(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_20

ID   PENCW_20; SV 1; linear; genomic DNA; GRV; FUN; 1072 BP.
XX
AC   AM920440_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   05-OCT-2010 (Rel. 125, Last updated, Version 3)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c25, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920440.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1072
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        complement(94..>1071)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200312" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944740"
FT                   /orf_name="Pc25g00010"
FT                   /product="Pc25g00010 protein"
FT                   /protein_id="CAP74117.1"
FT                   /db_xref="UniParc:UPI0001832FF5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX88"
FT                   /transl_table=1
FT                   /translation="VLSHSDALQRLFYLTKSFVSVQPLCHSWATIDIFFDHWKGFTFQR
FT                   DMAAHFVIAHRLLLENCSGERLKALTNDFLSLFPMHIQRPTSRNQHEVYIMSCNIASVL
FT                   GYGTPVYPQVADLFSKKQSTGAANESAPAMETEYVSNSPTELCSQLKLNQAFQAIRLTF
FT                   QTLFVLLRFSNFPNAIPGIHISLAFLWRVSFHRSVMEGLEATVPWQAVAGFLNSLFSHN
FT                   TVFSRIQDEKFPIGEYETAPQLPEDFLIRGQAWSQFYYPNNFFKDTSGYGISIDERDSE
FT                   EVVRRHRCLWLGVQIAKVSWHHLGYDSFEGDSTGTDLSYSLVAG"
XX
SQ   Sequence 1072 BP; 284 A; 243 C; 266 G; 279 T; 0 other;
     taagtaacta gctcagacac gtccttcaat ggccatatct ctccgcgaaa gtatgtgcta        60
     attcgaacct cctcgttctc gttggactgt aagttatcca gctaccaaac tgtatgacaa       120
     gtcagtacct gtgctgtctc cctcaaatga atcatatccc aagtgatgcc aactgacctt       180
     tgctatttgc actcctagcc agaggcacct gtgtcttctc actacttcct cagaatccct       240
     ttcatcgatt gaaatgccgt accctgaggt atctttgaag aagttgtttg ggtaatagaa       300
     ttgactccac gcttgacccc gtatcaaaaa gtcttctggt agctgtggag ctgtttcata       360
     ttctccaatt gggaacttct cgtcttggat cctcgagaaa acagtattgt gcgaaaacag       420
     actatttagg aatccagcga ctgcttgcca gggaaccgtg gcctctaggc cttccataac       480
     ggagcgatga aaggagacgc gccagaggaa cgccagagag atatgaatcc ctgggattgc       540
     attggggaag ttactgaacc taagaagaac gaagagagtt tgaaaagtga ggcggattgc       600
     ctggaatgct tgattcagtt tgagctgcga acacaattca gtagggctat tgcttacata       660
     ttctgtctcc attgccggtg ccgactcatt cgcagcaccg gtactctgct tcttggaaaa       720
     cagatcggcc acctgtgggt atacaggtgt accgtaacca agtacagagg cgatgttgca       780
     ggacattatg tacacctcat gttgatttcg gctagtgggg cgttggatgt gcattgggaa       840
     gagcgacagg aagtcatttg tcaatgcctt aagtcgttct cccgagcaat tctcgagtag       900
     gagacggtgt gcaatcacaa agtgagcggc catatctcgt tgaaaggtaa aacccttcca       960
     gtggtcgaag aaaatgtcaa tggtcgccca gctgtggcag agtggctgca cactaacgaa      1020
     tgatttggta agataaaaga gtctttgaag agcgtcggag tgtgacaaaa cc              1072
//

If you have problems or comments...

PBIL Back to PBIL home page