(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_22

ID   PENCW_22; SV 1; linear; genomic DNA; GRV; FUN; 1420 BP.
XX
AC   AM920444_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   05-OCT-2010 (Rel. 125, Last updated, Version 3)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c29, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920444.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1420
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        complement(926..>1336)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200313" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944743"
FT                   /orf_name="Pc29g00010"
FT                   /product="Pc29g00010 protein"
FT                   /protein_id="CAP74121.1"
FT                   /db_xref="UniParc:UPI0001832FF9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX92"
FT                   /transl_table=1
FT                   /translation="PSSERREHAKRVDAALPGKHTRQLYDRLSWKEASVLAQLRTGLAR
FT                   LNGYLYRINVADTDQCACGQARETVEHFLFRCQKWTAHRTELLQCTNTHRGNISLFLGG
FT                   KSLSDDQKWTPNLEAVRASIRFAIATGRLEAT"
XX
SQ   Sequence 1420 BP; 346 A; 339 C; 356 G; 379 T; 0 other;
     ggtttaccat gctcaacgca cgattttgag aggaatgatt ccaggtcgag acatgactat        60
     gggccacaag gtatccaaac accatttcaa cgtcgatcga atcacctcaa cgcctatcaa       120
     cgaggcagtg attatcgcta ccatctgcgc aactggttcc atcgagagac gtagcggaaa       180
     aaatataaaa ggggccggat gccccaaaaa atcaggactt cggtcctcac actttgatgc       240
     atcatagtgt ccctttcttg tctgcaggct tgggagtctc cgtggccatg gctgtcgctg       300
     ctttgagccc cgcgacgtta gaaaggtgtt ttgcaggata aggtctgcgt taaaaccaat       360
     accagagcct actatggtct acaagcggtg ccatattggt ttatctgaat caatatgcgg       420
     acatttagac acagaatgac cgccaaacgg tcgagttgta agaaccagca gtcatgagcc       480
     gattaacaga acggcaaaaa tgttccagtt cttgtagata acacagcaca aaaaattaca       540
     tctctacgag cgaagcggat tgaataaccc aaagagtggc tggttttgat acacacacac       600
     acacacacac acacacaatt tattaacgcc cggcggctaa gccgaaaggg caactatctc       660
     tgatctacta tacatgtcat aatatataca gtactgtgtc ttctcagagc ccatacataa       720
     agccttgcaa tatatgtcat ctcagatgtc cgtatcgcag cggatcctcg tgggttagta       780
     atttggttag taggctggct tgaaggcgct tctccaagtg tttaacttcc tattttcggc       840
     agttgaagcg cgtctaccat ctgtaacacg aggtggttgg tgggttagat cggcgaaagg       900
     gggtgattta tgttcgtcgg catggttagg tggcctcaag tcggcccgtg gcgatagcga       960
     atcgtattga ggcccgtacc gcctctaaat tcggcgtcca cttctgatcg tcggaaagcg      1020
     actttcctcc taggaagagg gatatatttc ctcggtgggt gttggtacat tgtagtagtt      1080
     ccgtccggtg cgccgtccat ttttgacatc gaaataggaa gtgctccacg gtctctctcg      1140
     cttgtccaca cgcacactgg tctgtgtctg ctacgttgat tcgatagaga tatccattga      1200
     gtcttgccaa gccggttcgg agttgagcca gcacgctcgc ttctttccaa gataatcggt      1260
     catacagctg ccgggtgtgt ttgcctggga gtgctgcatc aactcgtttt gcgtgttccc      1320
     tacgttcgct ggaaggtcat tgctgtggac tgcttgggac cgtgcgatat tcagtgtagt      1380
     tgacttcatt ctcgggacgc tttcttgcgg gagagcatct                            1420
//

If you have problems or comments...

PBIL Back to PBIL home page