(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_27

ID   PENCW_27; SV 1; linear; genomic DNA; GRV; FUN; 1381 BP.
XX
AC   AM920449_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   05-OCT-2010 (Rel. 125, Last updated, Version 3)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c34, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920449.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1381
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        complement(<3..>506)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200314" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671150"
FT                   /orf_name="Pc34g00010"
FT                   /product="Pc34g00010 protein"
FT                   /protein_id="CAP74126.1"
FT                   /db_xref="UniParc:UPI000183308E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HX97"
FT                   /transl_table=1
FT                   /translation="RAQRSLRAAGVVLKAVSYIRTLLPHIQMSPWTIHITIVLNNPAVL
FT                   FSLEKPHLQGGQALIILITEEIIQLSKMGAKVNLQPPTEEDNEHTARTHSLAREATVEN
FT                   SEVNTPPWARTQLRASALRRARANAKQHRKDNFQQSTTGQFTRQLDSALPGPHTKMLYD
FT                   CLKSR"
XX
SQ   Sequence 1381 BP; 332 A; 331 C; 352 G; 366 T; 0 other;
     cttctcgatt tcaggcaatc atatagcatc ttcgtgtgag gtcctgggag agctgaatcc        60
     agctggcgtg taaactggcc cgtggtcgac tgttggaagt tgtccttccg gtgctgttta       120
     gcattggccc gtgcccgtcg caacgccgac gcccggagct gggttcgcgc ccatggcggg       180
     gtgttgactt cgctgttctc tactgttgct tcgcgtgcta ggctatgcgt tcgtgctgta       240
     tgctcattgt cctcttccgt tggcggctgc aggttgacct tagcgcccat cttcgacagc       300
     tgaataatct cttcagtgat caggatgatg agagcttggc cgccctggag atggggtttt       360
     tcaagagaaa acaggacggc agggttgttc agaacaatcg taatgtgtat tgtccacggc       420
     gacatctgga tgtgagggag cagcgtcctg atgtacgaga cagcctttaa caccacccca       480
     gctgcgcgta gtgagcgttg agcgcgtcat cactgccgag cgtccgattc gacgaggcaa       540
     tgtcgacttg attaatgcga acaactagtc caggtccgac cagaccattg cggacgctga       600
     cgctggtgaa cagccacagc cggggaacag ccacagccgg gcatggcccc aataaccact       660
     agtatagcag atcattgatc gtaataaagg tgaatcctag tatgtagtat aattaatatg       720
     tcgtgtttgt agtaaattta ctgatgcgac tggtagacat tatattgtga gtggttttgt       780
     aggttcagca tgttttgtag tcatatatat atttacacgc aatgcagacg catcgcaatt       840
     tctatgcatt tcggatcaca ctttcaattt cacttagact cgatagtcca ttgcttttac       900
     taggtttggt tatagctgaa cacatccatt gtataccttt ctactcaaat aacctgaata       960
     cgtagcacta ttaaatgaca cgggacgggg ctatggtcaa ccgcccgccc gcccataggc      1020
     aggggggaaa taactcagtg cgaatccatg ggcctcatgg cccgtggcga ggtctatcaa      1080
     tgtctcacca acgtagtacg gagattttca tgccatctca cccacatgga taaatgtatc      1140
     aatcactata gattctattt cgtaagcgaa aatttctagt cccattctga tcactcggtg      1200
     aagttggcat acagcctcaa tccgataggg atagtagatc cactggttca actatgacca      1260
     agcaatacgc cgaagaccca catgtagaag catgtgatga ggtgccgaac gattggcttg      1320
     agtaagatca gccatgcggt aggctttgtg ccttgcgaag cccaaagtca tcacttcagg      1380
     c                                                                      1381
//

If you have problems or comments...

PBIL Back to PBIL home page