(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_24

ID   PENCW_24; SV 1; linear; genomic DNA; GRV; FUN; 1046 BP.
XX
AC   AM920446_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   05-OCT-2010 (Rel. 125, Last updated, Version 3)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c31, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920446.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1046
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        <430..>1044
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670879"
FT                   /orf_name="Pc31g00010"
FT                   /product="Pc31g00010 protein"
FT                   /protein_id="CAP74123.1"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI000183308B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX94"
FT                   /transl_table=1
FT                   /translation="PVACYWELIFSTFSRLVGGREELLLLIDGVTVELLQSRVPKISRK
FT                   DLQSLQVELEEGRLFPNFSEEARQDIWARLKEIDYPIPTLKTFFKDRLYLEVAQSVMKR
FT                   LFVQPRREKITIDQGVYGKYDTPVPISMTLRQEWLGSDLLEFWRFSFQYGFEMTDHQRL
FT                   KWPTDADLEDMLDRRSSGSSFPPKQEIRRHFFTLVRARGFQA"
XX
SQ   Sequence 1046 BP; 275 A; 245 C; 267 G; 259 T; 0 other;
     tcgtcgttga taagtttata gtgtcgccag acgaccacag aaatgaagcg gagtctattc        60
     gtcacaaatt catccaatcg ctgaaggagc ggtatccaaa tgacaatcgc ccacctgatg       120
     gactgatcta cgagcggatt aaccggtacg aaggctacct tgatacgccc agggatccgc       180
     tcgctgcgaa taactggtgg gctgtactgg aggccctggc gggaagcaag aaaggaaagt       240
     attttgaagc aatttttcaa acacgagacc ttacaccaaa agctaaattc tttgctcatt       300
     attccgggtc tctggggagg gatgcggatt gggctacttc ataaactgac agccatgcat       360
     tgcgacgagg taaatttact ctgaaccaca aagccagttc catctcagct aacttgattg       420
     caaatctagc cagtagcatg ctactgggaa ttgatcttct ccactttttc gagactggtt       480
     ggaggaaggg aagagctttt attgctgatt gacggagtta cggtcgagct gcttcaatct       540
     cgcgtcccta aaatctcccg taaagatttg caatccttgc aggtcgagtt ggaggagggc       600
     cggcttttcc cgaacttctc ggaagaggct cggcaggaca tatgggcgcg tttgaaagag       660
     atcgattatc caattccaac cttgaaaaca tttttcaaag atcggctcta tcttgaggtg       720
     gctcaaagtg tcatgaagag actgttcgtc cagccgcgaa gggaaaagat taccattgac       780
     cagggtgtgt atgggaagta tgacactccg gttcccattt cgatgacgct gagacaggaa       840
     tggctgggat ccgacctgct cgaattttgg cgcttcagct tccagtatgg atttgaaatg       900
     accgatcacc aacgccttaa atggccgaca gacgctgatc tcgaggatat gcttgatcga       960
     cgaagctccg gatcgtcttt cccccccaaa caggaaatac ggcgccattt ctttacactg      1020
     gtgagagcga gaggtttcca agcacc                                           1046
//

If you have problems or comments...

PBIL Back to PBIL home page