(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_23

ID   PENCW_23; SV 1; linear; genomic DNA; GRV; FUN; 1473 BP.
XX
AC   AM920445_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   05-OCT-2010 (Rel. 125, Last updated, Version 3)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c30, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920445.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1473
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        <521..856
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944744"
FT                   /orf_name="Pc30g00010"
FT                   /product="Putative uncharacterized protein Pc30g00010 "
FT                   /protein_id="CAP74122.1"
FT                   /db_xref="UniParc:UPI0001832FFA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX93"
FT                   /transl_table=1
FT                   /translation="PSKPPNLPLNLPLNLPPNLPLNLPPNLPLNLPLNIPFIICRISKP
FT                   IILICETPHAYNFTRSMYLCTGSTDQGLRGGRRRYKRKQLHPFHESFIDIYINLCNRFY
FT                   NPFDNQF"
XX
SQ   Sequence 1473 BP; 407 A; 376 C; 305 G; 385 T; 0 other;
     tgtggtttgg gtaattgaag taccgctgag aacaagaagc cttcttcgca gagtgagctt        60
     tcggagctgc tgggttagca acgccagagg agtcggctga ctattcgaga cggtcgtttc       120
     ggtttgttct ggaagggaca agacgcctgg ttagacaaga aaacattcaa atgacttttg       180
     atttcagaat tttcactaac actctgggaa aatgaaagct gacaatactc aagagtaaat       240
     agtatatccg agcagttgct gcccgacgat aaatcatgcg cgacagggga aggaggggca       300
     gcgggattac attctcccgt ggccttatcg atcatcccgg cccatcgatg ctgagagttg       360
     acattgattc taattagtta atcaactaga ttcatcacta actaatcagt gagcgctgtg       420
     gatcaaggcc aaattatagg tctgtcgtac tatcggtccg ctcctcatgt gtttcttgtc       480
     tgctttcttt cagcttgaca atttgctccg cttagcctag ccttcaaagc cacccaatct       540
     tccactcaat cttccactca atcttccacc caatcttcca ctcaatcttc cacccaatct       600
     tccactcaat cttccactca atataccgtt tattatttgc agaatttcca agccaatcat       660
     tctcatttgt gagacccctc atgcatataa tttcactcgc agcatgtacc tctgcacagg       720
     atcaacagat caaggattga gaggggggcg acggagatat aaaagaaagc aacttcatcc       780
     gttccatgaa tctttcattg atatttacat caacctttgt aatcgatttt acaacccttt       840
     cgataaccaa ttctagtctc agttattaac cgcacaacat ggcattgaaa aaaacttccc       900
     ctgatagtca ccaaggcttg acgccaccag atagcccaac gaaggagtcg actatgtctc       960
     ctgccacctt gaaggatctg atgcttctct ttggtgagtt tcttgagaac gccctgctcg      1020
     atcttgccga ccaagaacct ccaaacactc ccgtctccca ggaccaatcc ccaccaggcc      1080
     tcgacatggt tcgactgaag cagttgatgg tcaagctcac ccacgatgaa tgtgggtcag      1140
     ctgaatcctc cctggcaact aagcctgttc gatcttcttc tgccagcaat gaacagcaag      1200
     agaatgttca ggcgatagac gagattgata tcgaaagcca gatctgtact acaccggatg      1260
     atttcaagtc gtttgagaaa tgggcatcaa aatcccaatt caaaacagtt gtggaagtgt      1320
     atgagccacc agccaaccac ctcttccact ttttcagata gctgacacgg gtctagctgg      1380
     gacaaagaag catgtaaata cagaattgcc gagccaacgg agactagcaa tgacctggac      1440
     gactacgctg agtacgcatt cgttgtccgt gaa                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page