(data stored in ACNUC8465 zone)

HOGENOMDNA: PYRAE_1

ID   PYRAE_1; SV 1; empty ; DNA; empty ; PRO; 2222430 BP.
XX
AC   NC_003364;
XX
PR   Project: 57727;
XX
DE   Pyrobaculum aerophilum str. IM2 chromosome, complete genome.
XX
OS   Pyrobaculum aerophilum str. IM2
OC   Archaea; Crenarchaeota; Thermoprotei; Thermoproteales; Thermoproteaceae;
OC   Pyrobaculum.
XX
RN   [1]
RP   1-2222430
RX   PUBMED; 11792869.
RA   Fitz-Gibbon,S.T., Ladner,H., Kim,U.J., Stetter,K.O., Simon,M.I. and
RA   Miller,J.H.;
RT   "Genome sequence of the hyperthermophilic crenarchaeon Pyrobaculum
RT   aerophilum";
RL   Proc. Natl. Acad. Sci. U.S.A. 99 (2), 984-989 (2002)
XX
RN   [2]
RP   1-2222430
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (24-JAN-2002) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2222430
RA   Fitz-Gibbon,S.T., Ladner,H., Kim,U.-J., Stetter,K.O., Simon,M.I. and
RA   Miller,J.H.;
RT   "Direct Submission";
RL   Submitted (12-DEC-2001) Microbiology and Molecular Genetics, University of
RL   California, Los Angeles, 405 Hilgard Ave, Los Angeles, CA 90095-1489, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AE009441.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2222430
FT                   /strain="IM2"
FT                   /mol_type="genomic DNA"
FT                   /organism="Pyrobaculum aerophilum str. IM2"
FT                   /db_xref="taxon:178306"
FT   gene            1..957
FT                   /db_xref="GeneID:1464732"
FT                   /locus_tag="PAE0001"
FT   CDS_pept        1..957
FT                   /locus_tag="PAE0001"
FT                   /gene_family="HOG000222165" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="GI:18311644"
FT                   /db_xref="GeneID:1464732"
FT                   /translation="MLGNYLTSALREAGIDCLCLPRHFKCRGDIAQCAAVWTLVGRYKI
FT                   CPGECSGVPVAEIDGVVFLRRGGGRTCGWELGRRCENQVEVQFKPPAWPIIVVDLSLWE
FT                   EHTRGEKHELVEQILATLGAVRRFLWDGNLWITNASGEFIELLNLHARGLVHKMGVFDK
FT                   MPQLENPVVLDPEGPCLFTEEVARGYSEFIIGGIVDKERTAKSATARLAELIGVSKRCR
FT                   IELRGSRVGVPDRINKIAEIVLRTWAGEPLEKAILATQAKRDRVYRLMWEIQKRAGRSQ
FT                   GGYLTLSRKALEEANWLGAPWEEVELALRKLRVKILD"
FT                   /protein_id="NP_558311.1"
FT   misc_feature    1..954
FT                   /note="tRNA (Guanine-1)-methyltransferase; Region:
FT                   tRNA_m1G_MT; cl00407"
FT                   /db_xref="CDD:174181"
FT                   /locus_tag="PAE0001"
FT   gene            complement(954..1427)
FT                   /db_xref="GeneID:1464708"
FT                   /locus_tag="PAE0002"
FT   CDS_pept        complement(954..1427)
FT                   /locus_tag="PAE0002"
FT                   /gene_family="HOG000222270" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="paREP1"
FT                   /transl_table="11"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="GI:18311645"
FT                   /db_xref="GeneID:1464708"
FT                   /translation="MIALSKPWVDLEKYRRDRLKEALYEAELAEEFLKNGLIRNAAGKA
FT                   FQAVKAYLAAVAAAHRDRIVAAFPGRRRISPAKVVERGEWIIAVMPTSRMREVAAIVGD
FT                   RELRLMVELALDLHEFQYNGLDGDAEVSRYASEEMVRRDIEEVVAFIKRAARA"
FT                   /protein_id="NP_558312.1"
FT   misc_feature    complement(996..1334)
FT                   /note="Archaeal PaREP1/PaREP8 family; Region: PaREP1;
FT                   pfam05942"
FT                   /db_xref="CDD:147864"
FT                   /locus_tag="PAE0002"
FT   gene            complement(1471..2397)
FT                   /db_xref="GeneID:1464709"
FT                   /locus_tag="PAE0005"
FT   CDS_pept        complement(1471..2397)
FT                   /locus_tag="PAE0005"
FT                   /gene_family="HOG000072016" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase, putative"
FT                   /transl_table="11"
FT                   /note="Protein fate; Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /db_xref="GI:18311646"
FT                   /db_xref="GeneID:1464709"
FT                   /translation="MIVDLHQDIAYYFLTSLNPPPFDQDYGGRQSDLPKLRRAGVDLVF
FT                   AAVFPFVNAYGSWTPSRELILEGLKVYYTISERHGVKLVEGRGDLYAPGVKFLIALEGA
FT                   DVLYTVEDLRLLYKMGVRAVGITWNLDNKWGHSCYSRRDGGLTASGEELVEEAQRLGMV
FT                   VDLAHASKQTALDVLKIAKKPVVISHANVRAVNPHPRNVDDDVIKALLDNGGVLGLTFI
FT                   PGTISQSPTPRDLARHAAYVKDKFGVEVLALGTDYLGISATPQGLESADKIPNFINALR
FT                   EVGFTEEEIEAVAWRNAYRVLKEALRG"
FT                   /protein_id="NP_558313.1"
FT   misc_feature    complement(1495..2397)
FT                   /note="renal dipeptidase (rDP), best studied in mammals and
FT                   also called membrane or microsomal dipeptidase, is a
FT                   membrane-bound glycoprotein hydrolyzing dipeptides and is
FT                   involved in hydrolytic metabolism of penem and carbapenem
FT                   beta-lactam antibiotics...; Region: rDP_like; cd01301"
FT                   /db_xref="CDD:30044"
FT                   /locus_tag="PAE0005"
FT   misc_feature    complement(order(1621..1623,1630..1632,1798..1800,
FT                   1831..1833,1894..1896,2092..2094,2251..2253,2374..2376,
FT                   2380..2382))
FT                   /note="active site"
FT                   /db_xref="CDD:30044"
FT                   /locus_tag="PAE0005"
FT   misc_feature    complement(order(2041..2046,2053..2058,2062..2067,
FT                   2176..2178,2188..2190,2197..2202,2206..2214,2245..2247))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:30044"
FT                   /locus_tag="PAE0005"
FT   gene            2640..3797
FT                   /db_xref="GeneID:1464710"
FT                   /locus_tag="PAE0007"
FT   CDS_pept        2640..3797
FT                   /locus_tag="PAE0007"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="GI:18311647"
FT                   /db_xref="GeneID:1464710"
FT                   /translation="MSLSLSLKNFGPVINGKIIVKPMTVFIGPNASGKSYTAMALYAFY
FT                   SGLTRSYALPRLACAEYSRKKKWEEYLQWLQKRAVNVVEKEFRRVFGLNLQDLTTRGAS
FT                   GGELILTVKHRRERVKYILKWPDVSLKIEGLKCSKRGGNNVSALFDYLRSRVLYLPASR
FT                   SGLVQTYGFYVDLVIRVAEELPITGVRLVPLPGIVGDFLRWLLVPPMEETQLYQLFREK
FT                   LGVDVERKERGVVVRFDGLEMDIRNSPSGIAELAPLGLMLRHGIVKKKYMIIIEEPEAH
FT                   LHPEMQVKTMDLLAELAARGVRLILTTHSDLMLNRLSNIVLEGKILTRNKVAVYLFKRE
FT                   GNGYITERIKIGKEGIPDDEFLRVYDQLYKEYMSLIYASQVRESG"
FT                   /protein_id="NP_558314.1"
FT   misc_feature    2640..3791
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="PAE0007"
FT   gene            3784..4143
FT                   /db_xref="GeneID:1464711"
FT                   /locus_tag="PAE0008"
FT   CDS_pept        3784..4143
FT                   /locus_tag="PAE0008"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Hypothetical"
FT                   /db_xref="GI:18311648"
FT                   /db_xref="GeneID:1464711"
FT                   /translation="MKVDDYTIRLPEGLRLIDLALLDREESRGKKADYKVTFNSKCGEI
FT                   ILIEVTGVPEIRNIRKVEARGVVVKIIHHSGGVRTPVYQLARKYKIALLNCSSNNYIDL
FT                   ELVFINYYKELYNKC"
FT                   /protein_id="NP_558315.1"
FT   gene            complement(4316..4456)
FT                   /db_xref="GeneID:1464712"
FT                   /locus_tag="PAE0009"
FT   CDS_pept        complement(4316..4456)
FT                   /locus_tag="PAE0009"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Hypothetical"
FT                   /db_xref="GI:18311649"
FT                   /db_xref="GeneID:1464712"
FT                   /translation="MSRELAKRLRDVADLLEAAVEDGDCKTAEEALDELREIIEELESG
FT                   A"
FT                   /protein_id="NP_558316.1"
FT   gene            complement(4483..5151)
FT                   /db_xref="GeneID:1464713"
FT                   /locus_tag="PAE0010"
FT   CDS_pept        complement(4483..5151)
FT                   /locus_tag="PAE0010"
FT                   /gene_family="HOG000266145" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="coenzyme PQQ synthesis protein, conjectural"
FT                   /transl_table="11"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Menaquinone and ubiquinone"
FT                   /db_xref="GI:18311650"
FT                   /db_xref="GeneID:1464713"
FT                   /translation="MSATPRVRVLEIFASLQGEGINLGRPAVFVRLAGCPIRCIYCDTK
FT                   YSWDFNAGVEMGVEEIVAKALALSVVGHVVVTGGEPLIWQRRGLEELACALRALGSVEV
FT                   ETSGAYPPTPELDRCVDFYDVSPKLSNAGVKAPFSPFYASSPKAWFKFVVSNADDVEEV
FT                   ERFVVAYGIPRGRVFLMPMAESPEEHGEALRRIWDAAVRGGFRVTPRLHIMAWGNARGK
FT                   "
FT                   /protein_id="NP_558317.1"
FT   misc_feature    complement(4498..5142)
FT                   /note="Organic radical activating enzymes
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: NrdG; COG0602"
FT                   /db_xref="CDD:30947"
FT                   /locus_tag="PAE0010"
FT   misc_feature    complement(4489..5139)
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cl14056"
FT                   /db_xref="CDD:176838"
FT                   /locus_tag="PAE0010"
FT   gene            complement(5152..5586)
FT                   /db_xref="GeneID:1464714"
FT                   /locus_tag="PAE0012"
FT   CDS_pept        complement(5152..5586)
FT                   /locus_tag="PAE0012"
FT                   /gene_family="HOG000222166" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="GI:18311651"
FT                   /db_xref="GeneID:1464714"
FT                   /translation="MYLRLPPKIKVLEALGAVADGRVKVLGGGRCEVVSSEGDKTYTVV
FT                   IEGEYAYSNDNGTIYRGYIGYPILACLMAGGKLPADKELAERLRGIPWKRLNEKFKKYV
FT                   DVLQYIYAERGIDRERAEGYISMVLKEVGKLRLKFGGKSQ"
FT                   /protein_id="NP_558318.1"
FT   gene            complement(5759..6184)
FT                   /db_xref="GeneID:1464715"
FT                   /locus_tag="PAE0013"
FT   CDS_pept        complement(5759..6184)
FT                   /locus_tag="PAE0013"
FT                   /gene_family="HOG000222167" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="GI:18311652"
FT                   /db_xref="GeneID:1464715"
FT                   /translation="MGPPPWAFISRRGLREVVLWLLSDRPMNGAEIIRAVEDFTWGFWR
FT                   PSPGSVYPLLKQLEAEGLVSKRPDGRYELTESGRSAVKLIPWIRGPRLGAPRSIAEIID
FT                   ELESWAMYITDVAITEPDRIAPYRERIRRIGELLSKI"
FT                   /protein_id="NP_558319.1"
FT   misc_feature    complement(5942..6145)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="PAE0013"
FT   gene            complement(6400..7134)
FT                   /db_xref="GeneID:1464716"
FT                   /locus_tag="PAE0014"
FT   CDS_pept        complement(6400..7134)
FT                   /locus_tag="PAE0014"
FT                   /gene_family="HOG000222168" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Hypothetical"
FT                   /db_xref="GI:18311653"
FT                   /db_xref="GeneID:1464716"
FT                   /translation="MKCFCGRPALESGFCPYHDPNCVRDKACRRRLEFLPDCEKCNLPG
FT                   GEVVDVSPRLRGARIYGPLAVQFVTGNVDLAEARGIDVYIHSVKGDVDLRGAKFRHVFI
FT                   NEVVGAVFLTGARLETAMLQSVKGDVNGDGIAAGGHVYAGGISGAVSLTDARIVGEALI
FT                   EEVRGEVRIRAEAYSISLYRVKGDVALANSRVEGDIRIVESTGDRLDLSGVEIQGRVVI
FT                   LNSKFGGVRIDRADLFKKLVVL"
FT                   /protein_id="NP_558320.1"
FT   misc_feature    complement(6514..>6990)
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG3595"
FT                   /db_xref="CDD:33395"
FT                   /locus_tag="PAE0014"
FT   gene            complement(7499..7612)
FT                   /db_xref="GeneID:1464717"
FT                   /locus_tag="PAE0015"
FT   CDS_pept        complement(7499..7612)
FT                   /locus_tag="PAE0015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Hypothetical"
FT                   /db_xref="GI:18311654"
FT                   /db_xref="GeneID:1464717"
FT                   /translation="MPLKKTVTALEQETRSFKLFLGKVAGQRLLQLSRDFN"
FT                   /protein_id="NP_558321.1"
FT   gene            complement(7672..7767)
FT                   /db_xref="GeneID:1464718"
FT                   /locus_tag="PAE0016"
FT   CDS_pept        complement(7672..7767)
FT                   /locus_tag="PAE0016"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Hypothetical"
FT                   /db_xref="GI:18311655"
FT                   /db_xref="GeneID:1464718"
FT                   /translation="MAESLKLLEAEVKTQIQHVAREIDQLRQRIP"
FT                   /protein_id="NP_558322.1"
FT   gene            7914..8318
FT                   /db_xref="GeneID:1464719"
FT                   /locus_tag="PAE0017"
FT   CDS_pept        7914..8318
FT                   /locus_tag="PAE0017"
FT                   /gene_family="HOG000222169" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="GI:18311656"
FT                   /db_xref="GeneID:1464719"
FT                   /translation="MSIKPKFGEEILKGLKKYELRRLVGPLVEPGDLLYLYFTKPAGAV
FT                   IGRFTAGIVFLVPAGSISRLLGELGDVGIGAEDLEYVKGAKYAMLIQVKNPEACTAPVR
FT                   LSDAGLRPPPSYRRLKGEGAEALSRLCVRS"
FT                   /protein_id="NP_558323.1"
FT   misc_feature    7914..8276
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG4933"
FT                   /db_xref="CDD:34541"
FT                   /locus_tag="PAE0017"
FT   gene            complement(8315..9208)
FT                   /db_xref="GeneID:1464720"
FT                   /locus_tag="PAE0019"
FT   CDS_pept        complement(8315..9208)
FT                   /locus_tag="PAE0019"
FT                   /gene_family="HOG000222171" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="GI:18311657"
FT                   /db_xref="GeneID:1464720"
FT                   /translation="MEFKPDFKVVAGGVELGMKFFKTLLAVEITGSISGAARTVGMPYT
FT                   SVWNMLARAERALKIKLVEPRRRGGARLTAEGRGLLKRYMAEIAKRGMVLGLSDFIYAG
FT                   SHDPVVEKALEGGEAYFVGSMQGFLLVAGGLAHFGGIHLGDNWEFVKKYGPHLCLVAGF
FT                   MREVGVASRVEIRDLAQLRGLRLVNRPPGTGTRTHIDRLLAEIGVVPRAAPGYSDIATT
FT                   HDDAAIKVASGGADYTVTVRHVAEKYGLNFYKLLDEAFDFVCVPESCGRVAQFVKELSL
FT                   PSGYKPQKDAGEIRCI"
FT                   /protein_id="NP_558324.1"
FT   misc_feature    complement(8870..9208)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="PAE0019"
FT   misc_feature    complement(8318..8899)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="PAE0019"
FT   gene            9243..10184
FT                   /db_xref="GeneID:1464721"
FT                   /locus_tag="PAE0020"
FT   CDS_pept        9243..10184
FT                   /locus_tag="PAE0020"
FT                   /gene_family="HOG000228885" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="binding protein, putative"
FT                   /transl_table="11"
FT                   /note="Transport and binding proteins; Anions"
FT                   /db_xref="GI:18311658"
FT                   /db_xref="GeneID:1464721"
FT                   /translation="MSKIGYLIIIIVAIVAVAALLAIPRPQAPMTQTPMAQASTSTTTP
FT                   QKIVLYMATTTSVKDTGLLDVLIPDFEKWAASRGYNIEVRYTAVGTGQALAMAARGDVD
FT                   VVIVHAPSLEKQYLENGTLKCRDVIAYNFFIIVGPRDDPAGAKSLTATEAFRRIAEAKA
FT                   PFVSRGDRSGTHLMELSLWRRAIGREPDPKNDTWYISAGAGMGQTLLLANEKSAYTLSD
FT                   TGTWLRYRDKLPQLDVIVQAAPDLINIYSFSIVKLSNATRLMAQYMKTRGLEVIGNLTI
FT                   NGVSLFTPINKADPKAMEWIKTAIFGPSCVER"
FT                   /protein_id="NP_558325.1"
FT   misc_feature    9312..10136
FT                   /note="ABC-type tungstate transport system, permease
FT                   component [Coenzyme metabolism]; Region: TupB; COG2998"
FT                   /db_xref="CDD:32816"
FT                   /locus_tag="PAE0020"
FT   misc_feature    9483..>9818
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="PAE0020"
FT   gene            10171..10818
FT                   /db_xref="GeneID:1464722"
FT                   /locus_tag="PAE0022"
FT   CDS_pept        10171..10818
FT                   /locus_tag="PAE0022"
FT                   /gene_family="HOG000263701" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sulfate transport system, permease protein,
FT                   putative"
FT                   /transl_table="11"
FT                   /note="Transport and binding proteins; Anions"
FT                   /db_xref="GI:18311659"
FT                   /db_xref="GeneID:1464722"
FT                   /translation="MLSDELIGIVLNTLYVSTIPVFISALVGTPIALFLHLRGGRTALV
FT                   FKMAFNGLIGMPTVLLGLLLYLLLSRSGPFGWLNLLYTLDAVVIGHVFLILPLYIAYVL
FT                   TALEAVDPRIKELAAMFNLSALKKASIYFREAAGGIAGAAAAAYGRAVGELGLALMLGG
FT                   DIRYRTRVLTTAIAHETMLGNWDAAIQLGVVLLAISVAISAVVTALGFRYRG"
FT                   /protein_id="NP_558326.1"
FT   misc_feature    10171..10746
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="PAE0022"
FT   gene            10815..11417
FT                   /db_xref="GeneID:1464723"
FT                   /locus_tag="PAE0023"
FT   CDS_pept        10815..11417
FT                   /locus_tag="PAE0023"
FT                   /codon_start="1"
FT                   /product="sulfate transport system, ATP-binding protein,
FT                   putative"
FT                   /transl_table="11"
FT                   /note="Transport and binding proteins; Anions"
FT                   /db_xref="GI:18311660"
FT                   /db_xref="GeneID:1464723"
FT                   /translation="MIKAVALGKRYNDVYVFKNVYIDLPQRGLVALVGPNGSGKTTLLK
FT                   IFAMLTEPSEGEVYILGAPWREARVKHRGRVLYAHQEPLVYSGTVEQNLICNDDDVLEA
FT                   LGLKGLMRHKAKGLSGGYKKLLTVARVLACKPQIALLDEPTAYLDPGKRQGLLEYLNEY
FT                   AKKSLVVWTTHYPPEADSSEQVYEIRDGNLRLLKSRI"
FT                   /protein_id="NP_558327.1"
FT   misc_feature    10815..11393
FT                   /note="ABC-type cobalt transport system, ATPase component
FT                   [Inorganic ion transport and metabolism]; Region: CbiO;
FT                   COG1122"
FT                   /db_xref="CDD:31319"
FT                   /locus_tag="PAE0023"
FT   misc_feature    10818..11393
FT                   /note="This family of ATP-binding proteins belongs to a
FT                   multisubunit transporter involved in drug resistance (BcrA
FT                   and DrrA), nodulation, lipid transport, and lantibiotic
FT                   immunity.  In bacteria and archaea, these transporters
FT                   usually include an ATP-binding...; Region:
FT                   ABC_DR_subfamily_A; cd03230"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="PAE0023"
FT   misc_feature    10914..10937
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="PAE0023"
FT   misc_feature    order(10923..10928,10932..10940,11055..11057,11238..11243,
FT                   11334..11336)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="PAE0023"
FT   misc_feature    11046..11057
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="PAE0023"
FT   misc_feature    11166..11195
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="PAE0023"
FT   misc_feature    11226..11243
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="PAE0023"
FT   misc_feature    11250..11261
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="PAE0023"
FT   misc_feature    11322..11342
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="PAE0023"
FT   gene            complement(11425..12141)
FT                   /db_xref="GeneID:1464724"
FT                   /locus_tag="PAE0025"