(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_26

ID   PENCW_26; SV 1; linear; genomic DNA; GRV; FUN; 1455 BP.
XX
AC   AM920448_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   05-OCT-2010 (Rel. 125, Last updated, Version 3)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c33, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920448.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1455
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        <624..1133
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944745"
FT                   /orf_name="Pc33g00010"
FT                   /product="Putative uncharacterized protein Pc33g00010 "
FT                   /protein_id="CAP74125.1"
FT                   /db_xref="UniParc:UPI000183308D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX96"
FT                   /transl_table=1
FT                   /translation="KAQDYKMKKMPQEVTCTVRFFIECHFYPDLDSLSGFKWTGPDPLS
FT                   NSTRASDISLHMSALLFPKEVQWIEFRFVRFERVSGETIGEDMFFLPRVETALGNLRRF
FT                   RRQLLDTITWHAVRATGTIFRLSLRPRTESLPYSSLSAHSLLTRLPPTLSLNPRFFVHN
FT                   ISSNYE"
XX
SQ   Sequence 1455 BP; 358 A; 357 C; 326 G; 413 T; 1 other;
     ctttgtggtc ttatgcatcc attgcgagtt gtcgctggga ggtccggcct tcttncccgg        60
     tgttgtatcc gcgactgtgc aaatggaaac aacacgttcg tttatatcaa aaagttgccc       120
     agattcgacg cccaaccgaa ttcgaacatc attgcagacc acattgtatc ctgaccacgg       180
     gtatgatacc caatgcgcaa tgcttcttta tttctcacgc catcactata gccagtgaca       240
     cccgattaaa gtagtctgaa aaggccgaac acaaccaaca atccgggaaa gtcgcgttag       300
     aacacgtaat cagatcccaa ctgcgcttca cagacagtat tgattttgac gattaataat       360
     agctatgcca tgcgaaatga tgttactcag ctgttgtgca gtcggtttct caatcaagtt       420
     gaggtccatg tcgttctgta tatcagattg atgagtttac tgttcccgag aagcaggact       480
     ctcatctgcc gttcacgcaa tccatcattg tccaagtttg gtaattttca tcgcaaatgt       540
     agacattgag acatgactaa atgttgtggc tgctgtcttg ccttcttgga gcggattaag       600
     ccaacatggt acgccctgtc taaaaagccc aggattacaa aatgaagaag atgccgcaag       660
     aggttacgtg tacagtgaga ttctttatcg aatgccattt ctatcctgat ctcgacagtc       720
     tgtccgggtt caagtggaca ggtccagacc ctctgtccaa ctctactcgg gctagcgaca       780
     tttccctcca catgtcagcg ctccttttcc ctaaagaggt gcaatggata gaatttcgat       840
     ttgtgcgatt tgagcgggtg tctggtgaga ctataggaga ggatatgttc ttcctgccgc       900
     gggttgaaac agccctggga aatcttcgtc ggtttcgcag acagttgcta gacacaatca       960
     cctggcatgc tgtccgtgca acaggcacta tcttccggct gtcccttagg cctcgtacgg      1020
     aatccctacc gtattcgagt ctctcggcac attctctgtt gactaggctt cccccgacgc      1080
     tatccctgaa cccacggttt tttgtacaca atatatcgag taattacgag tgagattgat      1140
     ctgaatcaag cgggattatt cgtatactca tttcagtaaa gaccacgata atgaataatg      1200
     actatttggt gcccttcttg ttagaagcct cgggaatata taacctgctt tgcatgcggt      1260
     gtaatttccc ttgcactgcg tcgccgcttg tagtatttct atgttgccaa tataggacag      1320
     ggcaacccga aataggccat tccttactct tctcttgcga cgtccgtcaa cccggccaaa      1380
     ttgggactgt aggggtagtt ccagtcatcg agtaggttaa tcagtcgttc ccgagacgat      1440
     tcattgcatg ctcaa                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page