttttaccgct gttagtaagg      4920
     tatattccgg cgatacgtaa tctttttcca gggctcctcg cactatctca cccactcgtc      4980
     tactcagaaa ctgcctcttg catttgggct gtaggctgtt tcttggtgct gtggagtgtg      5040
     gtcgttgagt caacgttagt gcatcaaccg tttacaataa cgtcctttct tcaccgaatg      5100
     tgtcgccaat ataagatgtc cgcattcgat gaggccacat catcgcaagg tttgggccaa      5160
     cccgagcgct acatcgagta tctgaggatc tttcacctac aataccgacc gcaaatgccc      5220
     acgagcttgt cttgcgtgaa tggactgtct tgttccccgc aattgttggg gcttgaccgg      5280
     cttctgcacc cactagctgg tctggcgggt agctcaaggt gtgcgcaaga tgaagttgat      5340
     caatatctcc gcgaaggtct gaacaactgc ccaatatttc ctgttgacta ctgacacgca      5400
     acaggggttc tcaatatctc gccatgcgct tactggaaag accatcaacg cgaatggcct      5460
     gttctcactc gactggcgcg cgatctactc tccattccgg ctacaggagc tggcacagaa      5520
     cggcttctca ccgttgcaca aaacatctgc cgtactcgtg ggggatctct ggacgagtcg      5580
     accatgcgag atttggtgat gtacgcgtac tcggagggat ccgaatcagg gaagcaatcg      5640
     atcagccggg tgcaacgtga catggcgagt gacgaagaat gggaggagtt cgaagtagag      5700
     gcagaaaggc ctgaaccgat cagcgattac gaatgggatt cagccgagat gagcgttgac      5760
     gagcgctctg gggacgacga aaacagtcag gcagagacag cggtactgga aatcccacct      5820
     acagatggcc tggagcagga tatgatggct aaaggcgagg atgactcatt cctgcctccg      5880
     cctgtcacgc gactcatcaa tagccttcga agaagattct ccagcagatg acagtgatct      5940
     agcagggtgt gtcatcattc ttatccagca tttgtttgct agaatccggc cccacctttc      6000
     cgcagtacaa attcattgtc gttgatttac aataaatcgt tccaacgaag aatgcatcat      6060
     attaatagat cctgtggaaa gcgcacgata taggacagtc aatgttacaa ttctcacctt      6120
     tagcactgcc agtcttgttg cagcggtcat aaaaatgtgg ttgcgacgag cggacgccct      6180
     gcagcttgta ggtagtcagt gattacttgt aactctttca gtgttcgcaa atatctttat      6240
     ttgcttttac catcatgtct gctagctata gagttggcag aattcgatca ttagattgac      6300
     cctcacagga accctagccc aggaggcact tgattctagg tccttggcag tcagtaacaa      6360
     gggctgggcc cccgccggca catcattcaa atctccaacc caaataattg aggcgcaata      6420
     tccattttgc ccttcgtcgc catcctgcca ctggtgattc aagggatcct gtcgttcctg      6480
     ctgctgtatc tagagtcaac tatagttgtt cttaatattg attgttcatc ttgaaaaact      6540
     atccacctct atgtatacgt gagaccctca caatctccag aaaaatgagt tctacccctg      6600
     ggatcttcgc tctacgttcc tgactgaaca aaaagctcgc tttgggaaca cattggttag      6660
     atctgggagc tgtggcgccc ctgggaccct actttacggt cctagagtta acaccttgcc      6720
     ctcttgaggt cgcagaagct ctcacaaaga cactcgtgag ttctacctgg atagggctct      6780
     cacttataga atacattcca gcgaacccgt gccagatcac caaagcaaga gaaccctttg      6840
     gatgcaagat actccacgag attgaacaca actaacaact gattttcttc cttagatatg      6900
     tgcgcctgaa ggacgactcc atcgcacttc caaagtgtta tcaccgtctc tcgaccgcac      6960
     cccatcgcac ctcgcctcat accatagcac catccaacac ctagtctggt acattgtgag      7020
     cttctttcat attcgatcct aagaaactat ggatccgcat cgacgcttct cagaggtatt      7080
     tgatccccag atatcctctc gaatccagag acgccagtga aagaatccgg atctatatat      7140
     aatggccgcg gagcagaaga ccatccgcac acgccactcc aacagcctca agtcgagtcg      7200
     ccagaaacag gctcgtcgaa ggaacagcct cctccggaag tcattcgagc actgtcggga      7260
     atgcgatgcc gacgtcttta tgatgatacg gctcaagcgc aacgggaaga ttcagttttt      7320
     caactcctgt gcgcaatggc ctctatcacg acagcagctt gtaagtgttg gtcatcagtt      7380
     agtagcagct cgctgaccga cgcaggcctc gcactaccca gcgccgcgag agatagcatg      7440
     gcactatatg gctaccgaat acgccggtgg agagggagtg tccgctaatg agccaaccgc      7500
     atagcggcaa cagggagacg tttccacgga tggggagtgg ctacggatat gactctcgta      7560
     ccgagcagac ttcgtggtca agatctcttg ttggttaatg aatgagtcct taagataccg      7620
     gcatgaatag aggattatgc ccagcaattg ccgctcttca tgtgtaggct atgcgtagcg      7680
     atggttgact tttcatgtcg ttctcgcaga cccagtggcc tttactcaca ccacacgcac      7740
     ccgcttggag tgaccttctg tagaaccatg ccgtaatcgt ttgagtgtac ctggccgtct      7800
     gtccagcggt cgacgatcca aggtgcacag atgaaaatca atgatcagag cccgctggag      7860
     ctcagcattc cacaagatgt tttccgggcg aaggtcctgg tggacaaccc cgaaacgacg      7920
     gatctccttc actgaccgag agatcgcacg ctgggtagtt ttatccggag tagtatggcc      7980
     cacgctctcg ccaccccagc ccatcagaag catatgacgg atcctccccg cgccgtggag      8040
     gaagtacgtt tgggccaagt tgatcgcccc gagaaagacg ggaacggccg atccttgggc      8100
     acgctggagg acccggtaga cctcggcttc gcgcgaaacc tccccccaga gtttcgatgt      8160
     tgtccccttc ccgacaacag tatatctgaa ggtggcacac gtaatcttga atggtgcgcc      8220
     ggaggaccca caagggccga tcggagtgca gttgtgatcc agatcctgat caagctgcat      8280
     cttgagcctt ttcaccaagt cagctgcacc gatcggatgg cggtccaccc ttccaccgag      8340
     catatgcagc tccgtgttgg ggcactcagg gtcaagcgtg ccgccttgct gtagcccgag      8400
     aagacacttt tgtgtgcaat atggagcatc gtgggagcga gattgcccgc tttgtttccc      8460
     ttggcgatct gctcgcggtg cggaccgttg ggttggaggg gatgatgtga cctggctgaa      8520
     cccccgcttg cgtcctgcag atgaggtagg gtcggcctcg gagtccgaag aactctcgtg      8580
     gtgatgcgga ccggatagtg gcgcgcagct agcggccgct cgggtggtca ctcgagggcc      8640
     gctggtgatg ggggacgagg atgtgaggta ctcagaggtt gattgctcag gactagcgga      8700
     ttcggagtta gcaccgtcca tgtccaggtc ccgtggtaat tccactagta cgatctgagc      8760
     gcgatcgcta tcaaggatcg aacgccattt cggtagcccg tctttggccg cattccgcca      8820
     cgcctggtca cgaagaggag cacgaaaact catcaaacag aggcacaggg tcctctcaat      8880
     tcgagtcctg ggaattccag cccctgcaac acccgccatc ccgtatatac cgggatcacc      8940
     caggtggtaa taaagggtgg ttgggtcgtc atagggcacc cagagctgca catccatcag      9000
     gccgttcgtc aaatatgaat actccaaacc ctcttgaatc atcacatgaa attcttgtac      9060
     gatggctgat ccgaccagcc gctcggcgtg atatcttgat ttctctggct cctccgtcgg      9120
     aacacgatcg ggttggacca cttctcgcca aaaatccatc ggtcggagtc ctaaccgcag      9180
     gttcgcagcg gagagcttgt gggggggttt gtactcgacc gtggtgagca aggtacgccg      9240
     gttaccgtcc ctttgataga tgcaaaattg atccggcttc gaaggctttg tggttgatgg      9300
     ttgactggca tcgacttcat tatcgtcgtc cagagcgttg gggtgattat cgaaccatat      9360
     tccgttgccc aaccggaact cctcacgagc ctctggtact ttacacaact cagcgacgat      9420
     atcgtgcacg tggtcttcaa cggcgaggcg ttcgtaagtc tctaggtcct gttcgctgct      9480
     aatcggtcgg cgtgcaaatc gtcggccgtg gtcttccaac gcaaccagtg acgtaaataa      9540
     ctctcgtgca tccccttcga ttggttgcag gtagcggcag acagattcgt aaattttccg      9600
     ctgtttatcc tcacagtcag tccacggacg tagtcgtagg ggacagtgtt ttccgatggg      9660
     agcggggatt ttgcctgtcg tggagcgaga cggtgtttgc gctcggagtg gcctccaaag      9720
     gagatcgtgg caaagtcgga tgaactctgg aaaagtcgtc ggccggttgc gttccctctg      9780
     ttgtctctcc cgctcctctg cctgccttct gagttcggct tcctgccttt cgcgttcctc      9840
     tgcctgtttc tccctttcct cggcccgctg cctttcctcc tctgctttca ggaaaagcgc      9900
     cttgtagtcc ggggagctgc ttccactcat tgatatcgtt aataagggat ggaaaagatg      9960
     gaaagctcca aggcgacgtt ggtggtcggc tcgtccctct gtcagctggg cggcatctcg     10020
     gtgaaagtat ttatccgtcc atacgcgact tcgctcctga aaccccctcc ccctttatct     10080
     ttgtattgga aagtcccacg attatgacat cctcttatgt cccatatgac ttccatgtta     10140
     tggtcttttg tcgagcgcgt ctgccctgga ccaattgtac aatcacaaca cctccccaca     10200
     catgtcggtg cggtaagcag aagtgcatca gggccatcat ggatcggtac gggtgccgag     10260
     actcgaaatg aagtgacata cgagatgagt agaccgtcaa ttccattcgc aaaagcccga     10320
     ctaaaatcca atttttgtta gcatagcttt ttcattgtgt cttcttcaag agagtagtct     10380
     cattaaactc aatggactta ttttcgaagc acttaaagct gcgggagcat ttgcctattc     10440
     cagccacgga gcgcaaagaa tgacctaaat ggattgactg ccgtaatcat ctcaaagcta     10500
     ggaatctgaa tccttctcct tcttgaaccg gggtcttccg gaaaaacggg ttccaaagac     10560
     tgatcggcag ccccagtggt tccttctgcc gtgtgacctg tcctggtcgg ctccagtact     10620
     taagttaagg cacgtacgat gcactcgacc tgcgggctgg tgcctttcgc caatggcaaa     10680
     ttgtctgttg ccgcgctgct gtgctgtcct tcagctgggg aggagctggc catgccacaa     10740
     ggctcctctc ttccggagat cgagtcgacg gctcatcaac ctttccgacc atattcatcg     10800
     ttgtctaaca ttcgttgtta ctgaaccttt gtatcaacta cgctaggcct tcaacatgct     10860
     ctgccctcca caagatgctt tccaggttgg ctgatctgta tacgctgccc tcgtctacgg     10920
     atacgtgaga ccctcgcagc atcatctccc gtttaacgga gctatacagt tcactcctgg     10980
     gagctgtagg tcttctggga actatgattt ttatattctg ggagcaagta gtgtatctgg     11040
     ggactatgcg atggatcatg gatcgaatat tatgctagga agagatcgaa tgaaacgcac     11100
     tggtcctttt aattatgagt tgtaagtggg ggaaacaaca agggatcagc tgcagttttg     11160
     cgaccgaaaa ataacagggg cggatgggca gtcggcgagt ccgattgggt tggcgaaatt     11220
     gcatgggcgg gcaaaattgc aggggcgcag cgatgagtgc aaaatagaga ggcagaagaa     11280
     cggaaaagtg agagaaaggg aggaagagga gggaagacgg gtcttcttat gccggagggc     11340
     attgacggta ggttacgtga cggcgtactg gggcgctaaa ccaaaaaggg ccaaactaac     11400
     cacatacagt aatccacagg tccgccgttt acaccgcata tcattgatgc ccctcaaacc     11460
     cgaatcggcc gaaaacgaac cgttacaccg ctgatgatca aggctcttcg tgatcacttt     11520
     ctgggaagcc tagtctctac cccgatgaga tggcggtctt cctgtgggat gagtttcaag     11580
     ccatggttac aatttctagc attataagag cccttgtagc aaggtattgg tcgaaaatgg     11640
     cagcacgcca gcgcgctaag gagcagaatg cggacttgag agactactac ctacacagtt     11700
     tatgggagtt tcagtcatat aacctggata tatgttgatg gatctggatg tgataaacgg     11760
     gtcggattca ggcgcaccgg ttgggcaacc tcattgacaa cgctgctcta caagtgacac     11820
     agttgcaccg cgaccagcga tattgaatac tacctgcgta cactcaagat ggaatcctcc     11880
     tctcgcgtgt attccgcagc tctacatatg ctactgtgtt cgagggcttc atatcccagc     11940
     tcctcctgta ttgcagaagg tagccagagc ctaaattcgt cctcgtgatg gataacgcat     12000
     tctccaccac tctgaacggc ttctacagat gtgtgggagg ccgggatgaa attggtttac     12060
     ttgccaccct attcgccgga tctgaatcca cttgaagagt tttttgctga gcttaaaagt     12120
     ttcaataggc gtaattggaa ttactatgaa agagacctta gttaaggatt tgatgttttc     12180
     ctggaatggt gcattaacgt ggtcggtgcc aaggaagaaa atgcccgagg ccattttcgc     12240
     catgccggcc tggaaatcaa cgtctgtcac ccttgacatt catccgcgca gtgttgttgt     12300
     ggcacaattg cagcaaaggt ccgtggaatt gtcctgtagt gaagattgat tagaaaaggt     12360
     accgtcttta gcgtccgttt taaaacctta cattgcaccg atataaagtc ccttagaaac     12420
     cacgggggct caatgaagac gcagagatgg gtccactatt aaggacaaac ttcccatcat     12480
     agtctgtcat gggctcgtag aatgaacagc ccccagtggc gcacgtataa aatatcaatc     12540
     gtaagaacca cggaattcca ggctccggat tttggattcc acgtctactg aactgcattc     12600
     cgtggtcgca gaagcacgta ggattttcca tcaacacgcc tcgcatatct ccaaagcaag     12660
     agaacgtttt ttgagggatg cacgagcaga tatagtatgg acgaccctca ttgccgttct     12720
     ggttccaagg tttaccgtac ctaagctcgg tggactcacc acaaaggcgg cagcgaggtc     12780
     gtttgcggat tgcaacatga gcctgttcag gatcgacgaa atccatggct tggttcatgg     12840
     ctgaaagatt cacaagccct ttcaatgcta ggggagtttg tgagttgtgt accgggaaca     12900
     ggaacaaagc agcagtagat gatggagtgg tgaagtacta gcctcagaaa acaactgacg     12960
     actgttcacc atgccgcata ttaaatagga aagcggaggt gggtcatctc agtcgtggct     13020
     gtcaaagagt ggaaccacac ggtaaggcga tcccacgtag ctaactgtag cttggccgca     13080
     atttccggtc cccgcccgtc gcattttttc tctccgccca tcaattattt gccttgcgac     13140
     gcccacccta tctccccggt gcgtccttac tttttgatgc ttaattttta atgaagctga     13200
     acagaaccgg gttttttttt tgttcttttt tctgttcttt ttttttggtt ttacgtattg     13260
     ggttcaaatt gaaatagaat acgcaacgat gattttctat gacaacaatc aggtgctctt     13320
     attcttgcag gaatcatcaa acacaccgcc agatagtgca ttggcgccca gatgaagcca     13380
     tatgcagact aaagaatttc aagaacatgt atcgcgttct tcgcgttctg aattcacttc     13440
     ccaatatcct ctacgaaacg tcgagcgata cctattttaa ttcctttcgc aatgaagaaa     13500
     ctaggatcct gatttctgta cacctacctg ctcaaggtca agaccatttt cgagcatcac     13560
     atcacacact tcccgaaata cagttttgag ggagtcattc tcgacattcg acacctgcca     13620
     ataaccgtac tctttcacag acacatctct cggactagaa atgtcgagtg gacttggagg     13680
     ttgcaaatta tctggtacct tcggagccga aatctcgagc ccatgaggcg cagacggcga     13740
     ggatgaaaga tggatgttga taggtggata tgataaccta ggccctgtga cgtggccgcc     13800
     cttaggcctg tctctttcta atctgtcttg ctcttccctg tataattcgt cacggaccgc     13860
     ttccgggacg tccttgtgac tttctaggac accgcccttc tcaacgtggc ttactaggcg     13920
     tttgatgtga tgagatttga gtgggtagta cttttttcca ttgggtctac ccagaaatga     13980
     gggccgcgct gatacgtcga cgagtcacat cgcatcagac tagagacgct gtgtcaaatt     14040
     ggcttcccac cagaagtact ttcctctacg tcgatctgtg cgtccctctc actgagcaat     14100
     ctttgcgtga cagatgactt ccctcttttc tctcctttcc ggccagcgga tggagacgag     14160
     cgacgatttt ctacatagtt gaaactgatt ttcaacgtta gttctttacc acggagtaga     14220
     agcgagctct gaccatatca gaagctgctt ttcgatggcg gtccaggata tatcggtatc     14280
     gtccaatcgt ttgctcagat tttgcttggt acgatcggtt gtcgatgcga cgatgacggt     14340
     atcatctgat ctcacttggc ggtgatgagc agtcttgcgt cgtagagcct tctctaacac     14400
     tttccccaag gacagctgcc agaaggcgct aggtgccaaa acgacatctt cctccgtgtc     14460
     ctttgacact tccctgttat tgactgtcac tcgccactct atacggtagt gagtttgatt     14520
     gaaaatcatt ggttccacgt atagataatg cgggaattaa ttccgatggt gcggcttgac     14580
     tcctgacctt gcaccagcct catatcacaa cattaccaga tggcggtact gaattctctc     14640
     taagcggaca ggcctcggta aaaccaatca aaaccacacg gggaaaataa agtggaaaga     14700
     gtgcatatcc cctgcgtgga ataattttca actagtggct ttgccacctg tagagcagac     14760
     cgagataatg aaatcgcatg gccgcgcagc agttgtagat aagcagcgtg tcgcagcata     14820
     gttcgaaaac ccctgtactt gccagtagtc tctggccgca gcatgcatga atttgactac     14880
     gtgtatgcct tgggcgccag gctaagtgtt gggcagacaa ataaagagcg cgacatctct     14940
     ctacatctgt tcttcacgcg gggtctgcgt acggttatca ttccgagcag cttcaatgtt     15000
     acgaacatgg ataaaaaata ttctattcgg ttttactgtc ctgggtgtga gagggaaaat     15060
     tttcggagtt tggttggtgt taggaatcat ttcctagaga agcgtcactc tctccagtgt     15120
     cctgtttgcg aaaaaacttt tcaggacgag atggcgatta tacaacatta ccaaagctat     15180
     tataccaagc cagcctcgcc gggtagacca agcgatgttc accaggtatc accaccaagt     15240
     gtactatcaa gcgcagcggt gacacccgtt gtgcggtcaa tatctgtcca cacagatgcc     15300
     ctcgaggagc ccttgagacc ctctgagcag cgaccgcgaa tcccaggtgg tcatttgtta     15360
     catagtttac cggtctctat gccagtatta aacatcaacg agggccctat actaggtaag     15420
     gagcctcgta tctacccact gagtaatccg aggcttatat tcatttcaac aaaagctcta     15480
     ccaggtgttg cacctagcac tgcagcttat ccaacagata tgaaccttct ggagcagaat     15540
     ctcatcttgc gatatctacg ttcgaggtgc catacctgga atcgtcttga gacagaagga     15600
     tatatcatag gtcccacaac cataagaaac aagaaacgcc cacgcaaagg atcaattcca     15660
     acctaccaat tccgagagac acctcgcatg gagctacaag ccgcgggcac tatttgtgcc     15720
     atcgccattg actgtgagat ggtcggagtc agaaacggcc gccaagcact tgcttttctc     15780
     agtgcgatca actttttgac tggcgaagtg cttatcagtc gctatgtgaa tccatccgag     15840
     gaagttcttg actggagata taagttcagt ggtgtaacgc agggcatcat gactagcgct     15900
     gttgcctctg gtgcagcatt cagaacctgg caagaggcac gcgataaatt gtgggagttt     15960
     atggacgatt caaccgtgtt ggttggtcat tctctccagt acgatcttga agtactaggc     16020
     atatctcatg ctaaagttgt tgattctgcg atattgactg ctgagactgt ctactcttcc     16080
     attccatcga cgaagccatt gacccgcaac tgggggttga aaacacttgc gaaggacttt     16140
     ttgggcttga acatacagac tagcgatcgt gggcataatg ctttagaaga tgcatatgca     16200
     gcacgagatg tcgtcatctg gtgtatcagg aacccaggag gatcttaaag tatgggcgga     16260
     aaaggctcaa ctccaggaag agcagaagct cgcacggagc cgacaaagat atggtaaaag     16320
     taagtccaag ggcaagttcc ctgccaccca gtctactcca atttggggac atgatacagt     16380
     attccacgat gcccccgaag atattcgatg gtgggacccc gcggaggagt ttgaatggtc     16440
     cgaaggatat gatccttggt ctgattgatc ctggaattgc gctcatggat ttcctgaaat     16500
     atgcgccatt tctagtcatg ccttccctcc tctaccgctt tactttgtgt tgttgattga     16560
     ctttggaacc attctctttg aatagccttt taaacttcat atctggttct ttgcccaaat     16620
     tataccgcat tatcttctcc tgctgggtgt agcaaataga tattaaaaca cttttagcaa     16680
     ctggttttat ttcttatcag ggcccattta tggcgctagt gtgtagcatc atactcaggc     16740
     tacgaaagtt tatcatccct attcagttat gattcctact gcctactaga attgtcaagt     16800
     tataacaccg tactcacttt tccttttttt ctttaaaaag aaaaaaaaaa aaaaagaaag     16860
     aaagtccaag cctgactaga acctagagaa gtaaacaatc ggaatcattt tactagtatc     16920
     catggccaac ggattaaaac catttaacgg ctctacaata cgctctgact acgaaaatcg     16980
     agaatgcagt gtttatcccc taaattggtg tgtggctaag aatttggggg gatgtgtata     17040
     gtaactctag gaggaaaaga agagaaagga acaaagaggt cctaggacct atactgtgaa     17100
     attctcaatg aggaggaccc tgggcgctct cataaagcgg gctaggtaat ggctgcagcc     17160
     taaaatccac tacatacagg tacatatggc tataaattcc cctagcttgc cctcattctg     17220
     tgtaataaga gatgaataaa taactgctcg gcatccagct ttccatccct cccagcccac     17280
     attaaatcgc tgctttacac acttccatat tctccctaca gcgttcgacg gccagtcata     17340
     tagcagaaat gaacgaactg aacaacaatg gtctataccc gttgccttga taatatcttg     17400
     cgctaacatt actagtctac gatttggatc tcgaccttca cgctatctga catgaatctt     17460
     ctggcatacc gacaccgcct ccctgtctcg ctactgatcc caatgatcag tggcaggatt     17520
     cttttggcaa agacgaccct gcagaatacg aaactcaaga gccttccttt atcgaatgcc     17580
     ttttctatcc caatctcgac agtctgtccg ggttcaagtg gacaggtcca gatcctctga     17640
     ctaactctac tcgggctagt gagatttccc tccacatgtc agcgctcctt ttccctaaag     17700
     aggtgcactg ggtagaattt cggtttgtgc gatttgaccg gatatctggt gacactatag     17760
     gagaggatct gttcttcctg ctacgggttg aaacggccat ggggaatctc tatcggatac     17820
     gcagacagct acaagacaca atcacctggc atgctgtccg tgcaaccggc actggcttcc     17880
     gactgtccct ttggcctcgt gcggaatctc taccgtattc gagtttctcg acacattccc     17940
     tgttgactag gctttccccg gcgctacccc tggacccacg gttttttgta catattatat     18000
     cgagtaatca agggtgaggt tgatctgaat tgagggggtt gttcgtatac acatttcagt     18060
     aaaaaccacg ataatgagta atgactgttt ggtgcccctc ttgttagaag tctcgggaat     18120
     atataacctg ctttgcatgc ggtgtaattt cccttacact acgtcgcatc ttgtagtatt     18180
     tctatgttgc caatatagga gagggcaacc cggaataggc actttcttac tcttctgttg     18240
     caacgtccgg tagccctgtc agattggaac tggaggggta gttccagtca tctagtaggc     18300
     tagtcagtcg ttcccgagat gattccagtg cctgctcaaa aaagcgcagt cgagctagct     18360
     gcttgtcgtg gcgaagctga agtccgtccc tctcttctct caggtgtgta ccagcctcct     18420
     tcaagttctg attgctctgc tgcagttcct ggccaccgat atgcttggac acacacgact     18480
     cccaaacata tgaggtgact aggacaagga atatgtgcct gtcattgcgg attgattccc     18540
     ccacaaagcc tcagttcaag agggacgtga aggattcaac agtcagccaa cgttgcttga     18600
     ccgactcaac accactctta ctcgtctctc tcgcttagca cgtaaaacca tcaaagatgt     18660
     cgctgcaaat aattgcggta aaaagaagac gtgggtttca acaggcctca attgagaaat     18720
     gtgtccttca acacttccag ccaggtcggt gagtgacaga ggccgaaaag cctataaata     18780
     cgtcctctac ccctgcaatc gctctactat ttattcactt gattctgcaa agccgagcag     18840
     gcttgttgtg tgacgcactc gataagttcc cccctttgat cgagtactgg agtttatacc     18900
     gtgctgacat ttatagtata catcgtggac cagcaaacca gacagttcct gtactgtaag     18960
     agacgtggtt ccaagcagat tcactgcccc atttacgcca ccgatcgaag atacgcgatt     19020
     tggattaact ggtcaaggtg tctatacgaa gaggtctctg ctatagcgag ctggtctact     19080
     gtcgcggctc tggttgacca caaatttgaa gtgcaactgc ccacactgta ggtatatggg     19140
     cccacaaatc cttgaaactg cactgacccg aaagacgcgg gacagccaga tccgtagacg     19200
     ttcgaacaca atgcaccaga gcaagggcca ctcttcatcc ctggtcttga ccatcagaaa     19260
     atgtgagtta tggaattcca cgctggtcta ctggctaata attgacagtg aacctttggg     19320
     agctcaccag agtggccctg ataaccctgc actaccgtca gtgctccacg caaagccatg     19380
     gcttacacac tattcctagc cccgtcgctt cgaacaatgc agcatgtcct aggtggaaga     19440
     tcgcaaacca agatagcgag tcaacaacag ggtgcggaaa ttcaagtgca agctttagtc     19500
     gcatcgaagc ttgaggcgtc cgtccttcct gatagtgagt tatcgcgtct tctgctgcgc     19560
     cggtccgatt gaatatacca agccttgtgc ccaaaatcac gacaccactg acaccttcac     19620
     gctattatag gagcactcca tcatcgaggg tgaaatatac tgtggcgagt ggcctaattc     19680
     cgccagatcg aggataagac caaggtggcg gccgacgagc gtgcttcatc gcgtcttccg     19740
     ccctcgtccc caccgccttc gcactattgt ggagtcctga acctctggca tcgcgacaca     19800
     ttcatccacc atggaagtgc aatgtttatc gcgggtgggt tcgtaacgcg tttactgtct     19860
     caacaaattg tcttgtgcat cccagggcgg cttttttgaa gcgagtgcag attgcgatga     19920
     gcttgaatgc gacgtggcat ggctggtgac tgcattgcag agagttgtaa gtgatctagt     19980
     tgtgaagccg atataatcat tgcgcaaact gattgtcccg tctcaagcgc acttgggatt     20040
     tccatgaaaa ggtacgctac ggcgactcgt ccaactaggt caatccttgc tgcctcggat     20100
     cgtacaacag gagaacaccc tcgtttctgt cactcgagtc gaatgccacg cgaacaaata     20160
     tcttgtctgc tcgagctccc ctatacaatt acgattgcat gctctctgtc ccttccacat     20220
     gaatactatc gacgatgagt caccagaagg ttcgtatcgc gtacctcggc ctctttctcc     20280
     ctattgattc tgtgtatcag gtcattgttc gatttgtcta catgatacaa ctcttgaact     20340
     ccgatcagcc tataccacta cccgaatcat acctgtggct aagcatgcaa cctttcaaat     20400
     atcttcaagt ggcgtaggct gctggtatcg aatgcttgat cctcgttgtc ttcggatgac     20460
     atttggtggc ttcccaggcc tggaaatcca aaagacacag gaatgctgat gttttgtctt     20520
     gcttcttggc atatgagcgt acctctggtc atctcaggta caaaccgaga ggataagatc     20580
     ggggcacagg caagccaatg agagctcact acccaagaat cacctcgggc atacaggaag     20640
     ctgcatcatg agggctgtca aaagtgttgt ggtatacccg gttggttctt atgcacgcat     20700
     ttcctatcca agccgaagca ctatttgcaa agaccattta ccctgggtgt cacttcagct     20760
     gcaggttagt caagtcgacc gcgcgtatcc tttatccgct catatcgtct cctaacatat     20820
     catgcacttg tcaggaaatc cggattccct acatccccta tttcgacttt ttttaaaaaa     20880
     aaaatcatat attcgtcgag cccaccgcgc cgcggaggac acgtgggcat attactgttc     20940
     ggccaggcag ccactgtaaa gactttggtg tccgaaacaa tatcgaatca gaatgtttat     21000
     gagacctctt ggactagccc ctagatcccg gagcaaactt tccaccgtca atcaacgctc     21060
     atgtgatggt tgcttttgga agcatggccg gattgtctac tacgactacg agtgaactag     21120
     cactcctgcg gggatatcac ccaacggaaa ttcgtttcag acggcactgc tagaacccaa     21180
     tcgggtttca atcgggtttc aaccgtgttc tcttatcagc agaacatggt tgattgcatt     21240
     aacttgggac accacttccc aaaaggcaat tgccgtcact tcgatccggg attggttgaa     21300
     atatgatccg tcgttgccga ggcatagtag gagccaaccg ggtattcttg attgcttgct     21360
     tgtccagtct ctcagcaaca tggttgtctc tgtggtaaaa ttactttgat tcttgcgctc     21420
     tctgggatat aagagctgga atagggtaag gtcgagtgac tcacaatcgc cgcctgaagt     21480
     gatgactttg acttcgcaag gcacaaagcc taccgcatgg ctgattttac tcaagccaat     21540
     cgttcggcac ctcatcacat gcttctacac gtgggccttg ggcgtattgc ttggtcatag     21600
     ttgaaccagt ggatctactg tcctatcgga ctgaggctgt atgccaactt caccgagtga     21660
     tcagaatggg actagaaatg gcttgcgaaa tagaatcgac agtgattgat acatttatca     21720
     tgtgggtgag atggcaagaa aatctccgta ctacgtccgt gtgacattgt tagacctcgc     21780
     cactgcccat gaggcccata gattcgcact gagttacttc cccctgccta tgggcgggcg     21840
     ggcggttgac cgtagccccg tgtcatataa tatgcccatg ggtcgcttac taatgagcac     21900
     ttcagtcata tgaaattcta taattgtata atatttagcc acgcaagtat atgtcctata     21960
     gtactacgca ttgagcttat ttgtgtagaa ggatatacaa tggatgtgtt cagctataac     22020
     caaacctagt aaaagcaatg gaatatccag tgtaagtgaa attgaaagtg tgatccgaaa     22080
     tacatagaaa ttgtgatgcg tctgcattgc gcgtaaatat atatgactac aaaacatgct     22140
     gaacctacaa aaccactcac aatataatgc ctaccagtcg catcagtaag tttataataa     22200
     acacgacata ttagttatac tatataatag gattcacctt tattatgatc aattatctgc     22260
     tatactagtg gttattggga gtaaatgaca agtgatagtt ttccaaaagt tgaaccccct     22320
     attcaggaaa attacataat ctgagggtgg catggaccgt tggcaaggtc tagacgttga     22380
     ccaccttttt caccgcccga ccactcacca ccacgcttac caccacgctc atcaacacac     22440
     atcaacactc acatcaacac gctcattaac acacatcaac acacatcaac acgctcatca     22500
     acacgctcac cacgacgctc accaccacgc tcatcaacac acatcaacac tcacatcaac     22560
     acgctcacca cgacgctcac aaccacgctc atcaacacac atcaacactc acatcaacac     22620
     gctcatcaac acacatcaac acacatcaac acgctcatca acacgctcac caacacgctc     22680
     accaacacgc tcaccaacac gctcaccaac acgctcacca acacgctcac caacacgctc     22740
     accaacacgc tcaccaacac tcacaccaac accaacggtt caacaccaca agcattccaa     22800
     gacaacactc atctctgttt gcctaatctg aatgaaagat gccaatttct attgtagcga     22860
     ggaagctatt ggatcacaag ctactaaggg aaaggaatgg gaaatacgtc ctttgataat     22920
     gaagacactt gagttgttag tttatgattt tggctattct attgaactgg caaagatctc     22980
     tgactagggc tccttctatg tatccaatga tgaccctttg gaacaatgaa cagacgatga     23040
     agatgttgcg caggtcttgg cttctccgaa tactcatgga acactcgaat actggtccct     23100
     agcaccacga agaggtgcct gcacgggcta gaggggcttg ttgtcgcaga tgtccctgcg     23160
     aggcgctttg ttgacgcagg gcctaggctg cggagaactt gttaatgcag cggtctcctg     23220
     cagagaactt ggtaatgcag cggtctcctg cagagaactt gttaatgcag cggtctcctg     23280
     cagagaactt gttaacgcag cggtctcctg cgggtctcac ttgtcatcac agcgtccccc     23340
     tgcggagttc acttggtaac gcagcgccgc cctgcgagga ttgttgttca cgcagagcct     23400
     gtcctgcgag acacagttgt tgacgcagag cctgtcctgc gagacacagt tgttgacgca     23460
     gagcctatcc tgcgagacac agttgttgac gcagnnnnnn nnnnnnnnnn nnnnnnnnnn     23520
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     23580
     nnnnnnnnnn nnnntgtggt gaaccacttt catcaactgt tgaaaagaaa gcaacgccgc     23640
     aaaagtatgg ttcgtacata tcatcgaatt tgcaattaaa tcgctcaacg cgcttgcatt     23700
     ctacatgtcc ccattttaac cacggttacc atttcttaat gagggttgaa gtgcttcgac     23760
     agatgccgaa ataatgggct gcatactttg tggtcgacgg aaacgctgag ctgtacctgg     23820
     ggttggccgg atgacatttt ggtctcacta gagtcaaccc ttcatctcta ggctcgcgcc     23880
     gctgactttc atttctactc gcagctgact tatgttgtct ttactaaatc tctactccct     23940
     gggcgcgtag gccttggcat acttgcaatc tcaggatgga aattgtcttt ctttggcatg     24000
     atagccaaaa agggcccaga cctttgaaaa gctcagacaa gaaactgggt ctagtttcca     24060
     ggacaaccat gtgaactgat gcaaccaagg cccacgagct aggttctcgt gatcgccacc     24120
     cctcgcaaga ttgcaacgca actattacac tgatgagacc ctggagacga aaagcacccg     24180
     accggccaat caaacacagc gtgaatttag acagacgcag gtagggttct gcgatgaaga     24240
     tctcagcgac gacccagggg acagtagatc aaggaggttc taattgtggc ctggagagaa     24300
     attggaaaga attgcaaagg tccagacacg atccacaagc ccaaagcttt tgccatcagt     24360
     gtccgatgga acgggacttt gttgcctagg aggtactggg gcgggcgagt atttggaata     24420
     acagcagaat ttggcgacag aatggtaggc tacaactcga tccgtggttg tgttcttggc     24480
     cgcagtgaag agaaagtaaa taaattcctc tgtcaagtgg caagcagaac tttgcctatc     24540
     tggtctgtag aaagttctag gagctacgta tcttctcctg caataagcct tttccccgat     24600
     gattattgct ctctttaggc cataacaaca cttcctctcc atctcttcaa atctaccgct     24660
     atttcaataa ctctagcaga cggcttgtaa agaactatgc caattatgga ctaaccacat     24720
     gagcttaaat aaaatgcctc cgttttacta aaaccgattg gccccggaca agatttcaat     24780
     gtggaccggc cctcctgcgg ccctaaacct tatttcaatc gatctgcaca tcttgatcaa     24840
     gatgctgaat ttaatgaaaa tctctaataa aatattggcc ttaccgaaat aaatctatct     24900
     tacccagccg acggagattg tggtgattct gctctagttc tcttttcctt cgggctgcaa     24960
     ggcttaatca cgagcagccc agaaagaaag taggcagaaa cccaggcttg aactcttaat     25020
     tacagccgca ttctctcacc gtgcaagcat ttccatggtt catccaaacg agctttcgaa     25080
     atgatttgcg gttccgctac tgatcggcag tccccctcgt ggttccgcag tctgtgtcaa     25140
     acttaaattt ccttgtgact cgggtgtggg tcgaaagcag atcggacggt tccctccaca     25200
     gatcgcactg ttttcgacca ccgattcaat caaaccccac caggtatatt ttactgagct     25260
     aacaagattt cagtgccaga gccccttcct accctgtcct atctctctat tggaacgcgc     25320
     atagtaccgt gaatccttat acactctccg cagtattttg caggccacat gggccatgtc     25380
     cctggtttag aatgacaagg acgaaactgt gtagctgggc ctgctcagag ccaccacgat     25440
     catgctcgaa tgttcacctt tgactttgga actttctcac tactgttata attccaaaca     25500
     agggtgattg ctccttccta tacgaaatcc atggagtgat tcatatctct catgctgagt     25560
     gttcattgtc gagtaagcac agcctttatg gtaataacat acaccaggac tatttcatcg     25620
     aaatagttgg ccactgttcc ttcgacatag caatgtagcg ctccagtcga tgtcatgctg     25680
     ctagtgtgga cgttctgttc gccggtatct caattttctg gcggcacaga cacgatgtac     25740
     atagtcccac atccaggacg acgatcgtgt tctttgaggc gagtatggaa gcggtgctgg     25800
     ctcacgcagc ctgtggcaaa aggtcagcct cttatatagg aagaataaaa gtatttcata     25860
     cgtattttcg agcgtgctgt ttgatctggt ttatcactgt ccccttactg gctagggtcg     25920
     gccgctagaa ttgtttgaaa ccgtttgtca atgttccttt gggcagaggt attttctggc     25980
     agagttgacc gtgaaccact atcgaccagc gagcgccgca cgtcgcctgg gcgcttttgt     26040
     ctgcctgaat gtccgggaac tttggcgcct gtgcgacgct gcttccgcag aatatggtac     26100
     tttttccctc gtaaagactc aacgcttcga tacacctgat attcttcata atatgcgtcg     26160
     gagagggctt tccacggcag gccccgatgg gaatccagcc aagagagaag gtttttctct     26220
     tcccattctg gccagccgca tgcgctacgt ggggacatgg tgatgctcgg gcaagtcaca     26280
     aaagtgggaa gaacggttga ataaagcagc agaaagtgaa ttcgaagagg aagggttgtt     26340
     gagtttaaaa gatcatagtg ttgcacataa atatggcgat tgcgtttatg agccatggct     26400
     cagcttggtg aactggtacc agactctcac gactcgcccc agctaaagct tctgaaggcc     26460
     aaaagccttc aacttttgat gtactgtgtt tcgttgagaa tcaacaacgt tgaacggcca     26520
     ccgtgcacct gttgacaata tgacatggtt ccaccagttc gttgaaacat gtccgactct     26580
     tagtgagcca tgcagaaata gaatagatat ctacgtgcag aatcagaatg catgggtgaa     26640
     aaatgcgtgc gcttgcaatt cccgttatag tgagcaagca caacacttaa ttctagtccc     26700
     gcgatacaac ttgctataaa gccggagtgc tttcttctat cacactcaac cagaagtggg     26760
     aacactcgtc acctcagcgt aactcagacg cagacatggg cggaattcga aaagcctcgc     26820
     gccctcttcg acgaccagac tttcggagca gattgcaacg tgcattgtct ttgtcgtcct     26880
     tagagtctga ggataccggc agtgtgtcca gcaccgctac aggggataca acaagtgacg     26940
     agtcaccttc tcaggaggaa tacgactccg gcgaccagga aaatagtgac gcagctgatg     27000
     agagtgagca agaagctaca cgacagcaga gaactgtgtt tggacatgaa acggacttgg     27060
     gaatacgtgg gcaaactcag ctatccggag acagcaatac ggttgctctt gaatgcctga     27120
     cggagtaagt acaattccac acggacgtaa tttagaattg ggaattggcc tgctaacaat     27180
     atccagacta cataaccgaa tggggcaagt tgcggtcact actgagtgag aatttaaaac     27240
     actaactgtc cccgcaggtc tattgagcgc ttatcgcatg accaaggcgc ctggaatgaa     27300
     gccgttcgca acgatctggt tgacatcttg ggccgattgg caatcgtcga gactgaggta     27360
     cagaaggtga ccggacaggg tacaaacaaa tctacagagg gccagaagac tgggcgaccc     27420
     atgcgtcggc ggcagcagtg atgcgaccca aactgtgttt tgctatccga ccatatacac     27480
     cagaggaagg aaataattcg tgttggtctt gagttgtgga tacgattgtt tcaccgactg     27540
     aaaatattac tgaatatgga cactctcatc atggacgctg agttggaggg tcactggaaa     27600
     aggtctgatt gacccaatgc cgagctggtg ccagagcgag tcatgtatgg ttttgtcgtc     27660
     gtactatggt cttcggaatt tattaatgct tgcctaggtt gtgcacacca aagctacctc     27720
     gcccgagccg aggggctagg cgcgagctac tatatgtaaa agtgtacctt aagcctttca     27780
     ttagttccac cattgcagat gatttgtact gtctaatcca gtatgattgt gcacaatttg     27840
     tacaactgga gacatgcccc aaaggctaaa gccacagtag tacataagaa ttatactcca     27900
     tgtaaagacg attgcatatt agttgcgact attaaggtgc gatccttcgc gattgatact     27960
     aatagagtag ttcaatgtgc ctagtagttg agcaattgct atttgtgatt gagttagatc     28020
     aggacatact acggcaagct ttggattgag gaacgagaag agataacaac tgtagtgcgc     28080
     aagagaagcg ggggtttctc cattagaccc atagtcacaa ggcctagcat tgtcctgatc     28140
     ggactatcaa gatgcattcc ctttacatgg actacaataa atatcaactc cacagaccag     28200
     cgtgccaagg tctttcccat ttctgaagcg tatctaagcg gtgtgatact gaatccacca     28260
     cgactgcgtc tctacaagta tcagtccaac ctactcatta catttcttaa tgtataaaaa     28320
     acaaccaagg gctctggaat tggtcggcct agagagtggt gaacccgccg ttaacctgcg     28380
     ccgaacactg tatcgagacg cctgtgctta ctcgtactgg tggttcttgg accaaggcgc     28440
     ccagcgatat tcttcggagc aagaaatttg caatacacat atttcgtaat cactactctt     28500
     agaatggttt ggtgataatg ttgcaggaag cctgttcatg agctatctgc gcgttgactc     28560
     cattaaaaag gcaattctat ccacaggaaa ctaagcccca gcaagtccaa cgcagatatt     28620
     cgttcaaacg agagatccga attggttggt cgcagacggc tcctgctggc taggaagcgg     28680
     gacattcgat tcagagaggc tgaggagggc atcgtggccc tgagtaaccg ggccgctttg     28740
     ctcggcccag tccgcgtgga tcactccgga gcccggcaaa taggatgcca gtcgtctgtt     28800
     ctggagggca tcgatcgtgt tccaaaatcg agtggtcgtc gataccatgt ccccgtgtgc     28860
     ctgatccaga accagctgaa tatcattcca cggcacctga tcctgcagag cggcatttgt     28920
     ggactctagc tgctgctgca actcacagat ctcgtgcccg acccgctgat tgtcagctaa     28980
     tgccacatct cttgctgcaa taaccagctg caatttcgaa gtttcttcgg ctttctcggc     29040
     ttcaagttgt tccagcaact ggcaatgctt gtgtctctcc tcttctctct cctcctgtgc     29100
     tttttggatc tcttcctcaa cgatggacat catatgaaga catttcctat gggacgcttt     29160
     atcatgtttc agcctaggct ttcgtaatct cgtgatggag gatgcctaac acagtcagtt     29220
     gggagtacgt caaggtatgt caccagggca atgttggcca aggcaaatcc agaacatatg     29280
     gtggaaggta gagattaggt accgtatgct tgtgcaaccc agtcgccggt ttgagagggt     29340
     tccgatcgtc tttagatcta gaccgcgtag accganggga taacaggaag acgcagcacg     29400
     cnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     29460
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nctcgccatg ccggtcgtac     29520
     attcgcactg actcatcgag cccaccttcg cagcgagcca agaaggtcgt tgaaatgagg     29580
     attcatcatc gatttcatgg ctcgcacgtt acgttccgac aaccagaaag accccaaaga     29640
     aagggtgcca aagaacgtcg gcaccggaag cgagctgttt cagagcgaga ggcaattcga     29700
     ctggactgga tgcggcgact tcgtcccaag ccccatagac gttgctagat cggacaagga     29760
     tagggcagac atgaagccca gggggtggca tgttgcaatc tctagtttca ttcctatata     29820
     gttgaataga tgaaaataac ttgcaagaaa atgagagtga gaatgcagtg cgtgatgagt     29880
     tagcccgtaa acatggactc tatgtagggg attgctcagc taggcatcct atcgattggt     29940
     atacgcaaaa ttgccagtat acaagaggat attctctacg cttttatgat gcctgttgta     30000
     tacaattgca tatacaagtg cttactgtaa ttgggacgta tagaacgggc cagaagaagt     30060
     gtactgggat ttaatgctgc ttgcttgcat gataggtgtg ccattatccg tgccattctc     30120
     gaaatttgca aaggtctctc aaatacatat tcttcaaagc ctgtatcacc aagttgttct     30180
     gagaagagat catgctactc tacatgcact gaagcaagga gaacgcagtt tacggtgtag     30240
     acagagttca tggggcgtca agttttattt ttatatacct aatttagact tgaaaacgat     30300
     ccgttgcgtg attcttgtga acatttaatc ttttagagac agcacgatta acaaactcct     30360
     ggtttcaatg gccttgtctg agccacccgt ccacatacca caagctagtt ggagataacc     30420
     aaggacccac ctatcaccta tttggctcac gggattgact gcaaggacga cgcccagatg     30480
     gcgatgatga ccagttcgac ctgtttagta tcagcattat tggtataacg gtataacgtg     30540
     ggaatccgcg attacctcca atgcaatcat ccacgatctc tccaacgtac caatgacggc     30600
     aatcacaagc aaaagaagtg ccattgcaga gagatgacac gagatacacc gcaacttagc     30660
     tcgaccggca gttgaccgtt ggaacaacca ccaataccat gcaactacac aaaggtagtc     30720
     cgcgaagaga atatagaggc cacccagttg agcagagctc aaaaggaagg ttccaacgag     30780
     ggagactgct attttcgcca aagttgaagc catagagaaa gaagggcata tgaaacgcag     30840
     taatcgaggt gtgagtgggt tttcgcgctg ctggaagatt atgcgaatgt actgcagcat     30900
     tgttagctca gaacgaagac actgtatgtg accgagttcg gtgtgctgtc aacttaccgc     30960
     ttgtagtggt gggaatattg gtgtaatcca aaagagtact tgactccatg ctggaaacct     31020
     gttgctccag aacaacccag taaggatagc aaaggaacta caagacaagg caccaagcgc     31080
     taaatcgact ttataccacc gccagcgtgg ttggatgcaa tacaaaagaa atagtcttcc     31140
     aaagttgaga agtagaagaa tagtcaccaa gacggatctg atgacgtttt gtgaaaccac     31200
     aaccatactt gactgccagt taatgttctt gtttgaacga ggccttgaga tttatatact     31260
     gtgacagaga catattggcc aggtaatagt ggatgaattc ccaggatgtc ttcatttggc     31320
     tctaggattg tcttatactg agtttcctgc ctataaaaag cagctgccct caatcttatg     31380
     gcacagaagg ttaactgagg attcccattt gcggcttcgg ggcaacacgt ttgctctttt     31440
     tctgcgcaga ccctagaata gaccacattt aaagcttgca gtatagtttc tgatttaact     31500
     tgcatcatgt aagaccacat ttacaagggc caatcgcagt tgcagtatcc tgctttcaca     31560
     tagacatcga ggatatgcag aggtggtgca tacatttata aacgcctaac tcaatttctg     31620
     gagagcactg cgattctctc aggactcagt cttcggaccc gtagaaaaag taaagtgtgt     31680
     gctcgctaca atatgcctgg aagtcacaca atgttttgat aaaacagcat tcacctttaa     31740
     aatggctgga attagccata gagtacacgg tgtcttgaat gagtgcatgc caggggcagt     31800
     tttcatgcac cgcggattct ccgtgttagt ttcagcagcc catggttgtc tgccctggac     31860
     ggactcatta gcttatcgtg attactcctt aggccgaaac cgtaactaac ccttgctcaa     31920
     ggctcataat ttgaagatgt tttatcatcg ggaaatcaat acgtgtctcc tttccaaagg     31980
     gtgctgggat cagaaaatgc ggagaccggg gttacaatat ccgttcaccg tcatgatagt     32040
     atcttgctat tcgtcggcac actatggaac ggagcaaaat ggatagctac atcactaaaa     32100
     cataaaagta agttagatat gctctattca tgggttttaa tcgcttataa ttttcactgg     32160
     cggtctgaag tgcctatata ttgtgttggc cgatgagtag ttgttccaat gaagttacca     32220
     aattggcaat gatatataga ttgtgtttcc cttttctcac tcgtgtcaga aggttccaga     32280
     caacaggtta tacaggatat cgttaattgg ttcctgtaat ctacagcatg cgatgtgcaa     32340
     atgaacgtcg atagacgtga cagaaatact tctgctattt taggtaaagt caatccgctc     32400
     agaatgtggg acttctcaaa tcggtcacgt ttctccttgc tcctcgaaaa aatacacgca     32460
     gactttccca actaagaaac aaaagttaat gacataaata agagataata atgaaatcga     32520
     agacagcatc tggatcaccg cgacgcagac atttcatatg gtgaatcacg cacttgaatg     32580
     ttaacggctc atcaagacag tagaccggga ataaaccgaa cgatggacaa catgacatga     32640
     cgtttcatgc gtgcgagcct ttgtagtcca ctattgccat aattccacac actcgatatc     32700
     aagacatgta aggaattgct acctgcaaca ccgctttgga atactctacg aggctgtatg     32760
     tcaagatcaa gtacatgccg tggagactgg gctgccagaa ctggaccatt ccaattctct     32820
     caagagggcg caaagcgtac agagcataac cgcagaggtt gagaagcact agtctgccga     32880
     atgcagtggc caatggagag ggagcgtgga gcggctcggc caatgcgtga atggacggta     32940
     ccaaggccaa caggaccact gaggcaaatt gaagagacaa tcgggcggaa aatgcccccg     33000
     tgtccacgtc tttgagatag ccgtccgaga ggcttccaac cgcgatcatt gtgaaagccg     33060
     atgcacaccc aagttgtagc aatggttggg ctgggaagag aaaagcgatc gtgggaagag     33120
     cggcggtcca gaccaggaat aaaccaccaa accacacgga atcttgctct ttcctcattt     33180
     tctccttctg gaatgcactg aagcaattct gaaagataac acacagatac catatggcac     33240
     ttcctccacc aaacgccatc actgttagag cgtatgggat tgactgttga gatgagggga     33300
     aatggaagat caagaacata agtagataaa tgacaaagta tgagaatcca agcgtgccta     33360
     tgatgacacc tatggcgcag ttgcgcaggt ttcggtaatc gagcgtgtcc attgtgtaaa     33420
     gttggggtaa gcaccggcct tcttgaggca gcatccctcg ggcgagcatt tggctttata     33480
     gacgagagtg gagctcagtc tttactcgtt gaccgtgggt caggtattgc aaaaacatat     33540
     gtgttggaat aatgatgggt acggtgttga tcaccagaac ggtaaggaac catcatatct     33600
     gtggcgacca cccacctcaa cggccggcgc ctcagaagtg accgcgttta tgttgagttg     33660
     ccagaaactc tttttttgcc tcatcgatat tcaatctgac caaccgactg acagtcctcc     33720
     ttgactatgt aattggtctc tctcattatg caaatgcaag acctgagagt tcgtgattct     33780
     acctctcttc catgatagca ccatggaaga tgttgtacag attgtacgcc agatcggtca     33840
     acaacaagct cataatgctt attatcgcga ttgctattcc ctattcaagc tactccaaga     33900
     gctcacagaa catacgttca ccgaattaca aagactttac aaatccggca ccgagcgctc     33960
     gaccaattct gtccatcaac ttctccgaaa ttttcagaac acaatctgta atctggttga     34020
     aagagcatgc gaagcccaag cggaatgcga ggagttctgc tcagtgaatg aatcacactc     34080
     agcgcgcgtt gtcttcgagc ccatcaggag aatgtacacc aacccacaag cctcattgca     34140
     gggtacaaga tgatggtgga actactagcc tggcatcgtc gcctgggaag atggacgagc     34200
     acgactggtc actctactac agtgatattt tcgaaggcgg aatttctata attctatata     34260
     gccgtgtcaa aatcacaatg tactttgtgt accacagtat ttctctccaa aagctcatac     34320
     accatgtagg agcccaccaa cacaaagctc tcatgaatca gacgcagcta tcaagaagtt     34380
     ccgattacca cagaatgtgc accatagggg cgagcaatgt ttagctccac catctgccac     34440
     cgtccttata tatcatttcc gacacactcc cagccgaatg acgatctacg ggcttggcaa     34500
     ttagatgcaa cagcagaaaa gatggaccaa ccatatggtt gaaccaccaa tagaaaagaa     34560
     cactgccaac catgctgtgg taaacatctt agctccaagg gtaacttcaa cgccgtaagg     34620
     ctgcagggtg ttcttgacct tggaagcaaa aaccccatac atccccgtga ccacaattgt     34680
     ggcagtcgta atcagcatcg aggaaacctt aatttatcag catgtctttt cgatatttgt     34740
     ccaagtatca cataccgtgc aaaatatggc aagtggtctg ctgccttttg aaaagaaaac     34800
     tttgcgacaa gccaaaactc cggataatgt ggttaccaca aacccagcaa tatacaaaca     34860
     gatcacactc tgggaaaacc gtcggtagcc ggaaaccaag cttaggtcaa tatctggaag     34920
     tatgtttctg agatttatgg gtgtggaatc aagcacggcg gatagatcaa aagtaaaaga     34980
     ggtgctgggg tcggaacaaa ccatctccga gccatccttg gctttacagt agctccagag     35040
     gccaaccaaa tagtattgag gcagatgtga cttgaattcg tgtatctggg cttcaaccat     35100
     gctgcttgca gccggcgttg cctcatggat tgcttcattt gcgctggtat ggatgctaga     35160
     tgccacgcct tcgacggcat ttcttccccc gctctcgata cgcgcagtat caatattgaa     35220
     tgagtcccga atttgcaaat cacgcagctt tggaaattct ttcaggtcta cctgccgatt     35280
     gcttagcatt gattagcatg gaagtttttc gggcgtatct tacttttaga aaatgtagac     35340
     ccttcggcga ggaagacgac gaacatccga caaagacaaa agatagacag actaaaacgg     35400
     cgacggtaaa tgacaatgct gtggtcgaaa ctagcgaatc caatctgctc ttggtggaaa     35460
     gcttcatggc ttcagaaggg agaagataaa ggagtgtctc ttgaccgaat aatagacttt     35520
     cagattgaga gaacaattga gaaccatgat gtatcgtaat tcagggaaga atttatacaa     35580
     actttccaga tatggtcaac ttaacccgtg tgggcagtgt tctgcaaatt taattgaggc     35640
     cggcgcaatt ttccgcctca ttctatgggc agtagtagat aaatttgtca agtaaactac     35700
     agtgaatggg gatccataat acatcggtgt tgtgagggca ggcagataat tgacagcatt     35760
     aaccgccgga atatgagggc atgcaattac aagtgatcag gctggcgagt tagatcttcg     35820
     gcccacaatt attctcagat agattcaata attaaggtgg tataaatact actccacgga     35880
     gtgaccctcg acatctaagt tgtctttctc gttattccat acacctcctc acctgcaaat     35940
     cacagctgac ttgtactagc ccccgtcatg tcattttcta ggcagtcaga agttgaacat     36000
     tgggaacaga aattatatga ctatcgagaa agtcattttg agctatctgc cagagtgcac     36060
     atctctcacc tcttcttcga gagtgggttc agaagacgga tggacggccg gcagaatatc     36120
     cgtcgattga cacaattgat gaagatgcaa ggctgtcaac gcttgatgag ggacaaccac     36180
     gtgccggtgt tagtccccag ggctcattgg caagatcgcg tgcggccccg atctggcggt     36240
     ggaatcattc ctagcttgga tatggagctg gactataggt tgtgcgcata cgaccacgag     36300
     aacctcataa cagctgcaag gaatttcctt gaccacgaca atcagtggtg gatcgtagat     36360
     gtctatctaa cagataatga ggaaggtgcg tttgctcagt ttcagctctc agagatcgtc     36420
     gttgataagt ttatagtgtc gccagacgac cacagaaatg aaacggagtc tattcgtcac     36480
     aaattcatcc aatcgctgaa ggagcggtat ccaaacgaca atcgcccacc tgatggactg     36540
     atctacgagc ggattaaccg gtacgaaggc taccttgata cgcccaggga tccgctcgct     36600
     gcgaataact ggtgggctgt actggaggct ctcgcgggaa gcaagaaagg aaagtatttg     36660
     aagcaatttt tcaaacacga gaccttacac caaaagctaa attctttgct cattattccg     36720
     ggtctctggg gagggatgcg gattgggcta cttcataaac tgacagccat gcattgcgac     36780
     gaggtaaatt tactctgaac cacaaagcca gttccatctc agctaacttg attgcaaatc     36840
     tagccagtag catgctactg ggaattgatc ttctccactt tttcgagact ggttggagga     36900
     agggaagagc ttttattgct gattgacgga gttacggtcg agctgcttca atctcgcgtc     36960
     cctaaaatct cccgtaaaga tttgcaatcc ttgcaggtcg agttggagga gggccggctt     37020
     ttcccgaact tctcggaaga ggctcggcag gacatatggg cgcgtttgaa agagatcgat     37080
     tatccaattc caaccttgaa aacatttttc aaagatcggc tctatcttga ggtggctcaa     37140
     agtgtcatga agagactgtt cgtccagccg cgaggggata agattaccat tgaccagggc     37200
     gtgtatggga agtatgacac tccggttccc gtctcgatgg cgctgagaca ggaatggtta     37260
     ggatccgacc tgctcgaatt ttggcgcttc agcttccagt atggatttga aatgaccgat     37320
     caccaacgcc ttaaatggcc gacagacgct gatcccgagg atatgcttga tcggcgaagc     37380
     tccggatcgt cctttcttcc caagcaggaa atatggcgcc atttctttac actggtgaga     37440
     gcgagaggtt tccaagcacc cgtcacagac gacacgtcat ttgcaacagg ggagctacct     37500
     tcccctagag tgtgcgaatt tccagaagac ttagccgaag aaatagaagt tgccaaaaga     37560
     tgtgggaagc cgtactcgaa cactgtcgag gcagatcgat tcgctttgtc cgcagagacg     37620
     ctgcggcaaa gtcaagcctc ggttcgagtg acggcggggt ttctccgaca gtctgttttt     37680
     aaggcgttct ttggctatct gtggaatagc aatagtcaaa tggccggtgg tgatcctcct     37740
     gacgacaaca ttgaagttca ccatcgcggc gaaaggccga ctaccgcaaa tgttggtcgg     37800
     gccatgatgg ccacagacgg catggacgtg gatcctggga gcctcaggcc aaaccctctc     37860
     gtcacctcag cagcgcggac gcataatgcc gcggctactg cttcaccagc tgacatactg     37920
     ccgccgttcg gtgtcatgac cttcacggtt ggacgaacta cacgaatatt agacctacca     37980
     atccacgact catttatgaa agacttttcg actggtctat tcaacaacaa cttcaacgtc     38040
     cagaccgatg agagggaaaa gcgatccatt tccccatata cgtgctactc tcattatctg     38100
     cacaatccgt cgtcggtgct acacgccgaa ttcagacaaa atgagcatac tacctacgct     38160
     attgcaccct cgcaaatcgg cgctgggagc aagagaagga tgcttgatga agacgagcag     38220
     atggctagag cggaaatatg gttacaggag caaattgcgt tgctttcgga tcggcgtaac     38280
     ggcgacgaag acctttgacg ggtaccaaac tcgggtttca ccaaggcctt gaagaggctc     38340
     acggtataga ggaggcctgg tatggtagag atggtatgag tgaggcatgt aaaaattcat     38400
     atgttatgat atatcatatc tcagagcatg ttcctgtaaa cggcaacgtt ttagcttgaa     38460
     gcgagcaagc ctatggtatc tatcttatat agtgcgaagg aatagatgat aatgtacttc     38520
     ttgatttatt gggatgcatc gtggttcgat caattatatt tattagacat gcgcttggtg     38580
     tccggcactg atcgttattt atattttaca gctgacaatt agatgtaagt tccatagccc     38640
     gaggaatctc aatggcttca actattctct gatttatata ctcttcttcc attcaacaca     38700
     tagcgtcata cttgtagttc actctctggc caccatcaag ggttctacac cacatggcgt     38760
     cgcttcaagt ttaacaagtg aggtgctgcc tcttttatct caatggacta tggtacactc     38820
     cgccgactca aatacctttg ctgacccaga ggcgcaatga caaagaccac cctcacgatg     38880
     gtccgcctcc ctaaagatat aattagacaa cacaacttga attccatatc aaagagtggc     38940
     ttacttgatg aggcaggtat tcaggtcgag ttccccagaa cccttcggcg agggtattgt     39000
     ggtagggcca tgtgtctcgc taggtgcgct tggggatgcc gagatgctcg caaaccttga     39060
     tatattcggg agctcgcagc tagagctcgc agtatgggta gcagacccgg tactctcggt     39120
     attggtgctt gtctgttgtt gagtgctttc gggtctcgta gtctctttat tcagaggcag     39180
     cgattggcat gaacaattgc cttgctgttg cgagggaacc tcatcaccag ctgccctttc     39240
     tgcatgttgc ctcaccgaag ccatcagggg aagttgaccg tccagggaga ctgcaatact     39300
     acgacaatcg atggaaggac catcaacacc tgtaaagatt agcagtcagg tataatgcga     39360
     gggtagtgtg atacctacat ctactgagtg cgctttccat ctcagcctcg cagtcaggcg     39420
     acaaggaaac tgattgcgtg tgtccagaag ttgaaagcgt ggcattcaag cttcctccca     39480
     tagcttggtg ccatgagctg actgtattac atgtagattg aatgaggggc cgaagatcaa     39540
     gggcttgaac ttgaccgagg atagcgatga ctgtaagcag agacctgaac atgatcaaac     39600
     aactttggta tccaaagacc cggctttggc gggtggtgct gcgaagcgct tttatatcat     39660
     caaggttcga tgagcatatt tctgaggcac caatttatct aggaggcgtg gcaatcctat     39720
     gaaagtaaaa gaaatcgaga ataacgacgg gtggtgcatc attatgttgg catcactggc     39780
     atcaaagtaa tgccgttgac attgaaaatt gatgtcagcg ggagaatcaa cttttaattt     39840
     tgggacagc                                                             39849
//

If you have problems or comments...

PBIL Back to PBIL home page