(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_25

ID   PENCW_25; SV 1; linear; genomic DNA; GRV; FUN; 1704 BP.
XX
AC   AM920447_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   05-OCT-2010 (Rel. 125, Last updated, Version 3)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c32, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920447.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1704
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        complement(764..>1018)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127950"
FT                   /orf_name="Pc32g00010"
FT                   /product="Pc32g00010 protein"
FT                   /protein_id="CAP74124.1"
FT                   /db_xref="UniParc:UPI000183308C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX95"
FT                   /transl_table=1
FT                   /translation="DFRPFAPFGAINPNEVQNVSYRVDGLVPDKTFSSIRRNWNYYERD
FT                   PSQGFDVLLEWCINVVGVKEENARGHFRHAGLETNVCHL"
XX
SQ   Sequence 1704 BP; 411 A; 415 C; 406 G; 472 T; 0 other;
     ccgtgtgttc cattctttga cagccacgac tgagatgacc cacctccgct ttcctattta        60
     atccgcggca tggtgaacag tcgccagttg ttttctgagg ctagtacttc accactccat       120
     catttactgc tgctttgttc ctgttcccgg tacacaactc acaaactccc ctagcgttga       180
     aagggcttgt gaatccttca gccatgaacc aagccatgga tttcgtcgat cctgaacagg       240
     ctcatgttgc aatccgcaac cgacctcgct gccgcctttg tggtgaggcc accgagctta       300
     ggtacggtaa accttggaac cagaatggca atgagggtcg tccatactat atctgctcgt       360
     gcatccctca aaaaacgttc tcttgctttg gagatatgcg aggcgtgttg atggaaaatc       420
     ctacgtgctt ctgcgaccac gggatgcagt tcagtagacg tggaatccag aacccggagc       480
     ctggaatgcc gtggttctta cgaccgatat tttatacgtg cgccactggg ggctgttcat       540
     tctacgaacc catgacagat tgtgatggga agtttgtcct gaaccgtggg cctatttctg       600
     cgtcttcatt gagcctccgc ggtttctaag agactttatg ccggtgtaat gtaagaatta       660
     aaaacagacg ccaaagtcga tgccttttct aatgaaaatc tttataggcc aattccgtgg       720
     acctttgtcc aaatgcgcca caacaacact gcacgggtga atctcatagg tgacaaacgt       780
     tggtttccag gccggcatgg cgaaaatggc cccgggcatt ttcttccttg acaccgacca       840
     cgttgatgca ccattccagg agaacatcaa atccttgact ggggtccctt tcatagtaat       900
     tccaattacg tctgatgctg ctaaaggttt tgtctgggac caaaccatca actcgataac       960
     ttacattttg tacctcattc ggattaatgg caccgaaagg tgcaaacgga cggaaatctc      1020
     aggaacagca ccttgaaacc cggtttagga aagggagagt agaggcgttg ttttcattag      1080
     ggccagtata gcattgagga ccttgaatat gtgacatata ccagaaatta caagatgatt      1140
     actctataca aatgtaaaaa caaacgctag cagattgcat ggaaagagca aaaaactatt      1200
     ggcgatctcc gggataacca aatcattcgg ctggaggctg cgcagtgcca tcttgggggt      1260
     tcaaaggata ttcagccagc caagagcgtc ggctctgcgt ggctgaatcg agtgtcgctc      1320
     tcttgatgtt ttcgctgtgc tgtaagagtc tacctagcca ctgcgaggaa cctaaattga      1380
     aaggtccggc catacgaacc tcactttatc atttttcact gttttgttag tcgtcttagt      1440
     atgttcaggt accgtttgaa atgccttttt gtatgtcctc tggacctgct cgtggttcaa      1500
     ctgtatttga cacctcgact gtgtccgccg tctctattct tgatgatgct tgtagtgatc      1560
     ttctttattg ccgccccttg aaggtaacat gggcgctgat tgacgcggca tccgaggcct      1620
     tcgttcttgg tatctcaaat ctggctgaaa ctgagtcaca gttggaggtg caggtgccgt      1680
     catccagtct cggtctggta aaga                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page