(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_24.PE1

PENCW_24.PE1         Location/Qualifiers
FT   CDS_pept        <430..>1044
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670879"
FT                   /orf_name="Pc31g00010"
FT                   /product="Pc31g00010 protein"
FT                   /protein_id="CAP74123.1"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI000183308B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX94"
FT                   /transl_table=1
FT                   /translation="PVACYWELIFSTFSRLVGGREELLLLIDGVTVELLQSRVPKISRK
FT                   DLQSLQVELEEGRLFPNFSEEARQDIWARLKEIDYPIPTLKTFFKDRLYLEVAQSVMKR
FT                   LFVQPRREKITIDQGVYGKYDTPVPISMTLRQEWLGSDLLEFWRFSFQYGFEMTDHQRL
FT                   KWPTDADLEDMLDRRSSGSSFPPKQEIRRHFFTLVRARGFQA"
     ccagtagcat gctactggga attgatcttc tccacttttt cgagactggt tggaggaagg        60
     gaagagcttt tattgctgat tgacggagtt acggtcgagc tgcttcaatc tcgcgtccct       120
     aaaatctccc gtaaagattt gcaatccttg caggtcgagt tggaggaggg ccggcttttc       180
     ccgaacttct cggaagaggc tcggcaggac atatgggcgc gtttgaaaga gatcgattat       240
     ccaattccaa ccttgaaaac atttttcaaa gatcggctct atcttgaggt ggctcaaagt       300
     gtcatgaaga gactgttcgt ccagccgcga agggaaaaga ttaccattga ccagggtgtg       360
     tatgggaagt atgacactcc ggttcccatt tcgatgacgc tgagacagga atggctggga       420
     tccgacctgc tcgaattttg gcgcttcagc ttccagtatg gatttgaaat gaccgatcac       480
     caacgcctta aatggccgac agacgctgat ctcgaggata tgcttgatcg acgaagctcc       540
     ggatcgtctt tcccccccaa acaggaaata cggcgccatt tctttacact ggtgagagcg       600
     agaggtttcc aagca                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page