(data stored in ACNUC8465 zone)

HOGENOMDNA: RICB8_1

ID   RICB8_1; SV 1; empty ; DNA; empty ; PRO; 1528980 BP.
XX
AC   NC_009883;
XX
PR   Project: 58681;
XX
DE   Rickettsia bellii OSU 85-389, complete genome.
XX
OS   Rickettsia bellii OSU 85-389
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales;
OC   Rickettsiaceae; Rickettsieae; Rickettsia.
XX
RN   [1]
RP   1-1528980
RA   Madan,A., Lee,H., Madan,A., Yoon,J.-G., Ryu,G.-Y., Dasch,G. and
RA   Ereemeva,M.;
RT   "Complete genome sequencing of Rickettsia bellii";
RL   Unpublished
XX
RN   [2]
RP   1-1528980
RA   Madan,A., Lee,H., Madan,A., Yoon,J.-G., Ryu,G.-Y., Dasch,G. and
RA   Ereemeva,M.;
RT   "Direct Submission";
RL   Submitted (27-SEP-2007) Neurogenomics Research Lab, University of Iowa,
RL   200 B EMRB, Iowa City, IA 52242, USA
XX
RN   [3]
RP   1-1528980
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (16-SEP-2004) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000849.
CC   Annotation was added by the NCBI Prokaryotic Genomes Automatic
CC   Annotation Pipeline Group.  Information about the Pipeline can be
CC   found here:
CC   http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html. Please be
CC   aware that the annotation is done automatically with little or no
CC   manual curation.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1528980
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:391896"
FT                   /collection_date="13-May-1985"
FT                   /country="USA: Franklin Co., Ohio"
FT                   /note="isolated in Vero cell culture at 34 C by Karl
FT                   Poetter and Chip Pretzman; spaghetti forms seen"
FT                   /strain="OSU 85-389"
FT                   /host="Dermacentor variabilis adult female tick"
FT                   /organism="Rickettsia bellii OSU 85-389"
FT   gene            1..822
FT                   /db_xref="GeneID:5646281"
FT                   /locus_tag="A1I_00005"
FT   CDS_pept        1..822
FT                   /locus_tag="A1I_00005"
FT                   /gene_family="HOG000218052" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1806 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="GI:157826386"
FT                   /db_xref="GeneID:5646281"
FT                   /translation="MTKLIIHLVSDSSVQTAKSAAHSSLAQFTSLKPKLYHWPMIRNSE
FT                   LLKEVLSNIESKHGIVLYTIADQELRKTLTKFCYELKIPCISVIGKIIKEMSVFSGIEI
FT                   EKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQLLNELQFADIVLIGPSRTSKTPTSVFLA
FT                   YNGLKTANIPYVYNCPFPDFIEKDIDQLVVGLVINPNRLIEIRETRLNLLQINENRNYT
FT                   DFNIVQKECLEVKKICELRNWPVIDVSTKSIEETAALIMRIYYNKKNKYNK"
FT                   /protein_id="YP_001495450.1"
FT   misc_feature    1..789
FT                   /note="Domain of unknown function (DUF299); Region: DUF299;
FT                   cl00780"
FT                   /db_xref="CDD:174387"
FT                   /locus_tag="A1I_00005"
FT   gene            856..1215
FT                   /db_xref="GeneID:5647270"
FT                   /locus_tag="A1I_00010"
FT   CDS_pept        856..1215
FT                   /locus_tag="A1I_00010"
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thioredoxin"
FT                   /transl_table="11"
FT                   /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="GI:157826387"
FT                   /db_xref="GeneID:5647270"
FT                   /translation="MVIYNFTCKKYRGHMASNVTDKSFEEEVLKSDLPVLVDFWAEWCG
FT                   PCRMLTPIIEEISKDLESKVKVLKMNIDENPEIPSKYGIRSIPTVMLFKNGEQKDTKVG
FT                   LHQKNSLIEWINNNI"
FT                   /protein_id="YP_001495451.1"
FT   misc_feature    931..1203
FT                   /note="TRX family; composed of two groups: Group I, which
FT                   includes proteins that exclusively encode a TRX domain; and
FT                   Group II, which are composed of fusion proteins of TRX and
FT                   additional domains. Group I TRX is a small ancient protein
FT                   that alter the redox...; Region: TRX_family; cd02947"
FT                   /db_xref="CDD:48496"
FT                   /locus_tag="A1I_00010"
FT   misc_feature    order(985..987,994..996)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:48496"
FT                   /locus_tag="A1I_00010"
FT   gene            1227..1973
FT                   /db_xref="GeneID:5647271"
FT                   /locus_tag="A1I_00015"
FT   CDS_pept        1227..1973
FT                   /locus_tag="A1I_00015"
FT                   /codon_start="1"
FT                   /product="O-antigen export system ATP-binding protein RfbE"
FT                   /transl_table="11"
FT                   /note="COG1134 ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component"
FT                   /db_xref="GI:157826388"
FT                   /db_xref="GeneID:5647271"
FT                   /translation="MSFNHSKVFIEIKNAYVEGIDTHKRAQGLKHFFLNRGTSFSPNIP
FT                   ILKKINFSCYEGEKVAFVGSNGSGKSSLLKMIAGIYPPIKGTINVCGEIAPIIDMGVGF
FT                   EQEQTGRDNIKMLMLYNNMLDKYNKETEQEIIDFSELGKKIDLPIKNYSSGMLARLAFS
FT                   TSIFQNPQILLLDEVFATGDNYFVEKSLNLMKNKFRNTPISIIVTHQENIVKENCTRCI
FT                   LLRDGNIVGDGKPSEIFKIYTRRKRK"
FT                   /protein_id="YP_001495452.1"
FT   misc_feature    1227..1952
FT                   /note="ABC-type polysaccharide/polyol phosphate transport
FT                   system, ATPase component [Carbohydrate transport and
FT                   metabolism / Cell envelope biogenesis, outer membrane];
FT                   Region: TagH; COG1134"
FT                   /db_xref="CDD:31329"
FT                   /locus_tag="A1I_00015"
FT   misc_feature    1254..1925
FT                   /note="ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter
FT                   subfamily is involved in extracellular polysaccharide
FT                   export.  Among the variety of membrane-linked or
FT                   extracellular polysaccharides excreted by bacteria, only
FT                   capsular polysaccharides, lipopolysaccharides...; Region:
FT                   ABC_KpsT_Wzt; cd03220"
FT                   /db_xref="CDD:72979"
FT                   /locus_tag="A1I_00015"
FT   misc_feature    1416..1439
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72979"
FT                   /locus_tag="A1I_00015"
FT   misc_feature    order(1425..1430,1434..1442,1644..1646,1752..1757,
FT                   1851..1853)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72979"
FT                   /locus_tag="A1I_00015"
FT   misc_feature    1635..1646
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72979"
FT                   /locus_tag="A1I_00015"
FT   misc_feature    1680..1709
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72979"
FT                   /locus_tag="A1I_00015"
FT   misc_feature    1740..1757
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72979"
FT                   /locus_tag="A1I_00015"
FT   misc_feature    1764..1775
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72979"
FT                   /locus_tag="A1I_00015"
FT   misc_feature    1839..1859
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72979"
FT                   /locus_tag="A1I_00015"
FT   gene            1970..2746
FT                   /db_xref="GeneID:5647272"
FT                   /locus_tag="A1I_00020"
FT   CDS_pept        1970..2746
FT                   /locus_tag="A1I_00020"
FT                   /gene_family="HOG000010610" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="O-antigen export system permease protein RfbA"
FT                   /transl_table="11"
FT                   /note="COG1682 ABC-type polysaccharide/polyol phosphate
FT                   export systems, permease component"
FT                   /db_xref="GI:157826389"
FT                   /db_xref="GeneID:5647272"
FT                   /translation="MIKYFLSKKYWESVILLVKASIIRQNKDSFLGSLWSLIQPFVNIL
FT                   VISYFFGFLLHQPREFLIMNLVGGMPLWTFIVSSLTISSNSLVTRDQVIKKVRISKTFF
FT                   PVADSLAQLYNLFCSFLAMYCAFILLFPEKFTWQIIFMPILILPLIVCIISGSIVMAFL
FT                   TPYIRDIPQILNVVLGVIYWSIPIIYPYSLIPESKRKFFELNPFFIIIRPAQSLVINGA
FT                   LPDLISIGKSVLVAFITVCISYLVYKRFSKRVIYYL"
FT                   /protein_id="YP_001495453.1"
FT   misc_feature    1970..2743
FT                   /note="ABC-2 type transporter; Region: ABC2_membrane;
FT                   cl11417"
FT                   /db_xref="CDD:164215"
FT                   /locus_tag="A1I_00020"
FT   gene            2743..5997
FT                   /db_xref="GeneID:5646215"
FT                   /locus_tag="A1I_00025"
FT   CDS_pept        2743..5997
FT                   /locus_tag="A1I_00025"
FT                   /gene_family="HOG000230305" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative bifunctional glutamate synthase subunit
FT                   beta/2-polyprenylphenol hydroxylase"
FT                   /transl_table="11"
FT                   /note="undetermined function"
FT                   /db_xref="GI:157826390"
FT                   /db_xref="GeneID:5646215"
FT                   /translation="MKLGFNLDFKKLDLTGLKKLDQIFLDYLFKANKSLYDSILLFRSN
FT                   PYSILSQDYSEFLLNISPYLDDFLAELFCISNEITSLRLQHKDFDIIYECKRKFVQRYA
FT                   IKKYSQEKIKDIDFEDIYLKLVDLIGKNFTSRDFAKQVIIWQQAEESFVKELDIAAQYA
FT                   AYRVSSRGFIDGVIPWSRHGIQKKQIDSAIKLRNDILFDLPQKLDKENLIDDKKISKYQ
FT                   KNERLNFDYTDSFLNLDEALNHSHYCIYCHKQDKDSCSKGQNVIPTEAFSYSSNLSSRG
FT                   LGTRSSNKKYNCKKLDFSRFILDLVPKPRDDTERIFRSIQQLQSSQGMKGCPLKQKISE
FT                   MNYVKAQGFNLSALAIIVIDNPMVAATGHRICNDCSKACIYQKQDPVNIPLIESNILEE
FT                   TLKLPYGLEIYLLLTRWNPLNIYNPLPKESTNYNILVTGLGPGGFSLSYYLLRSGHNVT
FT                   AIDGLKITPLPFDIHKPIKFWHEYKNKLSERVPKGFGGVAEYGITVRWDKNNLDILRLI
FT                   LERNSQFKYYDGVALDFNITKEQAFDLGFDHIAFCIGAGKPKILDIENFDVKGVKTASD
FT                   FLMTLQSGGAFLENSNTNMLIRMPIAVIGGGLTSLDAATESLYYYKKQVKSFVKDYEFV
FT                   VAKYGKDYTEEDKEIAEEFIAHAKLFEKAKNNEELKEVFKKLGGATIYYRGKLQDSPAY
FT                   KLNHEELIYALALGVNFEENMQPLRINNDKYGHVESVEFRNQTYLMSSRGLTTGSSKST
FT                   NCNAVADFLDPVVKPRIDIIVKAKTVIMAIGIENNTEFDEDKYSYFGDCNPKYSGSVVK
FT                   ALANSKDGYEAINKKLANNNPNFKGDYKNFVKQLDDLLISKVHKINILGDKIFELVIHS
FT                   PLAARNFKPGQFFRLQNYSNDITKLIEPIALSVADIDIESGLISFIIYDIGKSTSLCKL
FT                   FSEDEKVVLMGPSGMPLEIPSNKRIVVIDTEPNNILIKALKDNNNEVMFFTYPEIKTQK
FT                   LTSVDRVIINASPEIAEELQSLKIFGESAEIIVSVNSSMQCMMKGICGQCIQKVEDERK
FT                   YIFACSCQNQKAEIVDFESLKTRLRQNSLQEKMKKL"
FT                   /protein_id="YP_001495454.1"
FT   misc_feature    2743..5994
FT                   /note="putative bifunctional glutamate synthase subunit
FT                   beta/2-polyprenylphenol hydroxylase; Validated; Region:
FT                   PRK06567"
FT                   /db_xref="CDD:168614"
FT                   /locus_tag="A1I_00025"
FT   misc_feature    3571..3678
FT                   /note="Rickettsial palindromic element RPE4 domain; Region:
FT                   RPE4; TIGR03777"
FT                   /db_xref="CDD:163489"
FT                   /locus_tag="A1I_00025"
FT   misc_feature    4960..5055
FT                   /note="Rickettsial palindromic element RPE4 domain; Region:
FT                   RPE4; TIGR03777"
FT                   /db_xref="CDD:163489"
FT                   /locus_tag="A1I_00025"
FT   misc_feature    5302..5916
FT                   /note="FAD/NAD binding domain (electron transfer subunit)
FT                   of dihydroorotate dehydrogenase-like proteins.
FT                   Dihydroorotate dehydrogenases (DHODs) catalyze the only
FT                   redox reaction in pyrimidine de novo biosynthesis. They
FT                   catalyze the oxidation of (S)-...; Region:
FT                   DHOD_e_trans_like; cd06192"
FT                   /db_xref="CDD:99789"
FT                   /locus_tag="A1I_00025"
FT   misc_feature    order(5434..5436,5440..5451,5491..5499,5515..5523,
FT                   5818..5823)
FT                   /note="FAD binding pocket; other site"
FT                   /db_xref="CDD:99789"
FT                   /locus_tag="A1I_00025"
FT   misc_feature    order(5440..5442,5446..5451)
FT                   /note="FAD binding motif; other site"
FT                   /db_xref="CDD:99789"
FT                   /locus_tag="A1I_00025"
FT   misc_feature    order(5512..5514,5521..5523,5530..5532,5542..5544,
FT                   5566..5568,5572..5574)
FT                   /note="phosphate binding motif; other site"
FT                   /db_xref="CDD:99789"
FT                   /locus_tag="A1I_00025"
FT   misc_feature    order(5650..5658,5740..5745)
FT                   /note="NAD binding pocket; other site"
FT                   /db_xref="CDD:99789"
FT                   /locus_tag="A1I_00025"
FT   misc_feature    order(5830..5832,5848..5850,5857..5859,5905..5907)
FT                   /note="Iron coordination center; other site"
FT                   /db_xref="CDD:99789"
FT                   /locus_tag="A1I_00025"
FT   gene            complement(6020..6439)
FT                   /db_xref="GeneID:5646216"
FT                   /locus_tag="A1I_00030"
FT   CDS_pept        complement(6020..6439)
FT                   /locus_tag="A1I_00030"
FT                   /gene_family="HOG000232166" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SOS-response transcriptional repressors
FT                   (RecA-mediated autopeptidases)"
FT                   /transl_table="11"
FT                   /note="COG1974 SOS-response transcriptional repressors
FT                   (RecA-mediated autopeptidases)"
FT                   /db_xref="GI:157826391"
FT                   /db_xref="GeneID:5646216"
FT                   /translation="MQIKEIFSCSVEKACELPLFDTKVQAGYPSPADGYMSNSLDLNSH
FT                   LIKHPKSTFFVQVTGDSMIDAGIRENDLLIVDKSLPPTNNKIVIAVINNEFTVKRLKFI
FT                   NDEAYLMPENKDFPPTKIENGTYIWGVVTSVIQQF"
FT                   /protein_id="YP_001495455.1"
FT   misc_feature    complement(6041..6280)
FT                   /note="Peptidase S24 LexA-like proteins are involved in the
FT                   SOS response leading to the repair of single-stranded DNA
FT                   within the bacterial cell. This family includes: the lambda
FT                   repressor CI/C2 family and related bacterial prophage
FT                   repressor proteins; LexA...; Region: S24_LexA-like;
FT                   cd06529"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="A1I_00030"
FT   misc_feature    complement(order(6143..6145,6254..6256))
FT                   /note="Catalytic site; other site"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="A1I_00030"
FT   gene            complement(6506..7612)
FT                   /db_xref="GeneID:5646217"
FT                   /locus_tag="A1I_00035"
FT   CDS_pept        complement(6506..7612)
FT                   /locus_tag="A1I_00035"
FT                   /gene_family="HOG000124180" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyltransferase family protein"
FT                   /transl_table="11"
FT                   /note="COG1835 Predicted acyltransferases"
FT                   /db_xref="GI:157826392"
FT                   /db_xref="GeneID:5646217"
FT                   /translation="MQKLVLLHVQKRDELIDVLRGIAIILVLILHFHLSYTIESWNFNF
FT                   LMHGNYGVTIFFVISGYLISTNALKRYGDLASIDIKHFYLLRCARILPPLFFALIIISL
FT                   FYALDLKSFINLVYKDGVNNPSLGLTIFSVLTFWHNVMMDYYGYFNYAINIYWSLSVEE
FT                   FFYLIFPLACVILRNRKLIIFILISIIAISPIYRYMNRNDEIIFMYSYLACSDAISIGI
FT                   LSALLKSNIKYFPQKNLIRVFGFSLIGFVYFILGIHGFEAIGFSLVSLGTGLIIISSYS
FT                   QTFKSNVVSKLLSFLGKISYELYLFHIIILGLIRGIIVPKNLSGLPAIGLLSMFLFCSV
FT                   LISYLISRFYSEPINRFFRRCLMAKYNC"
FT                   /protein_id="YP_001495456.1"
FT   misc_feature    complement(6533..7591)
FT                   /note="Predicted acyltransferases [Lipid metabolism];
FT                   Region: COG1835; cl00792"
FT                   /db_xref="CDD:174391"
FT                   /locus_tag="A1I_00035"
FT   gene            complement(7643..8665)
FT                   /db_xref="GeneID:5646218"
FT                   /locus_tag="A1I_00040"
FT   CDS_pept        complement(7643..8665)
FT                   /locus_tag="A1I_00040"
FT                   /gene_family="HOG000097665" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG4804 Uncharacterized conserved protein"
FT                   /db_xref="GI:157826393"
FT                   /db_xref="GeneID:5646218"
FT                   /translation="MSTNIVNSEYLEFLEQLKIRVSQSRYQAARSVNSELIRLYHYIGS
FT                   EILNRQERYGWGAKVIDNLSRDLHSAFPEMKGFGSRNLKYMKRFAEEYRDTEFVQQPAA
FT                   QLPWFHIVVLLDKVKDNQHRIFYIKKTIENGWSRSTLIRQIELELHKRQGQAITNFQNK
FT                   LTSSQSDLAHYTLKDPYIFDFLSVGKEAHKREVEKELTKHIEKFLLELGAGFAFVGRQY
FT                   HLEIGEQDFYIDLLFYHLKLRCFVVIELKDKDFKPEYAGKMNFYLSVIDDLLKHPNDNL
FT                   SIGLILCKSKNNVLAEYALRDMSKPIGLAEYKITENLPKEIKGELPTIEELEAELAKDF
FT                   "
FT                   /protein_id="YP_001495457.1"
FT   misc_feature    complement(7679..8629)
FT                   /note="Protein of unknown function (DUF1016); Region:
FT                   DUF1016; cl01979"
FT                   /db_xref="CDD:121012"
FT                   /locus_tag="A1I_00040"
FT   gene            complement(8771..9265)
FT                   /db_xref="GeneID:5646219"
FT                   /locus_tag="A1I_00045"
FT   CDS_pept        complement(8771..9265)
FT                   /locus_tag="A1I_00045"
FT                   /gene_family="HOG000010826" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG0513 Superfamily II DNA and RNA helicases"
FT                   /db_xref="GI:157826394"
FT                   /db_xref="GeneID:5646219"
FT                   /translation="MLADKKIVKVEVSKEHLKTLNEASTLLISCVDFRLIDETDKLMKQ
FT                   LGLEDDFDKVSLPGASLALVNEKYTHWGKTIEDTIEILQDLHNIKQIIFLDHRECGAYK
FT                   KLIAEERLSTKEKETEAHTEILNKARKIIKEKFPQLKVYTFLMGLDGVIEQIYERHPAD
FT                   C"
FT                   /protein_id="YP_001495458.1"
FT   gene            complement(9284..9829)
FT                   /db_xref="GeneID:5646220"
FT                   /locus_tag="A1I_00050"
FT   CDS_pept        complement(9284..9829)
FT                   /locus_tag="A1I_00050"
FT                   /gene_family="HOG000010898" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /transl_table="11"
FT                   /note="COG0558 Phosphatidylglycerophosphate synthase"
FT                   /db_xref="GI:157826395"
FT                   /db_xref="GeneID:5646220"
FT                   /translation="MKIDENLPNYLTIARIAAIPVIILTFYINSPLARMLGALLFVLAS
FT                   ITDFFDGYIARKYNLVTSFGKMLDPIADKLLVGCVIIMLLKKSDVDEIPCLLILAREFL
FT                   VSGLREFLALVKVSVPVSTLAKTKTFLQMFALSILVLGSKGSNIIYLDLVGEIILWIAA
FT                   FLTITTGYSYFKACKKYF"
FT                   /protein_id="YP_001495459.1"
FT   misc_feature    complement(9308..9814)
FT                   /note="CDP-alcohol phosphatidyltransferase; Region:
FT                   CDP-OH_P_transf; cl00453"
FT                   /db_xref="CDD:174212"
FT                   /locus_tag="A1I_00050"
FT   gene            complement(9853..11532)
FT                   /db_xref="GeneID:5646221"
FT                   /locus_tag="A1I_00055"
FT   CDS_pept        complement(9853..11532)
FT                   /locus_tag="A1I_00055"
FT                   /gene_family="HOG000101821" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative inner membrane protein translocase
FT                   component YidC"
FT                   /transl_table="11"
FT                   /note="functions to insert inner membrane proteins into the
FT                   IM in Escherichia coli; interacts with transmembrane
FT                   segments; functions in both Sec-dependent and -independent
FT                   membrane insertion; similar to Oxa1p in mitochondria"
FT                   /db_xref="GI:157826396"
FT                   /db_xref="GeneID:5646221"
FT                   /translation="MNNNIVNLVAAIVLSLGIIFGWQYFIVKPQQQKQQQQIALQKAKD
FT                   LKKKESAQLEATPVIVQEASQAPRIKIDSNALSGSISLKGLRFDDLILKKYKQDLSENS
FT                   PEVVLFSPSDTKDAYFAEIGWVSNLSSVKLPNNETIWNSDSEILTPEKPVNLFWVNEDG
FT                   VKFLVAITVDENYLFTIEQTIVNNSNQELPVQSYGLINRKYTAVEKAVNILHQGPIGCI
FT                   DENLKEYSYDDIKDKKSEKFSASKVDWIGITDKYWLTSLIPDKSSNYSSNFNYAVKQEV
FT                   ERYQVDFISPVQIVKPGENFSIKGRLFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWFYI
FT                   ITKPVFYAMNFFYKYVGNFGISILIVTVIIKLLMFTLANKSYRSMKRMKNLQPEINRIK
FT                   NLYGDDKARLNQEIMALYKKEKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPFYG
FT                   WIKDLSAPDPTSIFNLFGLLHFSLPSFLMIGAWPILMAITMFLQQRMSPEPADPVQAQV
FT                   MKFMPLVFLVMFSSFPAGLLIYWSWNNILSIIQQYYINKLDK"
FT                   /protein_id="YP_001495460.1"
FT   misc_feature    complement(9865..11337)
FT                   /note="putative inner membrane protein translocase
FT                   component YidC; Provisional; Region: PRK01318"
FT                   /db_xref="CDD:167210"
FT                   /locus_tag="A1I_00055"
FT   misc_feature    complement(9865..10461)
FT                   /note="60Kd inner membrane protein; Region: 60KD_IMP;
FT                   cl00489"
FT                   /db_xref="CDD:174237"
FT                   /locus_tag="A1I_00055"
FT   gene            complement(11826..12944)
FT                   /db_xref="GeneID:5646222"
FT                   /locus_tag="A1I_00060"
FT   CDS_pept        complement(11826..12944)
FT                   /locus_tag="A1I_00060"
FT                   /gene_family="HOG000199955" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG0668 Small-conductance mechanosensitive channel"
FT                   /db_xref="GI:157826397"
FT                   /db_xref="GeneID:5646222"
FT                   /translation="MLFVMLVSIIPLVFLIKKLIFVPVKNYLTRHHYEDYERVLKKYPI
FT                   FRYLLHSLLGIYFISWGNIFHPSSFKAHILLGIKDTIVILYVSLSFTMLLLTLIDAGAD
FT                   LYHNRIKTFAKKAPLSLYFQILKIFVMIISAMITISYLLNISLSAFLTSLGAAAALLTF
FT                   IFKDTMLGLIASLQLTSQDIINIGDWVHIGEVEGTVEKITISVVTIRNFDQSISTIPTS
FT                   SVLSSNVINYKGVDETGARRVKREFNINMATINFCDSTILTNLKKSPYLSKDVINKITL
FT                   DKDEKDLTNIKIFKLYVQEYLKNNPAIYTEGFTFLVRQLQPTVNGLPIEIYIFVKETSL
FT                   IGYEKVQADIFEHIISVLPEFKLKIFQNVGIV"
FT                   /protein_id="YP_001495461.1"
FT   misc_feature    complement(11850..12572)
FT                   /note="Mechanosensitive ion channel; Region: MS_channel;
FT                   pfam00924"
FT                   /db_xref="CDD:144501"
FT                   /locus_tag="A1I_00060"
FT   gene            13108..13899
FT                   /db_xref="GeneID:5647341"
FT                   /locus_tag="A1I_00065"
FT   CDS_pept        13108..13899
FT                   /locus_tag="A1I_00065"
FT                   /gene_family="HOG000098666" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /transl_table="11"
FT                   /note="transfers the N-acyl diglyceride moiety to the
FT                   prospective N-terminal cysteine in prolipoprotein"
FT                   /db_xref="GI:157826398"
FT                   /db_xref="GeneID:5647341"
FT                   /translation="MTFPNINPIIFSVGPLAVSWYSLSYVVGILFGWFYASKIIEKFPT
FT                   QITKKNLEEFVTYAIIGIIVGGRLGYILLYNPYKYFSNPIEILKTYEGGMSFHGGAIGV
FT                   IIAAYIFCKRHKLNFLSLTDIIAPVVPIGLFFGRIANFINGELYGRVTNSSIGVIFPDS
FT                   DLNLRHPSQLYEAFFEGLVLFCILAYAVFKRNTIKKQGLNSGLFLMFYSLFRIIIEIFR
FT                   EPDVQIGFIFDSLTMGQILSMPLLLLGIYLIIKTECRSITK"
FT                   /protein_id="YP_001495462.1"
FT   misc_feature    13108..13869
FT                   /note="Prolipoprotein diacylglyceryl transferase; Region:
FT                   LGT; cl00478"
FT                   /db_xref="CDD:174230"
FT                   /locus_tag="A1I_00065"
FT   gene            13878..14978
FT                   /db_xref="GeneID:5647342"
FT                   /locus_tag="A1I_00070"
FT   CDS_pept        13878..14978
FT                   /locus_tag="A1I_00070"
FT                   /gene_family="HOG000265463" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1565 Uncharacterized conserved protein"
FT                   /db_xref="GI:157826399"
FT                   /db_xref="GeneID:5647342"
FT                   /translation="MSIDHKIREIIEQSGYITCDRLMQEVLHVSPTSYYRQTKSLAEEG
FT                   DFTTAPEVSQLFGEIIGLWCIKEWQRIGSPKNLSIVELGPGRGLLMRDLLRTAKLVPEF
FT                   YNALSINLIDINENFIVQQKSNLQNFDLPINWYASIEDIPKKPALIIANEFFDAMPIKQ
FT                   YIKVKESWYERIFVVQPVDGKIKYDKIAVSKQLQEYLQKTHLDAKDGAVLEESYKSIEI
FT                   MKFISEHIKELGGSGLIIDYGYDINPNIRTRYQYNSTLQAIKNHKYCPIIENLGEEDLS
FT                   AHVDFYVLKTVAQNSKINVIDTISQRDFLIENGILLRKQTLQNKLNPEQAELIERQVNR
FT                   LISLKEMGGLFKVLQVMKTPPTVSPP"
FT                   /protein_id="YP_001495463.1"
FT   misc_feature    13878..14951
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG1565"
FT                   /db_xref="CDD:31753"
FT                   /locus_tag="A1I_00070"
FT   misc_feature    14058..14756
FT                   /note="Uncharacterized ACR, COG1565; Region: DUF185;
FT                   pfam02636"
FT                   /db_xref="CDD:145672"
FT                   /locus_tag="A1I_00070"
FT   gene            complement(15224..15703)
FT                   /db_xref="GeneID:5647343"
FT                   /locus_tag="A1I_00075"
FT   CDS_pept        complement(15224..15703)
FT                   /locus_tag="A1I_00075"
FT                   /gene_family="HOG000141924" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG3807 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="GI:157826400"
FT                   /db_xref="GeneID:5647343"
FT                   /translation="MIKILFALIAIILSTTINADNKKLPIPRFVSIKSNEVNARSGPTT
FT                   KAAIEWVFVKKGEPVEIIAEYEQWRQVRDIHGESGWIHSSILSGRRSVIIIADQEIELL
FT                   KHANIESRVIAKLMPKVRCGLKKCKEQFCQITCKNYTGWVLKKDLWGVYDDKDRY"
FT                   /protein_id="YP_001495464.1"
FT   misc_feature    complement(15437..15607)
FT                   /note="Bacterial SH3 domain; Region: SH3_3; cl02551"
FT                   /db_xref="CDD:141512"
FT                   /locus_tag="A1I_00075"
FT   misc_feature    complement(15251..15415)
FT                   /note="Bacterial SH3 domain; Region: SH3_3; cl02551"
FT                   /db_xref="CDD:141512"
FT                   /locus_tag="A1I_00075"
FT   gene            complement(15696..17423)
FT                   /db_xref="GeneID:5647344"
FT                   /locus_tag="A1I_00080"
FT   CDS_pept        complement(15696..17423)
FT                   /locus_tag="A1I_00080"
FT                   /gene_family="HOG000179076" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein KefB"
FT                   /transl_table="11"
FT                   /note="COG0475 Kef-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="GI:157826401"
FT                   /db_xref="GeneID:5647344"
FT                   /translation="MNDHILINVIVLLGTAVFIVAILKRFKLSPVLGYLIAGAAIGDHG
FT                   LKIVTYDQTKLLGELGVVFLLFAIGLELSFERLKAMRRYVFGLGTLQVLTTAIVIAGAM
FT                   VLIDGNSSAAIITGGGLALSSTALVMQVIEENRSQSTQIGRISLAILLLQDLAVVPLLV
FT                   IVPLLSGNSQASLATALGIAFLKAIVALLTIFVAGRVLLRPIFSFISSESNSANELPIS
FT                   MTLLIVLSAAWATETFGLSLALGAFVAGVLVAETEFRLQAEESIYPFKSLFLGLFFMTV
FT                   GMNIDALEMYEKLSHILTLSIALIGIKTLIITAFCILFGFNKGVAFYSGLLLSQGGEFA
FT                   FILFSLGKESGVLEESSANILLLVVTFTMALTPLLAALGQKIAEKVDKGLGKTPTQIIE
FT                   LGARDLTNHIIIAGLGNIGKMVARVLEAEGTSYVILDLDEDRVKEGLTDGFPVFKGDVS
FT                   QADTLKALGTDRALAIILTMNNQVTIKKSLKTVTANYPDMQVIVKLKSLKNSREFYDLG
FT                   ATTIIPESYETGLQIGGTVLKFIGISEQEINRIKVQFRLGNYIVAKKEDSLSEVEYND"
FT                   /protein_id="YP_001495465.1"
FT   misc_feature    complement(15750..17423)
FT                   /note="glutathione-regulated potassium-efflux system
FT                   protein KefC; Provisional; Region: PRK03562"
FT                   /db_xref="CDD:167546"
FT                   /locus_tag="A1I_00080"
FT   misc_feature    complement(16239..17423)
FT                   /note="Kef-type K+ transport systems, membrane components
FT                   [Inorganic ion transport and metabolism]; Region: KefB;
FT                   cl10482"
FT                   /db_xref="CDD:164194"
FT                   /locus_tag="A1I_00080"
FT   misc_feature    complement(15858..16199)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="A1I_00080"
FT   gene            complement(17434..17808)
FT                   /db_xref="GeneID:5647345"
FT                   /locus_tag="A1I_00085"
FT   CDS_pept        complement(17434..17808)
FT                   /locus_tag="A1I_00085"
FT                   /gene_family="HOG000016051" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Iojap-related protein"
FT                   /transl_table="11"
FT                   /note="COG0799 Uncharacterized homolog of plant Iojap
FT                   protein"
FT                   /db_xref="GI:157826402"
FT                   /db_xref="GeneID:5647345"
FT                   /translation="MILANIINIKIIYYSNMKKESEELKLFILECLNEKKAEDIDVIDL
FT                   SGKNKIADYIIFANGRSTKNVGAIAEYVALELKNKAGISTNIEGLGKSEWVLIDAGTIL
FT                   VNIFYPEARTHFKLEEIWKK"
FT                   /protein_id="YP_001495466.1"
FT   misc_feature    complement(17443..17739)
FT                   /note="Domain of unknown function DUF143; Region: DUF143;
FT                   cl00519"
FT                   /db_xref="CDD:174259"
FT                   /locus_tag="A1I_00085"
FT   gene            17880..18110
FT                   /db_xref="GeneID:5647346"
FT                   /locus_tag="A1I_00090"
FT   CDS_pept        17880..18110
FT                   /locus_tag="A1I_00090"
FT                   /gene_family="HOG000255170" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="BolA-like protein"
FT                   /transl_table="11"
FT                   /note="COG0271 Stress-induced morphogen (activity unknown)"
FT                   /db_xref="GI:157826403"
FT                   /db_xref="GeneID:5647346"
FT                   /translation="MAISVEELEKILKKSFPNGVIKITDLVGDQDHYALELSDIQFRGL
FT                   TLINQHKLVKNALSEVLNKKLHAITIKTIVI"
FT                   /protein_id="YP_001495467.1"
FT   misc_feature    17880..18104
FT                   /note="BolA-like protein; Region: BolA; cl00386"
FT                   /db_xref="CDD:174164"
FT                   /locus_tag="A1I_00090"
FT   gene            complement(18134..18208)
FT                   /db_xref="GeneID:5647347"
FT                   /locus_tag="A1I_t07957"
FT   tRNA            complement(18134..18208)
FT                   /db_xref="GeneID:5647347"
FT                   /locus_tag="A1I_t07957"
FT                   /product="tRNA-Thr"
FT   gene            complement(18331..18459)
FT                   /db_xref="GeneID:5646869"
FT                   /locus_tag="A1I_00095"
FT   CDS_pept        complement(18331..18459)
FT                   /locus_tag="A1I_00095"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:157826404"
FT                   /db_xref="GeneID:5646869"
FT                   /translation="MKNWLNNLLQTYLDSKNSEDAAIHFEEFYIFKEVDMCGKAFG"
FT                   /protein_id="YP_001495468.1"
FT   gene            complement(18475..19719)
FT                   /db_xref="GeneID:5646870"
FT                   /locus_tag="A1I_00100"
FT   CDS_pept        complement(18475..19719)
FT                   /locus_tag="A1I_00100"
FT                   /gene_family="HOG000141611" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proline/betaine transporter"
FT                   /transl_table="11"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="GI:157826405"
FT                   /db_xref="GeneID:5646870"
FT                   /translation="MNRKKIVFSSGIANTFEWYDYVLFGYFAPIIGTKFFPNDDANTSL
FT                   LQAFLVFAIGYLARPLGGIFFGVIGDKFGRKAALTGALFCMSAPTVLIGILPTYHTIGI
FT                   TATISMIVVRILQGLSMGGALTGSISFVIEHTHPKHRGFTGSISMSSICAGLLLGSFVS
FT                   YIVKNILNAEQFDSFGWRIPFLLGFFILFAAFYIKNHTHETPNFKNLKEQKKIQNSPLK
FT                   KVITKHWFDILISIFINAPGSIIFYLHAIYLVSFLKISRNFTENEVNSLASICYVIMIA
FT                   VTLLSGYLSDVIGRRKIFVINLVVIIIATPFLLNNFETGNFTGVIISQFILAVLAASYI
FT                   GPEPALQAEFYPTEIRNTALSLSYNTATTTFGGTTPLVFEYLVQKTGQVTSAVYYIILS
FT                   CILALIALFFYKNRT"
FT                   /protein_id="YP_001495469.1"
FT   misc_feature    complement(18628..19701)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="A1I_00100"
FT   misc_feature    complement(18535..19680)
FT                   /note="metabolite-proton symporter; Region: 2A0106;
FT                   TIGR00883"
FT                   /db_xref="CDD:162087"
FT                   /locus_tag="A1I_00100"
FT   misc_feature    complement(order(18628..18633,18640..18645,18676..18678,
FT                   18685..18690,18700..18702,18709..18714,18721..18723,
FT                   18871..18873,18883..18885,18892..18894,18904..18906,
FT                   18916..18918,18958..18960,18967..18972,18979..18984,
FT                   18991..18993,19252..19254,19270..19275,19282..19287,
FT                   19321..19323,19330..19335,19342..19347,19354..19359,
FT                   19519..19524,19528..19533,19543..19545,19552..19557,
FT                   19564..19566,19633..19638,19642..19650,19657..19659))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="A1I_00100"
FT   gene            complement(19716..20591)
FT                   /db_xref="GeneID:5646871"
FT                   /locus_tag="A1I_00105"
FT   CDS_pept        complement(19716..20591)
FT                   /locus_tag="A1I_00105"
FT                   /gene_family="HOG000264283" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="S-adenosylmethionine transporter"
FT                   /transl_table="11"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="GI:157826406"
FT                   /db_xref="GeneID:5646871"
FT                   /translation="MNDALKTYSIGIGWFLLSLVSSSANDVMSKYLGTRLHSFEVAFFR
FT                   FFFSSIVLLPFVVYYGKNTLKTSRPFVHILRGLLLFFGMTSWTYGLSIAPVTTATVISF
FT                   SIPLFTLILAVFFLNENIIWQRWVVTIVGFVGLVITLKPHAEDFNPEMLYFVLAAISFA
FT                   MLDIINKKFVVKESMISMLFYSAIVTAVVSIPAAANYWLTPTLFELALLFILGSSGSLI
FT                   LFLLLKAFSMVDATATAPYRYLELVISAIAAYFIFNEFPDKSTLHGAVIIIPATLFIIY
FT                   SEKKAMSKKI"
FT                   /protein_id="YP_001495470.1"
FT   misc_feature    complement(20169..20534)
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="A1I_00105"
FT   misc_feature    complement(19761..20384)
FT                   /note="Carboxylate/Amino Acid/Amine Transporter; Region:
FT                   2A78; TIGR00950"
FT                   /db_xref="CDD:162128"
FT                   /locus_tag="A1I_00105"
FT   gene            20743..21480
FT                   /db_xref="GeneID:5646872"
FT                   /locus_tag="A1I_00110"
FT   CDS_pept        20743..21480
FT                   /locus_tag="A1I_00110"
FT                   /gene_family="HOG000010626" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="OmpW family outer-membrane protein"
FT                   /transl_table="11"
FT                   /note="COG3047 Outer membrane protein W"
FT                   /db_xref="GI:157826407"
FT                   /db_xref="GeneID:5646872"
FT                   /translation="MIRMSKRLGVILFVSCISINSFAKSMEADVNAVPEYNYDNIPYYE
FT                   NEGSLLVKMRLNGVFAHAKQKNLPAPTVPQPLPVGEFVKNGYGGDISTTIFFNNYFATE
FT                   LSLGFNVLRTKNSVLSNVSYNYGVGATPGKSKPLYMIPATITGQFHVAPFGGIRPYVGL
FT                   GYHGSYMITQSSGIKIRNGNGFVGQIGLDFYAKDDTVINLDIKQYYLNPKIVYKPSLVG
FT                   NQNITSRTKLNPLVVSIGIGFSF"
FT                   /protein_id="YP_001495471.1"
FT   misc_feature    20791..21477
FT                   /note="Surface antigen; Region: Surface_Ag_2; cl01155"
FT                   /db_xref="CDD:174558"
FT                   /locus_tag="A1I_00110"
FT   gene            21905..22093
FT                   /db_xref="GeneID:5646873"
FT                   /locus_tag="A1I_00115"
FT   CDS_pept        21905..22093
FT                   /locus_tag="A1I_00115"
FT                   /gene_family="HOG000011922" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:157826408"
FT                   /db_xref="GeneID:5646873"
FT                   /translation="MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNK
FT                   DILANSLTVVETKADMN"
FT                   /protein_id="YP_001495472.1"
FT   gene            22099..22860
FT                   /db_xref="GeneID:5646874"
FT                   /locus_tag="A1I_00120"
FT   CDS_pept        22099..22860
FT                   /locus_tag="A1I_00120"
FT                   /gene_family="HOG000130877" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="GI:157826409"
FT                   /db_xref="GeneID:5646874"
FT                   /translation="MYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKALGLYGK
FT                   ERADKLEVFKPESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSCINMIDV
FT                   LSNQITEITNQVEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKLTRRQIA
FT                   SLAGLAPKANDSGKYQGYRKVGHGRAGVKPILFLAAMSARNSKTSGLRLFYERLINNGK
FT                   KKMVALTALMRKIIVIANAKLKSLLFNLKHS"
FT                   /protein_id="YP_001495473.1"
FT   misc_feature    22108..22362
FT                   /note="Transposase; Region: Transposase_9; pfam01548"
FT                   /db_xref="CDD:144952"
FT                   /locus_tag="A1I_00120"
FT   misc_feature    22489..22743
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="A1I_00120"
FT   gene            22959..24356
FT                   /db_xref="GeneID:5646328"
FT                   /locus_tag="A1I_00125"
FT   CDS_pept        22959..24356
FT                   /locus_tag="A1I_00125"
FT                   /gene_family="HOG000243958" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NAD(p) transhydrogenase subunit beta"
FT                   /transl_table="11"
FT                   /note="COG1282 NAD/NADP transhydrogenase beta subunit"
FT                   /db_xref="GI:157826410"
FT                   /db_xref="GeneID:5646328"
FT                   /translation="MSLQIIQLLYLVAAICFILSLKFLSSQKQARLGNTIGILGMTIAV
FT                   GVTFFLPDFAHKLPIIATILVGGIIGGVIALKISMTAMPQLVAGFHSFVGLAAVFVSYA
FT                   TVLAPENFAIGIAGSLTISSLIEISLGVSIGALTFSGSIIAFLKLQGLMKSSPLKFYGQ
FT                   QYVCLLTTILLVALIVLFIRSENIFLFNLIILLSLLIGVLLIIPVGGADMPVIVSMLNS
FT                   YSGFAAAGIGFTLSNSLLIITGALVGSSGAILSYIMCKAMNRSLIKVIFGAFLPAPSGA
FT                   SKNIDDDKIAKASCPEDAANLLRNASSVIIVPGYGMAVAQSQHIIKEMVDILEGLDVNV
FT                   RFAVHPVAGRMPGHMNVLLAEANIDYEKVLELEEINRDFATTDIVLVIGANDVTNPAAK
FT                   NDPDSPIYGMPVLDVEKARSVLFIKRSMASGYAGIENELFYHDNTFMLFGDAKKVVEEI
FT                   VKFLNED"
FT                   /protein_id="YP_001495474.1"
FT   misc_feature    22968..24344
FT                   /note="NAD(P) transhydrogenase beta subunit; Region: PNTB;
FT                   cl00566"
FT                   /db_xref="CDD:174288"
FT                   /locus_tag="A1I_00125"
FT   gene            24411..24980
FT                   /db_xref="GeneID:5646329"
FT                   /locus_tag="A1I_00130"
FT   CDS_pept        24411..24980
FT                   /locus_tag="A1I_00130"
FT                   /gene_family="HOG000142626" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG3820 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="GI:157826411"
FT                   /db_xref="GeneID:5646329"
FT                   /translation="MNSQKILPLLPKATAMWLIENTSLTFKQIADFCGIHELEIKGMAD
FT                   GEVAQSIKGLDPIANGQLTLEEIDRCSKDPKNVLQISHSPAYELMKNQKKQRAKYTPIA
FT                   RRQDKPDAIYWLLRNYPDIQDNQVVKLIGTTKTTIDAIRTRSHWNMKSIHPRDPVLLGL
FT                   CRQVELNKVVAVLESASSHNKETKES"
FT                   /protein_id="YP_001495475.1"
FT   misc_feature    24420..>24977
FT                   /note="Protein of unknown function (DUF1013); Region:
FT                   DUF1013; cl11533"
FT                   /db_xref="CDD:159521"
FT                   /locus_tag="A1I_00130"
FT   gene            complement(25138..25494)
FT                   /db_xref="GeneID:5646330"
FT                   /locus_tag="A1I_00135"
FT   CDS_pept        complement(25138..25494)
FT                   /locus_tag="A1I_00135"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative colicin V production membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:157826412"
FT                   /db_xref="GeneID:5646330"
FT                   /translation="MGLLAGFAVGAAISAVIFFITMIFTSENYYKSKSLEDFIASSKSN
FT                   KYSGVLKDSLTTEYFDELNKNIIVIIPVETLKSVKTLNSKDLGNFKSNDENNQSSQELD
FT                   DELNDNDAFSDVDD"
FT                   /protein_id="YP_001495476.1"
FT   gene            25875..26444
FT                   /db_xref="GeneID:5646331"
FT                   /locus_tag="A1I_00140"
FT   CDS_pept        25875..26444
FT                   /locus_tag="A1I_00140"
FT                   /gene_family="HOG000281193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1678 Putative transcriptional regulator"
FT                   /db_xref="GI:157826413"
FT                   /db_xref="GeneID:5646331"
FT                   /translation="MNDKIFYNLSGKTLVSTPYVITKGIYHKSLIYMLSHTEEGAIGLM
FT                   FNRLVNHIDLKSFFKIKNDEIVNPVMVPIYLGGPVEHEKGFFLHSTDYNKNLLLDFHND
FT                   LAVSSNLEISEDIAFGKGPKNSLLIVGYTGWKAGQLEKELEENLWLVMDCDKEFIFADN
FT                   PENKWHNALKHLGIDEAHFSSQVGSA"
FT                   /protein_id="YP_001495477.1"
FT   misc_feature    25875..26441
FT                   /note="Uncharacterized ACR, COG1678; Region: DUF179;
FT                   cl00731"
FT                   /db_xref="CDD:174365"
FT                   /locus_tag="A1I_00140"
FT   gene            26749..27660
FT                   /db_xref="GeneID:5646332"
FT                   /locus_tag="A1I_00145"
FT   CDS_pept        26749..27660
FT                   /locus_tag="A1I_00145"
FT                   /gene_family="HOG000036278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Signal recognition particle-docking protein FtsY"
FT                   /transl_table="11"
FT                   /note="COG0552 Signal recognition particle GTPase"
FT                   /db_xref="GI:157826414"
FT                   /db_xref="GeneID:5646332"
FT                   /translation="MISIFSKLKQGLSKTSGKISAGIDKIFYKKKLDAETLEELEELLI
FT                   STDMGSLVAAKIIEDFKSLKFDKEVETTEIKETLANLIEQQLLESEIPFTLNENKLNVV
FT                   LVCGVNGAGKTTTIGKLAAMYGMQGKKVAVAACDTFRAAAVNQLDSWVTRAKALLITGE
FT                   EAADPASVAYRAVEESIKQDIDILFIDTAGRLHNKKNLMDELTKIVKVIKKVDENLPTH
FT                   SVLVIDAITGQNTYNQVEHFNDATNLTGLIVTKLDGSAKAGVIVGVVQRFNLPIYFIGI
FT                   GEQIEDLKIFNRHDFAKSLVGL"
FT                   /protein_id="YP_001495478.1"
FT   misc_feature    26770..26997
FT                   /note="SRP54-type protein, helical bundle domain; Region:
FT                   SRP54_N; pfam02881"
FT                   /db_xref="CDD:145830"
FT                   /locus_tag="A1I_00145"
FT   misc_feature    26839..27651
FT                   /note="signal recognition particle-docking protein FtsY;
FT                   Region: ftsY; TIGR00064"
FT                   /db_xref="CDD:161686"
FT                   /locus_tag="A1I_00145"
FT   misc_feature    27052..27588
FT                   /note="The signal recognition particle (SRP) mediates the
FT                   transport to or across the plasma membrane in bacteria and
FT                   the endoplasmic reticulum in eukaryotes. SRP recognizes
FT                   N-terminal sighnal sequences of newly synthesized
FT                   polypeptides at the ribosome. The...; Region: SRP; cd03115"
FT                   /db_xref="CDD:48379"
FT                   /locus_tag="A1I_00145"
FT   misc_feature    27070..27093
FT                   /note="P loop; other site"
FT                   /db_xref="CDD:48379"
FT                   /locus_tag="A1I_00145"
FT   misc_feature    order(27160..27162,27325..27327,27508..27510,27517..27522)
FT                   /note="GTP binding site; other site"
FT                   /db_xref="CDD:48379"
FT                   /locus_tag="A1I_00145"
FT   gene            28699..31131
FT                   /db_xref="GeneID:5646333"
FT                   /locus_tag="A1I_00160"
FT   CDS_pept        28699..31131
FT                   /locus_tag="A1I_00160"
FT                   /gene_family="HOG000011929" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG2956 Predicted N-acetylglucosaminyl transferase"
FT                   /db_xref="GI:157826415"
FT                   /db_xref="GeneID:5646333"
FT                   /translation="MINHPKHPKHPRYIREKQISSTNSSSQESITSNKNETQTKQVEES
FT                   TKTVAKLGIEKEIENIFESENFINLVNKYSDESIFSKNKKVLIILGQEQEDLNIIVNFF
FT                   KDNKLSLERNTHKDWYFSKKNPVDNPEILDSFRGYVTYKSPYLNSKASTQELTLDKFLL
FT                   PKILSTAPTKFILAVKNIDTTKNAEEGIKNIAQIFKKFTQLLGNVDINEGNVAIVVTDS
FT                   KPDDDKERISNIFHDAIELCNFNDKQKSFINKIQDSIYLLPQVSEQAKDYKALPSFKSG
FT                   NYITQNENNKITIDEKLIPYFIIQTVKNNITNEVSKFKELVYAKWEKEKSLVFKFKVSN
FT                   NTDKLQKLVETIKNYKATDNSNKTIGSFLEVVKELNQILETPNSKLESFLNYLKHFCDT
FT                   KLSDQHDLDIIDVKDWFSTLFAPFNKINLEAELIESFKTVLKSDEFSFVGKLNDAIKDF
FT                   YQDIKNSKILDINQINNIENLKAFLKSIKDAKIQNLKDITDTLTNNIHCISFKSLDMSK
FT                   IILDSISNFKKLVSSISEQEAKSLWSCITAFKSIDEKSFTEVIYSKLLHSQIAPMQGQS
FT                   AYNSLGELLIATHGSIAFHNKQDELYKNQLAEIYCQHAQVVNTPSAIDLYKKAAALDSV
FT                   KANIKLGNIYLQQREYAKALEYLRKTKCIDDEKKAFKGLIDEMKHNPEINDRNLADEYL
FT                   LQAGYYEKHSRIDDATKAYLIAIGKMEGIVEPKDYLKLSKIYTNLAKIVLPSNNNKTEY
FT                   FMQATGYKVLAEKFDIPQKIEQDTSVDLSRPIYDPKDVLLSGDNSSNDSDYYSDSGN"
FT                   /protein_id="YP_001495479.1"
FT   misc_feature    <29737..>30051
FT                   /note="Secretory pathway protein Sec39; Region: Sec39;
FT                   pfam08314"
FT                   /db_xref="CDD:149389"
FT                   /locus_tag="A1I_00160"
FT   misc_feature    <30481..>30678
FT                   /note="tetratricopeptide repeat protein; Provisional;
FT                   Region: PRK11788"
FT                   /db_xref="CDD:171284"
FT                   /locus_tag="A1I_00160"
FT   gene            31206..31874
FT                   /db_xref="GeneID:5646334"
FT                   /locus_tag="A1I_00165"
FT   CDS_pept        31206..31874
FT                   /locus_tag="A1I_00165"
FT                   /gene_family="HOG000010616" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:157826416"
FT                   /db_xref="GeneID:5646334"
FT                   /translation="MTQDYPADDTKKIAEQIKDALMGISDSLVLESTEVEELFEELSQS
FT                   EDFEYEIEQILAILNEQTMDLTQLQSQIILLIRKYLGKTKNLKLKMLKMDEKLISKNIS
FT                   EVSNYLMHQHSKIVRDANKNLANQKDKLQGLTKQARIDLKRLIKSFAVYQIYMFMNPKR
FT                   IAGETKLMNFAYNFIRGGMKLAQKYEGGKPRDIKSYSPKLIKKLERARAGFKKSGGISI
FT                   "
FT                   /protein_id="YP_001495480.1"
FT   gene            32335..33651
FT                   /db_xref="GeneID:5646524"
FT                   /locus_tag="A1I_00170"
FT   CDS_pept        32335..33651
FT                   /locus_tag="A1I_00170"
FT                   /gene_family="HOG000063856" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="folate synthesis bifunctional protein"
FT                   /transl_table="11"
FT                   /note="COG0801
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /db_xref="GI:157826417"
FT                   /db_xref="GeneID:5646524"
FT                   /translation="MIYISIGSNLGNRFLNIRRALNLLKSHGFVLLRQSIIFETQAILP
FT                   PNADSSWDRPYYNMVVQGTTALLPNALLTVLKKIEQQIGRKENYDKWCPRVIDLDILLW
FT                   DSYHIDLPDLKIPHSQLLNRPFLIHLIASLSIECRYICPDNNLYNDKAFAEIAHLIENQ
FT                   GVIRSLVLNPQFVGILNITPDSFSDGGLSFHKEDAVKNFVHLMDAGSSMIDLGAQSTRP
FT                   SAFMISEDEEYTGLDSVLEELKGVIEKTEALISIDSFSPEVIKRILKKYPVHCINLVKT
FT                   NLDNDTLRLIADYNCKIVIMHSLTVPPQKQQCLDFDKSLIISLNIWAEQEIAKLEKCGF
FT                   DRKDIIFDPGIGFGKSVYQNLHILQNIQEFKKLGCEILVGHSRKSYISTFYNSIAKERD
FT                   LETIAISKYLAENGVNYLRVHNVEDHQRFFVTQAYTLNK"
FT                   /protein_id="YP_001495481.1"
FT   misc_feature    32338..32736
FT                   /note="7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
FT                   (HPPK). Folate derivatives are essential cofactors in the
FT                   biosynthesis of purines, pyrimidines, and amino acids as
FT                   well as formyl-tRNA. Mammalian cells are able to utilize
FT                   pre-formed folates after...; Region: HPPK; cd00483"
FT                   /db_xref="CDD:29601"
FT                   /locus_tag="A1I_00170"
FT   misc_feature    order(32353..32355,32452..32457,32461..32463,32500..32502,
FT                   32506..32508,32551..32553,32563..32565,32572..32574,
FT                   32587..32589,32593..32595,32608..32610,32617..32619,
FT                   32626..32628,32632..32637,32677..32679,32686..32691,
FT                   32704..32706,32710..32712)
FT                   /note="catalytic center binding site; other site"
FT                   /db_xref="CDD:29601"
FT                   /locus_tag="A1I_00170"
FT   misc_feature    order(32551..32553,32563..32565,32572..32574,32587..32589,
FT                   32593..32595,32617..32619,32632..32637,32677..32679,
FT                   32686..32691,32704..32706)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29601"
FT                   /locus_tag="A1I_00170"
FT   misc_feature    32851..33621
FT                   /note="DHPS subgroup of Pterin binding enzymes. DHPS
FT                   (dihydropteroate synthase), a functional homodimer,
FT                   catalyzes the condensation of p-aminobenzoic acid (pABA) in
FT                   the de novo biosynthesis of folate, which is an essential
FT                   cofactor in both nucleic acid and...; Region: DHPS;
FT                   cd00739"
FT                   /db_xref="CDD:29545"
FT                   /locus_tag="A1I_00170"
FT   misc_feature    order(32872..32874,33103..33105,33163..33165,33169..33171,
FT                   33235..33237,33376..33378,33472..33474,33484..33486,
FT                   33586..33588,33592..33594)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29545"
FT                   /locus_tag="A1I_00170"
FT   misc_feature    order(33415..33417,33427..33432,33544..33546,33556..33558,
FT                   33568..33570,33613..33618)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29545"
FT                   /locus_tag="A1I_00170"
FT   misc_feature    33478..33486
FT                   /note="inhibitor binding site; inhibition site"
FT                   /db_xref="CDD:29545"
FT                   /locus_tag="A1I_00170"
FT   gene            33660..34163
FT                   /db_xref="GeneID:5646525"
FT                   /locus_tag="A1I_00175"
FT   CDS_pept        33660..34163
FT                   /locus_tag="A1I_00175"
FT                   /gene_family="HOG000040233" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydrofolate reductase"
FT                   /transl_table="11"
FT                   /note="COG0262 Dihydrofolate reductase"
FT                   /db_xref="GI:157826418"
FT                   /db_xref="GeneID:5646525"
FT                   /translation="MKNRKITGIMACDPKGVIGLKGRMPWSYPEEFEYFYQIVKNNIIV
FT                   MGHKTFDSLPPKILQNCICIVFSRNTPTSDNDVFFVESLDEFWQVIEIFADKKIFMVGG
FT                   AEIATFFLKQNLLDEFLLTRINNDYEGDAFFPLDLLKGWDSMMIYKTNNYQIYKFTKNA
FT                   IMNI"
FT                   /protein_id="YP_001495482.1"
FT   misc_feature    33675..34139
FT                   /note="Dihydrofolate reductase (DHFR). Reduces
FT                   7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH as
FT                   a cofactor. This is an essential step in the biosynthesis
FT                   of deoxythymidine phosphate since 5,6,7,8-tetrahydrofolate
FT                   is required to regenerate 5,10...; Region: DHFR; cd00209"
FT                   /db_xref="CDD:29264"
FT                   /locus_tag="A1I_00175"
FT   misc_feature    order(33684..33686,33735..33737,33750..33752,33843..33845,
FT                   33963..33965,33981..33983,34026..34028)
FT                   /note="folate binding site; other site"
FT                   /db_xref="CDD:29264"
FT                   /locus_tag="A1I_00175"
FT   misc_feature    order(33690..33692,33711..33713,33801..33809,33864..33866,
FT                   33966..33977)
FT                   /note="NADP+ binding site; other site"
FT                   /db_xref="CDD:29264"
FT                   /locus_tag="A1I_00175"
FT   gene            34181..35263
FT                   /db_xref="GeneID:5646526"
FT                   /locus_tag="A1I_00180"