(data stored in SCRATCH zone)

HOGENOMDNA: SAENT1_2

ID   SAENT1_2; SV 1; empty ; DNA; empty ; PRO; 93939 BP.
XX
AC   NC_003277;
XX
PR   Project: 57799;
XX
DE   Salmonella typhimurium LT2 plasmid pSLT, complete sequence.
XX
OS   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Salmonella; Salmonella enterica subsp. enterica
OC   serovar Typhimurium.
XX
RN   [1]
RP   1-93939
RX   PUBMED; 11677609.
RA   McClelland,M., Sanderson,K.E., Spieth,J., Clifton,S.W., Latreille,P.,
RA   Courtney,L., Porwollik,S., Ali,J., Dante,M., Du,F., Hou,S., Layman,D.,
RA   Leonard,S., Nguyen,C., Scott,K., Holmes,A., Grewal,N., Mulvaney,E.,
RA   Ryan,E., Sun,H., Florea,L., Miller,W., Stoneking,T., Nhan,M., Waterston,R.
RA   and Wilson,R.K.;
RT   "Complete genome sequence of Salmonella enterica serovar Typhimurium LT2";
RL   Nature 413 (6858), 852-856 (2001)
XX
RN   [2]
RP   1-93939
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (10-SEP-2004) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-93939
RG   NCBI Microbial Genomes Annotation Project
RT   "Direct Submission";
RL   Submitted (11-JUN-2003) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
CC   REVIEWED REFSEQ: This record has been curated by NCBI staff. The
CC   reference sequence was derived from AE006471.
CC   REFSEQ gene predictions performed by GenMark 2.4/Genemark.hmm 2.0
CC   with comparison to original submitter provided annotation.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..93939
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:99287"
FT                   /note="conjugative plasmid that also encodes virulence
FT                   functions"
FT                   /strain="SGSC1412"
FT                   /plasmid="pSLT"
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Typhimurium str. LT2"
FT   gene            94..378
FT                   /db_xref="GeneID:1256238"
FT                   /locus_tag="PSLT001"
FT   CDS_pept        94..378
FT                   /locus_tag="PSLT001"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative cytoplasmic protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:17233404"
FT                   /db_xref="GeneID:1256238"
FT                   /translation="MFKYWPTFVQQWENSLKAAQKGLEIWKSARADAWLAYHNGIFATS
FT                   HYEGALTSEDISSAAAAALKGHKIRGGNVNTKSILDGSNRLAHTLALQG"
FT                   /protein_id="NP_490493.1"
FT   misc_feature    <97..375
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:185959"
FT                   /locus_tag="PSLT001"
FT   gene            712..1155
FT                   /db_xref="GeneID:1256237"
FT                   /locus_tag="PSLT002"
FT   CDS_pept        712..1155
FT                   /locus_tag="PSLT002"
FT                   /gene_family="HOG000222239" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative phospholipase D"
FT                   /transl_table="11"
FT                   /db_xref="GI:17233405"
FT                   /db_xref="GeneID:1256237"
FT                   /translation="MFIPAGLPASYCGTVRSGRFFTGGQRKQLVLKTIEAAQHNIRLME
FT                   YSFTSPEVAGALISAKRRGVDVRGGGLDWKANTGKNNNASRVTMNLLTSAGIPVRTVSV
FT                   YKILHDKVIVSDGRHTEVGSFNYSRAADRSNSENVLSSGMTQS"
FT                   /protein_id="NP_490494.1"
FT   misc_feature    793..1125
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="PSLT002"
FT   misc_feature    order(1036..1038,1042..1044,1081..1083,1087..1089,
FT                   1120..1122)
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="PSLT002"
FT   misc_feature    order(1036..1038,1042..1044,1057..1059,1078..1083,
FT                   1087..1089)
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="PSLT002"
FT   gene            1334..1600
FT                   /db_xref="GeneID:1256235"
FT                   /locus_tag="PSLT003"