(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_21

ID   PENCW_21; SV 1; linear; genomic DNA; GRV; FUN; 1211 BP.
XX
AC   AM920442_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   05-OCT-2010 (Rel. 125, Last updated, Version 4)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c27, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920442.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1211
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        complement(<4..>588)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944741"
FT                   /orf_name="Pc27g00010"
FT                   /product="Pc27g00010 protein"
FT                   /biological_process="metabolic process"
FT                   /protein_id="CAP74119.1"
FT                   /db_xref="GO:0008152"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI0001832FF7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX90"
FT                   /transl_table=1
FT                   /translation="QVDMQWCSTHVSPSTMRHFNTLTFSSYFQPKELPGLCLQDGGVRA
FT                   NNPLAIALRESSIIWPMAKRHDLLLSIGTGFSTSPPSRPTGILGRIWEGPLPRLFRAMI
FT                   SSPSMDGKQGFLEALNYLPHLSTPDIFRLDQAIDGTLPDLDDVCSLEAMSNMDFAVPAE
FT                   LVRTILASAMFFFELDETPIQGKASFHCRGSV"
XX
SQ   Sequence 1211 BP; 331 A; 289 C; 326 G; 265 T; 0 other;
     aagaacagat ccccgacaat gaaatgaagc cttaccctgg atgggggttt catccaactc        60
     aaagaaaaac attgccgacg cgagaatggt cctcacaagc tcagctggaa ctgcaaaatc       120
     catattcgac atcgcttcca gcgagcacac atcgtctaaa tcagggagcg tcccatcgat       180
     tgcctggtct agtcggaaaa tatcaggcgt cgacagatgg ggtaggtaat tcagagcttc       240
     caaaaaccct tgctttccat ccatagatgg agaggatatc atggcccgga acagtcgggg       300
     aagaggcccc tcccagattc gacccagtat gcccgttgga cgactggggg gagatgtgga       360
     gaagcctgtt ccgatagaga ggagaaggtc gtgtcgtttc gccatgggcc agatgatgct       420
     cgactctcgc aaagcaatgg cgagtgggtt gttcgcacgg accccaccgt cttgcagaca       480
     aaggcctggc aactcttttg gttggaagta gctagaaaat gtcagcgtgt tgaaatgtct       540
     catggtgctt ggactcacat gggtgctgca ccactgcata tcgacctgtc aaaagctaac       600
     tgttagcaag atcgactacc actgtccaaa tcaactggct gcaaacgatc acttacgcgt       660
     caagtaagga agggtcttgt cggtcgttgt gtggagttag aaactcgtag gcggtattgg       720
     tggaacgtgg acttgttcct cggtaattag ctagcacgta ggctttacca tcagatgtgc       780
     ggcttgctac aatggcgatc cggcaacccg caggattggc ggtggcgaca tcgaacatgc       840
     gacgagatgg gttaacggct actttcaaaa tcttcgacag accttcggaa ttataaaggc       900
     catctgtggt caagttgaac gccgaggcaa accaccggat acagcgagga attggggttt       960
     cggatgaatg acaaaaaatg ttacgcgcca ggtgcgggaa cgcatcgaaa cattgcgtga      1020
     ccgaagattg attgagaaaa acgtcaattg ccgtcaatgc gcctagagga agtttcttag      1080
     tatatcaacc acaataaaac actcggccac tcggcgtacg tacctacact ggttccaatg      1140
     cacaggtccg gcaaagatgc gatcggaatg ccaatgcgac tttctaaaac ccgtagaagg      1200
     cccagttgat c                                                           1211
//

If you have problems or comments...

PBIL Back to PBIL home page